2I2BA

Crystal structure of lmnadk1 from listeria monocytogenes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
263
structure length
258
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 69
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2bA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2bA01
3VZCA 3V7YA 3V8QA 5DHPA 3V7UA 2I2BA 3V8NA 2BONA 4L02A 3VZBA 3VZDA 1U0RA 4V24A 4DY6A 5DHSA 2JGRA 3AFOA 2I1WA 5DHUA 5DHQA 4HAOA 4WERA 2I2AA 5EJHA 3T5PA 3V8RA 2QV7A 2QVLA 1Z0UA 1SUWA 5EJGA 5EJFA 3S40A 1Z0ZA 2P1RA 1Y3IA 2I2FA 3V8MA 3PFNA 4WRRA 2Q5FA 5DHTA 1Y3HA 2AN1A 3V7WA 1U0TA 3V8PA 2I2DA 2I2CA 5EJIA 1YT5A 1Z0SA 2I29A 3V80A 5DHRA
chains in the Genus database with same CATH superfamily
3MNFA 1QG6A 1M8PA 1BCRB 1AK2A 4N47A 4I5DA 1HQYE 5HKBA 1RJEA 3LP5A 1ODJA 4IIVA 4RH3A 1AQUA 3FR7A 2VPYA 3M6LA 4LZLA 2NU6B 4X7RA 1O58A 2QI9F 4URVR 1AX9A 1JXOA 3K0AA 3N7UA 3ANXA 3VV2A 2QD5A 4MQFB 3PENA 4I6JA 4B7ZA 5AM0A 3EY4A 3I64A 3FVRA 1F6WA 4YPOA 1BIFA 1PZMA 3LT0A 3WRYA 2CV1A 1X39A 2HL6A 1JIKA 5EIEA 2O59A 3MJEA 3OO0A 5EIBC 1D2NA 3E7PA 3CVXA 2WKRA 1VRWA 2X5KO 1TKBA 3RUHA 3RTEA 2NTNA 4FU0A 2JQIA 4H0FA 5TEVA 3STUA 1OD6A 5KNDD 1RAFA 4BUZA 3IBFA 2OYSA 4OHUA 2ARKA 3KQPA 2JIOA 3G5UA 4YI5A 4LSGA 1DQZA 4UTPA 5KWIA 4Z4EA 2OWDA 1UBFA 4MP3A 1H5NA 3SKVA 1DJLA 2F64A 2V45A 1V1MA 3GAZA 4QVKA 3S6JA 3WGJA 4N41A 1DRJA 1W88B 3NI2A 5IFKA 4UAJA 2EFYA 1VZ2A 2ZR9A 4B75A 4M9UA 4XM0A 3BGOS 3TR5A 4Z0HO 2GX6A 2QP4A 2Q27A 2DX7A 4P93A 4NK4A 4ZT4A 4D8YA 1V95A 2VJMA 3ECSA 5K05A 3A77A 1B8PA 1E7WA 1QRRA 1Y5MA 4JA0A 5L7WA 1FNSA 2YBDA 3G8DA 1GRVA 3FOBA 3JASB 1F7VA 1UJCA 4EJFA 5B1DA 2G25A 3KYDB 2G1LA 3UPTA 2FEKA 3L7CA 5HQTA 4RHXA 3GFGA 1JGTA 3B5JA 2LRHA 3IKMB 1XTJA 3MT8A 4IWXA 3HNPA 4NYMQ 2YX1A 3RUPA 2B2NA 1W4RA 4U7GA 3U13A 4B8WA 1SK9A 1XCMA 1MB3A 4M7RA 4ONEA 5A8IA 4Y0VA 2IVFA 1MTZA 3CG0A 2WWWA 1X7HA 2DHQA 3DTTA 1TA9A 3A1TA 3GEIA 3GNQA 4TWIA 1V9LA 4UOEA 4I0WB 1WSBA 3G17A 2QL5A 5THQA 4I3HA 1QSGA 4A10A 4BNMA 1AKYA 1U11A 3VTKA 3DV0B 4NZOA 1JDVA 3TTVA 2CMHA 2QY9A 1DNPA 1VCOA 1RAGA 1IBCA 1M3SA 2FUNB 3BAFA 4B73A 2EFJA 2HMVA 2DTEA 4Q4LA 2RK3A 2YWFA 3MJFA 2DF8A 4CR8A 4ENQA 2AOXA 4HDKA 4KC0A 4DSAA 1S8OA 1USKA 1DG1G 3SCZA 1B0AA 3MLAA 3WBJA 4KQEA 1LDBA 1IZ9A 3FCSB 3OPXA 5EXXA 4BZWA 5C8ZA 2V7EA 1RI3A 1XR3A 1RZRA 4NBRA 1KHXA 1U7VA 2BMVA 2C4TA 3OEHA 1FMTA 4LX8A 2C5HA 4NWIA 4WLNA 5JYCA 2COKA 3H5RA 4AZ0B 5CM9C 1Y6RA 4H7KA 1L0BA 3CNEA 2VNAA 1FTQA 2BR3A 4OUDA 4WCFB 5CTAA 4E30A 4K88A 1SURA 4KLCA 2GTIA 3RIMA 2JKZA 3LVFO 3FDXA 3OM1A 2Q6IA 4B3CA 3R5XA 2QRKA 5FWXA 2YWEA 3R7NA 4TRJA 2PUJA 1BE1A 4HDRA 2RGYA 4LBWA 4KO3S 1XLUA 3GQBB 1MK2A 4AMZA 3H7AA 4Z7OB 3H3XA 1DAFA 5FPHA 2F8MA 3OQIB 2C7QA 1RSZA 1FSFA 1YU6A 2QBYB 3SSAA 3C3YA 1X2BA 2A3NA 1XSEA 2N46A 4NBVA 4P36A 4D96A 1XJQA 3VZBA 3ZD9A 4ZYZA 4HOYA 5JY1A 1C1YA 3AFMA 2OFFA 4KU0D 1S8NA 1ML3A 2GLTA 1U3FA 4YCLA 1VYHA 2I2AA 2ZAOA 4YCCA 1QO9A 4K03A 5ENZA 3N2ZB 2HB6A 5DVZA 3I8XA 2GZ3A 3U4DA 3UYLA 3WLMA 4XCQA 3LDGA 3TW6A 3N2GA 4HWRA 1A82A 2J7KA 2VLBA 2ZJOA 1RAEA 4H31A 1W2HA 1ZMRA 4UEJA 3UOGA 3UGJA 3EIUA 3BKXA 4ZYUA 2JFXA 1ZQ1A 1YKSA 3R9KA 1YGYA 2C1ZA 4OMFG 5BR1A 3DWEX 3IEIA 2GCIA 2YRXA 2Q6OA 3OZAA 5LFAA 2F4VB 1U3GA 1Z4OA 2ZJ3A 3OOEA 1NUQA 4RNCA 5FUWA 2I62A 3LQ4A 4A26A 1E2QA 10MHA 4LYEA 5HTKA 1Y7IA 3HY3A 4AJNA 3HV2A 1KZHA 3TS1A 5EQDA 3ORQA 1JYFA 1ZUNA 2C8JA 4AY4A 3QA3E 3Q8MA 1BKSB 2QMQA 2CFOA 1QFSA 1JSXA 3KJHA 1B1CA 1YQXA 2V7XA 3TCKA 1SQ0A 3TMKA 5KPJA 3KSAC 4O1HA 1TE2A 1DOZA 4FBGA 4RK0A 3VVCA 3J81k 4IDEA 2FJ0A 3DDOA 3ZXSA 1BWSA 2ZE8A 5J4LA 1JE1A 1T6BY 5JJCA 2DE0X 1WUTA 1XAJA 2VQFB 1P19A 3CRZA 2GRAA 4NF2A 3AEYA 3FI9A 1ZL0A 2VZ9A 1BO6A 4RW0A 3SYMA 3WKDA 1RD4A 4BC0A 4W5RA 2GHIA 3HDGA 4O08A 2WOOA 3QQPA 2VPXA 3VAZA 3A7DA 1NX9A 3HCCA 2R97A 3PNPA 3INRA 2VDPB 3VU8A 3DLBA 4PC1A 3L7LA 3LPMA 3JY6A 2HMTA 2ODQA 3BIWA 3N7TA 4XH9B 1DL5A 1ZHHA 1M6WA 5C37A 5LQRA 4IZHA 1PT6A 3IV6A 2OZLA 3KR0A 1G5RA 1J5PA 2D62A 2PYIA 4G36A 4AI6A 4WCVA 3Q3IA 4CM5A 2X9GA 2ADOA 3A1WA 3D5QA 1DEVA 5I7HA 2DWCA 4C0HA 1KDTA 4E7PA 4AF8A 2OV1A 2QUAA 1BJTA 5AVZA 1GU0A 2FX3A 1FPQA 4N6OA 2IPLA 2IHVA 4UE6A 3V4ZA 1HNXB 3C7TA 3KUKA 1E7SA 2WWIA 4UMDA 4UM9D 3DBHA 1VIYA 1KU0A 1RXEA 1AB5A 1GKKA 1NIJA 3RU7A 4JODA 1FQOA 2ATIA 1QHGA 4Q3BA 1DQYA 4F21A 2BGMA 4YAGA 5DYTA 2PUWA 2BFFB 1UWLA 4G84A 1T2CA 2GAFA 1PJSA 5DN9A 4ZVTA 4ASUA 1U9IC 4C7OA 1V11B 2OP0A 5C53B 2C57A 5TDHA 3E03A 2JLWA 1JDBB 2YWGA 3BK2A 2WTEA 1JYSA 3NB0A 4A0FA 5AW9A 3KD2A 4IKEA 3P4YA 3I34X 2QRNA 4E4RA 1ZJ5A 2QT9A 4K6KA 4UC0A 1YJXA 3HUUA 1DQPA 3JSXA 2ISSD 3G9XA 4BFWA 1L8OA 3O83A 2IZOA 4OHBA 1RHRA 4XGQA 3V4VB 1ACLA 4QUAA 4BMNA 1WMFA 4XM1A 3AMVA 3ZV7A 1X7YB 1J0XO 1UJNA 2IK8A 1QQAA 3CISA 4KGZA 1NPTO 5HIIA 3VYWA 3IUPA 2V7TA 3LBIA 4YYEA 3BJIC 1LJ8A 4R7ZA 4HVTA 2J3LA 1P31A 1WUYA 3KCQA 4NY1A 4G8DA 3U3OA 3WY9A 4AIRA 1XLWA 5LQDA 1EBFA 1QQ7A 2HBQA 3DAPA 1VXRA 4GGOA 3PDJA 3NMUF 3I37X 3ZE8A 4Z7NB 2GEFA 1ODSA 2H1HA 3V7WA 3NAMA 1GL3A 3FYUA 4B4DA 1IMOA 1QWSA 2HWUA 4AXBA 3RAJA 1BH6A 2EF1A 1AUQA 4R84A 3B78A 1VECA 2IWRA 1QC5A 4P86A 4L78A 4XQCA 2EKBA 1NW3A 1IUOA 4BP9A 1XA4A 1AKUA 2ZS8A 2H2FA 1X3LA 3TRJA 5FNVF 2XCTB 5E50A 1KYXA 1NVMB 1T9KA 4M38A 1OGYA 4O2BA 3TZQA 5BW5A 2JJQA 2PWYA 5A6SA 3P0IA 5KWSA 1BGVA 1SC6A 1DAOA 1N1MA 2AN4A 4M6WB 5DNVA 1ORIA 3FCEA 4GWLA 2G0AA 5TVKA 1Z5GA 1C3XA 3L0SA 3U9SA 3SD7A 2ZXEA 4QFMA 1YH3A 1T91A 1Z2CA 5AM4A 3L8HA 4ID9A 4YWJA 1Q50A 2EP5A 1E1YA 3R3YA 2XF8A 1G7TA 1L7AA 2OK8A 1QGDA 1Z6XA 2O0HA 3EHEA 3JQ9C 1TEVA 3G2LA 4M3NA 4TL7A 3U4GA 2CYCA 3PS9A 3WSTA 1CJVC 1AGYA 1Q91A 1U0EA 5ECYA 4AMBA 1GPBA 2XCIA 3KSUA 1GTG1 3AGQA 3AFGA 5IJZA 5IT0A 3STWA 1CZKA 4UM9B 1H2AS 1E3QA 1Q16A 2PN1A 2D13A 2ZIZA 4FFOA 4NS1A 4TS1A 4DOMA 4ZJZA 1SQSA 4TXHA 2ERXA 5KKCA 3LCMA 3GRUA 2PUCA 3QW2A 3KYCA 1CUIA 1OXSC 2JRCA 2PZLA 2CLCX 3AESB 4L2IB 1NMQA 4MZDA 8OHMA 3K70D 1T43A 1SIBE 4KXUA 4X64B 4WWHA 1KAMA 3L7MA 3OKFA 1OR8A 1U1IA 3EZ7A 2R6DA 3OY7A 2BFEA 5TB5A 1LJLA 4REQB 4RHTA 1C3OB 2PMEA 1R15A 3JR7A 2R8BA 1RBYA 4MDYA 5IS2A 4TKVB 3NT4A 2ZBRA 4LDNA 4AROA 4LAFA 2KBEA 3ROKA 4YT5A 3LYUA 1R9NA 3NIBA 4EFKA 3E5MA 4HSEA 4JK3A 1GZ6A 1ZI9A 1G7RA 4G2NA 2NV2B 4X3CA 2M1XA 1A9XB 1M8JA 1RYFA 4G37A 4MAMA 5EP3A 2HTFA 1SG0A 1XQXA 1MH1A 1ST2A 1ZU5A 3DOUA 4HNAB 4RLFA 2WYVA 3JARB 2OXIA 1ADJA 1LK7A 1XHEA 4MRSA 2EC5A 2ESRA 4H08A 2HCTA 2J46A 4ZO6A 4CQNA 3CKMA 5FV4A 1G8KA 3JZAA 3DB2A 4OYHA 3X43A 1I36A 2XADA 1WG8A 1Y7PA 3N74A 2X4DA 4Z4GA 2J7PA 3MT7A 1ZHFA 3QHPA 1HUQA 3K9WA 4G1CA 1QFXA 3E7WA 4TPKA 5K8VA 1R27A 1YZHA 2PXXA 2ZIWB 5BUSA 4D3ZA 1ZPDA 2R1VA 3PHCA 4NQRA 1A3CA 2X9NA 4Q15A 1CRLA 4BP3A 4ENTA 5CT6A 3M6WA 4J7AA 4OXNA 2QZZA 1XZAA 3FG9A 3IEMA 2YZMA 4II2A 1NHWA 2VPPA 1ZA2A 5EFZA 1MB2A 5GJBA 3RTBA 1K6MA 4I1IA 2IOQA 1Z34A 1YB5A 5AW4A 1U8UA 2HMYB 2UU9B 4OP3A 2R6HA 3WGYA 2RJOA 3B85A 5M34A 4OA8A 1KEEB 1RM4A 1ECGA 3ZXYA 3EZ9A 2P3QA 3G7UA 4QDXA 2Z5LA 3N59A 2JD0A 4IJUA 4Q19A 5KSZA 2OESA 1KGDA 1FB5A 3FDJA 4D97A 1LTKA 3KPVA 3PI6A 3PUHA 2CXTA 2CBGA 3KT8A 4QTZA 4B46A 1Z2PX 3PJEA 4DG9A 1F38A 2ZSIA 1DHRA 2YVUA 1L7PA 3H5LA 1PI3A 5CB0A 3AO0B 1U4OA 4Q9NA 3X0DA 1WB5A 1RXWA 1RZRD 4NXNB 5FLEX 1CUAA 2YVAA 1KKMA 2DPMA 3OEHD 5DTRA 5G53C 2AGVA 4P84A 4EA6A 3HYLA 1KL7A 5IBQA 5LOVF 1A8HA 1TZKA 2GCOB 2ZPAA 3DDCA 2VAPA 3LWBA 3W05A 2E37A 2LIPA 4PCUA 3BIJA 3ME5A 4JKYA 1EGHA 3LVRE 4O1MA 5KVAA 3UA4A 2DBYA 4BEWA 3GJZA 1Y8QA 4DLYA 3Q41A 3K70B 4RM2A 5IH3A 4MK4A 1YHZA 4AJKA 4O4HA 4RKEA 3BXXA 1LVGA 2E4YA 5K0SA 1HDYA 4PO9A 3LD9A 2V3CC 2AZXA 3AI3A 3C41J 2ZK7A 1UUFA 2GEJA 3EZYA 3BWYA 4H87A 2I6GA 4GPBA 4Q4DA 1X86B 1DBSA 4CKBA 3VA4A 4LRXA 1Y6GA 4FEYA 1DBWA 1R37A 2H57A 2ZRIA 3CW2A 3Q5EA 1AUPA 3PXAA 4LWZA 1NVFA 3LPCA 4HT3B 4RA6A 3LRXA 4ZTUB 1C9DB 2G3YA 1CJSA 1TIKA 2YW9A 4MDFA 1S9HA 4LFCB 4Z6KA 1FNBA 4I1YA 1RJ9A 4TL8A 5A5EA 2ZRGA 4ER7A 4F1KA 2PLFA 1QGZA 4HQOA 3UHJA 4RTKA 5G1OA 2LWIA 5CGZA 3ESXA 1M1YE 1XZMA 1ZQ9A 1QDEA 1T4DA 2P5SA 3PTZA 4H9GA 1U3UA 1Z16A 3OUUA 4MKZA 5JXHA 1YJMA 5A71A 2G9UA 4GOKA 2RBEA 3VPXA 3T3OA 3L7YA 1M8KA 1E3TA 4QELA 2HQRA 2VSQA 3UQYS 4BKMA 4JI1B 4J2HA 3UTCA 4E1VA 2CVQA 3T3EA 1EU1A 2GDZA 2GJ9A 3AOGA 2XE4A 4G5XA 2WIFA 4RJ2A 1QK3A 1FU4A 1SQGA 2AYYA 5BQFA 4NDAA 4M0DA 2IX3A 1M6NA 4RCZA 3SSOA 5EG5A 3HJGA 1THTA 2D59A 2O1SA 2PPVA 2QT0A 2WSYB 4DV6B 3BFKA 3EC1A 3HLTA 3IIJA 4GQAA 1LRLA 1QX4A 3BTUA 3GLSA 2TMGA 3ETLA 5IM4A 3FFWA 3ENKA 4ICIA 1F4PA 4GXRA 4AURA 2KWIA 3OF5A 3CTPA 4E1AA 4JBYA 3NYQA 3OC0A 3TOVA 2OFXA 3IYLW 4JMLA 2F8LA 1IAQA 1IU9A 1Q1AA 2PIDA 4HGRA 3FNFA 3T3MB 2IYSA 3V55A 3MIZA 1D03A 5KZMB 4DW8A 4R4JA 2Y67A 1XCLA 1MX1A 2DFPA 5DKFA 4JVOA 4TWAA 3JTEA 4B5KA 4GS5A 2HRDA 3ZK7A 1E2BA 1YL7A 2R8RA 1GGKA 3AUKA 3CVJA 1Y37A 1LFDB 4S12A 3HVKA 3QUTA 4HDKB 4KVGA 4M0MA 5AM1A 5KNCA 4QPDA 3WNZA 3D7NA 3ZU4A 1W76A 1GDDA 2C97A 4U9UA 4Q4HA 1Q2UA 1TCCA 1F0NA 2AG6A 2VATA 1OWMA 5CU7A 5AUNB 3A26A 2IHJA 1XA0A 3AR5A 2QLJA 2G4CA 3BFXA 2ZRBA 3ZE2B 1Y3CE 5FBHA 1HE4A 3HVHA 2BWJA 2GXQA 4JXZA 2WR8A 2QRLA 1Z7BA 3UHOA 4I1RA 3JYHA 1FTNA 4ZYLA 2JGEA 2VK8A 4H7DA 2OCIA 3TIXB 2E85A 5KTOA 1RJGA 1Q0UA 4F3YA 4EFMA 3COSA 1IWPB 1SXJE 3UMBA 5FWXB 1GSHA 5JYEA 4HDRB 3CU5A 3RANA 2C2ZA 3DJYA 5GVSA 1PHRA 4JLSA 3W6PA 2FR8C 3C3CA 1QAOA 5D7BA 2J0SA 3BGDA 4XDHA 5GZ3A 3MUEA 1B0ZA 5FA5A 3BCSA 3KQOA 3DKPA 3O73A 4QYXA 5CNMA 4A8PA 2VFAA 4G1FA 5HUQA 6PFKA 3ZNQA 3QE3A 1SVNA 2XYVA 3INYA 4HGQA 2YJZA 3FFXA 3LG2A 3U56A 3PP8A 1X1RA 2FPXA 3CFYA 5DNEA 2XX3A 4G0PA 4YP5A 1CBUA 3W9UA 1ID1A 3AJ8A 3P96A 3STXA 2GTPA 4KO4S 2B4RO 4P2BA 3L4SO 2FWRA 5A3RA 3SXUB 1YONA 4ZI7F 2WTUA 2Q1UA 2OAP1 3N2GB 4JT4A 3R7AA 1NVEA 3WYBA 4TYNA 2X19A 4PRYA 3KOYA 3K72B 5JEOA 2QQ5A 3DEYX 2F6RA 3OJFA 2NUAA 1TKCA 1MGPA 2R751 1ZVVA 1UP4A 2XUPA 1E2GA 2HA6A 1DELA 1LQ2A 2O8VA 1VDMA 3QX9A 3A2KA 1EFRD 2DWUA 3ST7A 3U0VA 5FWDA 2BDTA 4IEEA 1T1IA 3O84A 1ZUNB 3PLNA 1PTJC 5I7WA 5LOVA 2BFBB 5K2OA 5BSVA 3LHFA 2ZPTX 4KXYA 4MIKA 5ER6A 1UOOA 2FG7C 4A92A 1CUSA 3EX7C 1V7CA 4XFDA 3OHSX 4JASB 4KITB 4JEIA 1NF9A 3AEXA 3L0CA 4NICA 5JIBA 2QTRA 4NOJA 2WJ4A 4U8GA 4NCBA 1E98A 3WLHA 1ADFA 1E7RA 3IS3A 1XWFA 3S81A 2YDYA 3TOSA 4L4UA 1IONA 1OJLA 4BTEA 2EFHB 5FA6A 4AMVA 2NW6A 1XTSA 2WJGA 4FFLA 4E33A 4YUZA 5KBYA 5L6MB 2CLSA 2FUG1 2OORA 2AUTA 3SC2A 4CU5A 3EAGA 3ADCA 2YWRA 3FIJA 3NV7A 4EITA 2AXEA 2GNOA 4L5CA 5E4YA 4JLNA 3C3AA 1GTVA 4BXOA 4P3PA 2YVQA 4OX9B 1K3JA 5JNUA 1MN6A 2CXRA 4YQZA 3KJZA 4J94A 3RSZA 3ZE1B 3QSYA 1T5DX 3IBYA 2FEOA 4PQEA 2HQOA 4QRDA 3TQQA 2H92A 1HX7A 2XAUA 3DGFC 4XGNA 2J4FA 1PFVA 2MJLA 2Z2YA 3OVMA 4FQ8A 3WRWA 3PUYA 1SA0A 1J0CA 3LPLA 1P5RA 2VK1A 3A8TA 3MJDA 3DBHB 1NUPA 2OVBA 2KSQA 1M7HA 5F21A 4R1QA 2QTCA 4DNQA 4A2CA 3RK4A 3KAPA 3O4HA 3QPVA 4F60A 2O48X 1BOFA 2NU9A 5FOTA 3C97A 3I12A 2Q7DA 2C0QA 2VT6A 5ALXA 1VCHA 3GLHE 4C7OB 1QO7A 4S2UA 5LIPA 1UT8A 1YCHA 2BGKA 3M4YA 3DAGA 1RWOA 4XSVA 3I0MA 2HLHA 1JAYA 4HPJB 5HCUA 4ZEWA 4DR1B 1L4HA 1OGIA 4HN9A 3F6RA 4MB0A 5AKHA 4KYTA 5E0KB 3R76A 4UJ3A 4EZIA 1Z3CA 2QMYA 1QHIA 5JCOA 5BT8A 2VHYA 5C46F 5LLDA 5MN4A 4C0KA 2VPIA 3HB1A 2WLSA 3ZWYA 5COAA 3V3TA 4R2XA 2OG1A 4DILA 2VJBA 4GWKA 4KQXA 3KEOA 5JNVA 1DAHA 1H6DA 3BREA 3NV9A 1UXOA 1E0AA 1ESZA 3DE3X 1NY5A 4HWKA 4IIHA 1DLIA 3MS7A 3Q11A 4N5DA 4V03A 4F8EA 3GR6A 4RTNA 3HX1A 3LH5A 3RIGA 2RMKA 4JGBA 4HMPA 3O3NB 1JVNA 2I6XA 1JR2A 3MXTA 1FXSA 4KQ6A 4R2HA 5C4IA 5L9AA 2GA8A 4LRUA 3UQZA 3VMFA 4CLRA 1E3WA 1W0KA 1Z25A 4LK2A 1YU9A 4BRSA 3VOAA 5B30A 5KDDA 2XXAB 1GAWA 4K1XA 2ZWPA 3IQEA 2JGKA 4HB3A 4RLQA 1NHGA 5JFTA 3OAAA 4GZ5A 4F56A 2F7SA 3OPVA 3FYUB 4D1YA 4GBJA 1SFRA 4TTRA 4L3WA 4TKUA 2DKOA 2JB9A 3HB7A 3WICA 3PQEA 3OH8A 2BFCA 1QC5B 2ADMA 1OWNA 1ZKMA 3MJRA 3T7DA 4Q7QA 3E82A 2OCLA 5BMVF 1SPXA 2YHBA 1UFQA 3E8XA 3WRVA 3ZTTA 2I1WA 1F4LA 5ELMA 1FTWA 1JDJA 1SVOA 2BHRA 4OHMA 4MRMB 5H1YA 2OYRA 2NX2A 4O2BB 1TCAA 1YUBA 1G21E 1HRKA 2EHDA 1HYQA 5EQJB 5A6SB 3F0TA 1ORHA 4I14A 3SIPA 1JMYA 1OIWA 1T8SA 3IPRA 4AP9A 3L6DA 1SR8A 1L4EA 1V26A 3OIDA 3DW3X 1VLHA 1Z83A 1R8XA 1C8KA 3CZ9A 3NQ41 3PNQA 1GYRA 3GYBA 3H4MA 4KOAA 4DR3B 5AI9A 1RMYA 4LVOA 3HCNA 2WVJA 4FMBB 4N3GA 1JQKA 2OFOA 2KYRA 2QAIA 3BXPA 3DBIA 4ZI7A 5MGBA 3H9EO 4OBEA 3QLEA 3Q7IA 1QIJA 2PX4A 1L7XA 2FX2A 1JW9B 3EDRA 3R24A 9MHTA 3ZDFA 3HLKA 3GW8A 4RVNA 5DW0A 3VSAA 1H0HA 4WNAA 4TXJA 5GPBA 2OBFA 5BW4A 1IN7A 2WNSA 1BYUA 3G5AA 1G0NA 5AXDA 1DO2A 3PKIA 1X0XA 4C7MA 5JTUA 4K2AA 3NUZA 1Q0TA 1BGWA 1X7XA 4MV1A 4DLUA 1N75A 1IHXA 1BXKA 2DAPA 2X2EA 3KYCB 3M5DA 2ZUTA 4IDDA 2DPLA 3FCUB 1E1CA 1YJ5A 4LHYA 2JW5A 3PNVA 2GF9A 5TMEA 1AKVA 1ODLA 2X3UA 2HIHA 3D4NA 1XQ6A 2GS9A 3N2KA 3X2SA 5IDXA 5H68A 3U4IA 4XTCS 2BUBA 1Z17A 3RRBA 3FAZA 4M1WA 1I1NA 2XRFA 4WNCA 4BV3A 4CWAA 1U0NA 1LC3A 1U98A 4BO4A 4YQYA 2YASA 5FV7A 3TLBA 2X0DA 2FPOA 2VXOA 4II3A 3JCZA 2H48A 1GGHA 4OD0A 2WTMA 1E2LA 1GILA 1QIDA 3ZLVA 4C3OB 1LI7A 2IEAA 5EWJB 3EJWA 4Q3CA 4G25A 4LG1A 2B35A 1RYZA 3PUJA 5IZCA 5L3SB 3GLGE 3CVVA 3P0JA 4JX9A 1XMOB 3THXA 4ODIA 3VH4A 3DGEC 1P1BA 1X1BA 2HT6A 3PFBA 1GGFA 3RARA 1TYDE 1RHMA 4ZVLA 2FCRA 2IT1A 1G6HA 2R7AA 4OB8A 1PNTA 2ZT5A 3H99A 1GPKA 3T7KA 3SYRA 1TECE 4ESOA 1N2GA 3GF4A 4GG1A 4LX0A 4MGKR 3G9ZA 1ONPA 2A9OA 1QTRA 4TLCA 4TT3A 2VQEB 1MX5A 3CV3A 4EJ2A 1Z39A 3ELVA 2BFWA 2LKCA 3DPIA 3IURA 3NW9A 5AFSA 4PM4A 3IJEB 3UV3A 4AC9A 2NZXA 2R1VB 3IV7A 4EI9A 4LBVA 1G20A 3PLRA 1NUHA 1NQXA 1Y4SA 2F1OA 3JVDA 4LNUA 4TVOA 1X1SA 4ZV4A 4N7RA 4L9AA 4ZAXA 3A6GA 3V4OA 3HCEA 3HCFA 4IFIA 1SVLA 3VR6H 4BQRA 1U6KA 1CUUA 3MUFA 1BRTA 1RRKA 2H2AA 2LKDA 3ZWBA 3THYB 4AL4A 1N5OX 4L4ZA 3H97A 2P9YA 1ZCZA 4BB9A 2WFLA 2P9EA 3I4LA 5F7ZA 4ERXA 4V2UA 1XKXA 4BFXA 4M55A 2HQBA 1GTMA 2K7ZA 4L8FA 4II7A 4MUIA 5DGDA 3WE7A 2W2TA 2NO6A 4EKYA 3OMWA 1JSRA 1D3AA 1GLVA 3HWSA 4QU9A 3SC4A 5CBKA 1AN9A 2W93A 4DNPA 2P78A 5JYBA 3KCNA 4GNKA 2F8SA 4ZPJA 3BWXA 2O8CA 4FKBA 4PTLA 2PK3A 5K4AA 1NL3A 3W34A 3CRNA 1A9ZA 1TEXA 3DXZA 1E2FA 2JKVA 4BUJA 5K0FA 2CSWA 3OIUA 5KNCD 4QBHA 1L5RA 2WA2A 2Y3IA 4NBTA 5CH8A 5JVDA 4HJXA 4ZOCA 2IP2A 4LC1A 5AVQA 3UICA 2JRLA 3H9JA 4NARA 4JA2A 4RTRA 4QVIA 4EYOA 1GZUA 1VGQA 1XXLA 2POCA 5LP1A 2CMKA 4EP1A 1M7GA 1XMXA 3DAFA 3MMSA 4WKGA 2VHEA 2AQ8A 2PHZA 3EZXA 1ZMXA 2ATCA 3RIXA 1VLLA 3SSNA 1OX4A 3EFOA 3U17A 2BRUC 5ILOA 3FZGA 4FN5A 4JYBA 1ZXXA 1E20A 2EBWA 4QDKA 1ISGA 1MAWA 2G1KA 2GO7A 3B6ZA 1SUAA 4DLLA 1Z9BA 2AD1A 1Y8QB 3K6KA 3UNNA 1CUVA 2FN8A 4ARSA 4D8VA 3TD2A 3CRW1 2QV7A 3PEVA 3B9PA 4O4HB 1J49A 2P9BA 4TVKA 2QJOA 2NUBA 2ZJ4A 3W2HA 2XY4A 5INTA 1MQSA 2O7RA 4LMBA 4NZZA 1EX7A 1W5SA 5C8VA 4TZ6A 5BMVA 2W8BA 1O97D 2WVHA 4EO7A 5AHXA 3U40A 2WHRA 1VKHA 3OKPA 3B6IA 2HDWA 4DCTA 4K9LA 4G67A 5C35A 4OHPA 1W1WA 1RWBA 2A0XA 3WV5A 3SPXA 1P7ZA 2MDTA 4RA6B 1LGYA 3K05A 4QYIB 4X63A 3VDXA 3TNJA 4Z0NA 1RJ9B 4EO4A 4MV9A 1O6FA 2QZSA 3EFEA 3EEQA 1RQGA 2EEZA 1NOJA 2W98A 2CVPA 4K87A 3HYCA 1CUFA 3KJNA 1M2EA 1W2GA 1NKSA 5CD9A 2HHHB 2EIHA 1JG2A 2GRUA 3UT0A 2O8FA 5MFPA 4WK6A 1TZ2A 3BMOB 8AT1A 2J87A 2IYOA 5EQTA 4C03A 1YZVA 1Z33A 5CLLA 1WS6A 3W8FA 2CYAA 2YIMA 3G2HA 5FLXA 2EGHA 3H5OA 4BKUA 3SSMA 3MWKA 4KRGA 3ZN2A 3I2YX 2MIIA 5AI0A 3LC2O 4XWWA 1GL6A 2IOFA 2EU8A 1ZJJA 5HZKA 5EMLA 2CDBA 4GPZA 4X61A 4QDOA 1EXDA 1D07A 1OI2A 4ZU6X 2Q29A 5DPMA 4RANA 1MH9A 1MJGA 1ZK1A 3K7EA 3KT6A 4GU5A 5J2UB 2PAFA 1KMNA 4L5JA 3ZZTA 4FGZA 4PS1A 4RO0A 4D9FA 1N7GA 3U9LA 2QTWB 2NU7A 2QD2A 1L5NA 3MLBA 2R0QC 2HZ7A 2ZUCA 2ZSBA 2CXHA 5ADWA 4UDYX 1C4WA 3KV3O 5AKYA 3ZC3A 4IRUB 2F3UA 3QVXA 1DQNA 3QBVA 1QBKC 3V97A 2AA3A 4XUGB 5F52A 3IEKA 1M9NA 3AF2A 1H93A 1JWLA 1SU7A 3GLFA 2HHLA 4FWBA 4URXR 4DJ5X 2WW8A 2IUFA 2H9IA 1RRMA 3BXZA 4OBWA 3PXDA 1E8NA 1A9SA 4URUR 3SZUA 5M3BA 4TLBA 1EK0A 1OXBB 2WJJA 3DKKA 4D82A 1ESDA 1NVDA 4EGFA 4KRFA 1AVTA 3O9ZA 4OI2A 5EE1A 3ZPXA 3OQ1A 2QRQA 2X8AA 4FOPA 4WN3A 4OXYA 1THGA 4PAQA 4O4IA 4DV1B 4EB6A 4Z3OA 2D7DA 2YVLA 5C32A 5IKMA 4XASA 5L4NA 1TYEB 4TTJA 3FW1A 1E0DA 1WXHA 1N7HA 2XA2A 1ZFNA 1RPAA 1NJ2A 1KGSA 5IN4A 2D4HA 2PS1A 1Z4QA 4WXMA 4LXGA 1U0TA 1M5UA 1OTHA 3KQQA 4NNJA 4NYJR 1U7HA 3KP1A 1EXVA 2JGDA 3HHPA 3A58B 1X70A 2C78A 2AI1A 1UMDA 1GGMA 1CDDA 3QA9A 3GUHA 1W44A 3WB2A 4P4TA 2H4FA 1PW7A 3BUSA 4GC9A 5AO9A 1JSZA 4NE7A 5AWFC 5T8KC 3KOXA 1QU2A 4XIIA 1O95C 3U5TA 3HDVA 4XYMA 4KO2S 1XNGA 4WL0A 3O8BA 3LL7A 1TU3A 3RYTC 3T1VA 4DKXA 1PEAA 1YDFA 2IXFA 3EUEA 4MS3A 1VBMA 3HBNA 3FE2A 2DZDA 4RELA 4HBGA 3RWOA 3ZHOA 3N0WA 1L4YA 1P2BA 3AOEC 2D54A 3QFFA 4KE9A 5K0GA 3D3WB 1MAHA 1OBVA 3PHBE 3LHIA 4E12A 5ALRA 3FNHA 4XQEA 2P9QA 4NENB 1Z0SA 3BQ9A 3JVIA 5CD1A 1JEDA 1Q1BA 3RASA 4RK7A 1Q20A 2NVUA 3TNLA 2IZ1A 4LJ4A 5CLGA 5JZMA 1C9MA 3O26A 2DHRA 3EZNA 5LKAA 1W0KD 3V5NA 1GIAA 3E8MA 3GJSA 2O2XA 2GPAA 2Y1LA 1BW9A 4H7FA 3MVEA 5DYYA 2HRRA 4TMYA 1Q44A 3AF5A 2J48A 4KV9A 3FOFC 5LOVB 3OAAD 4QD3A 5SYAA 3ZGNA 2JLBA 5AJTA 3IHKA 2C9CA 5LZ2A 5TF4A 2XYHA 3CGGA 4ZCSA 2J0VA 4KU4A 3KTAB 3MS4A 4MQEA 3W5AA 2G08A 3IL2A 2YFKA 1O4WA 3JU3A 1J07A 1X14A 4HKTA 1QWTA 3PV0A 4JY7A 3DYIA 3ECAA 3PL5A 2FUKA 3C1AA 1QXSA 4H3KB 2YHAA 3HN6A 1Y3BE 4X41A 4YBZA 5BQPA 1GV0A 3U4AA 4YVFA 3S8EA 2SHKA 3S1SA 5I9LA 3JWEA 4DYVA 1EUCA 3LZ6A 4RVCA 2H2WA 4EHIA 4JH0A 2HCRA 3CCCA 1E5LA 4COKA 3DKRA 2OKCA 4F0JA 4KLNA 1O0BA 5C4GB 3L8MA 2ERCA 1VYUA 3DP7A 3SC2B 1ZNWA 3LOUA 4I8IA 2VDWA 5BYAA 1ZZGA 1POWA 3THSA 5U9CA 3GJ3A 2PV7A 2OYCA 1BVRA 2WG1A 3V8VA 5EI5A 2BOVA 4BXOB 4AZSA 5LJIA 2E5LB 3K2EA 3IVGA 5E38A 3HKEA 4OBBA 4C6SA 1EHCA 2V9PA 3UUGA 1RCTE 1RQ7A 5A2GA 3HY4A 4QQFA 1W75A 1WBDA 2ODBA 3RI3A 1SBYA 3P9XA 4FXPA 1N5IA 3ETEA 5EUMA 4CPDA 3NLLA 1FFYA 1SA0B 2AC7A 3LIPA 4WTOA 3ELBA 421PA 1P2DA 1JIXA 2R7KA 3TI7A 2J32A 5J4KA 3RVLA 4RD1A 3B6MA 3IEPA 1DGQA 4OXQA 4ISBA 5JRJA 4HG2A 4ZN6A 1L5FA 2AFRA 5FWYA 4BZZA 3VNUA 1W47A 2NU9B 1NATA 1RAAA 3KWFA 3MGCA 5E1BA 4RV4A 1G2QA 5K0TA 5E6RA 3EG9A 2JFYA 2UAGA 5KTMA 3P2EA 3VKUA 4HAIA 5G1PA 3NKVA 4RAOA 2FQQA 4QOEA 4QOHA 4KE6A 4JJKA 4O2LA 1FP1D 3VHQA 1OLXA 4BJ1A 2NSHA 3TIFA 3TM4A 3V4LA 5DYIA 5C5CA 1K6IA 5D84A 3ENZA 3UEOA 2PFKA 1QYWA 8GPBA 3QM1A 3BE5A 4LV8B 2VDJA 1US8A 1QCCA 2Z58A 3U7RA 2OCPA 2D7JA 1RWKA 1A4RA 4MKXA 1CG6A 4EGXA 1XC7A 2CK3A 4F6LA 4KWTA 2OD2A 3RS3A 1YS9A 2EXXA 3ZWVA 1VJ1A 1ZC4A 4MTLA 2O54A 4DJDC 1II8B 3GDGA 4DJFC 4WINA 2RB5A 3VX3A 4NHOA 2DB3A 4L9RA 2VQSA 4LHVA 4YRSA 3DO6A 3CLTC 4RL4A 1Z5UA 2A1TR 1WW2A 2CMGA 3PGXA 1SIWA 4IGIA 4IXMA 1G8PA 4LTMA 3SK0A 4TT3D 4BCDA 1FYVA 4CLRB 5A0VA 2DULA 1ISPA 1YS7A 5HMLA 1GVHA 1NUTA 4G5YA 3SWWA 1JHOA 4G1EB 4ISCA 1Z2AA 1RWXA 1T2DA 3R3UA 4QUIA 1RLJA 4D7AA 2NG1A 5ESWA 2A58A 3PCXA 3CJRA 4A5SA 5L4SA 1JE0A 5BSTA 1OBCA 3VU9B 4W7SA 4G2SA 2EG9A 2QAJA 1GPJA 2H11A 1SIOA 1MJ5A 2GXUA 3MILA 2OXTA 3V4PB 4DUPA 1IB0A 2BFCB 3NBQA 2EEPA 2P7HA 2PRKA 3H2IA 1JKMA 4YGXB 4BNKA 4DZTA 2ORWA 2QW8A 3U39A 5AKZA 3P71T 3AQ4A 2YWCA 3ONNA 5K0NA 4E6PA 1UBGA 4F1JA 4N0EA 5JMOA 3SBDA 3VSBA 1OT5A 3VR1A 1QZXA 1P4GA 3BYZA 1H65A 4A0RA 1Z0KA 3HU2A 5KWJA 5CXQA 2CCKA 4JC8A 2DQYA 3MBIA 4JP5A 4TV9F 3P26A 4HATA 1TUIA 1XTVA 4WFQA 5K6TA 2NV6A 4Q01A 4B1FA 3JPYA 1MOZA 2AG8A 2ZBVA 4KREA 1TQ2A 1PJAA 2EQ5A 3MGBA 4ZI7B 3GJRA 4FPXA 3JXEA 3GRVA 1N57A 2Z9BA 4ARBA 3HHEA 1Z2OX 1KFBB 1GUDA 4A1OA 5H82A 4Q1EA 4YY3B 1Y4UA 1JDPA 2EZ9A 4AUNA 3MQ4A 3U2QA 4TQUS 2NZ8A 3DOHA 4BVJA 2CN1A 1TRKA 4KR6A 4NC9A 3M0EA 1I3MA 2D5CA 2VBGA 1U7FA 5FUBA 4EHDA 1FQWA 3WGNA 1SXGA 1L8XA 2BR4A 1D09A 2KPOA 3G0IA 3K73O 2WHQA 2J4CA 4OI4A 1X7XB 3B5EA 4QIHA 4MNTA 4YALA 3RGGA 1EVQA 5TY0A 1ZI8A 1XF9A 2ONZA 3T5AA 2ZETA 4ZEXA 3D02A 4L8LA 1GNRA 4GHWA 2PKXA 4MRAA 4Y2YA 3VC7A 3RVBA 4XB6B 3V8BA 1JEQA 2J41A 3D64A 4ZHQF 4QDUA 1GUZA 2OO5C 2WM8A 1DEXA 3ODGA 3MD9A 3UJCA 5HZMA 1ID8A 3RUEA 4YO7A 2GSDA 3T5BA 3FGZA 1U63A 4MKGA 2HNBA 3TQHA 3DMNA 1KI2A 3UV0A 1OI7A 2FZ5A 2WWYA 2TECE 4H7PA 2OSBA 5B58T 1U0GA 4BB5A 3I92A 1GL7A 3THXB 4TZTA 1AHIA 2RHJA 4P92A 5L3VA 1W34A 3I6QA 3O5AA 4OG2A 2OHHA 3IJPA 1A0OA 4KMOA 5E1MA 3ZVNA 5JMTA 4I19A 3ROZA 4RD4A 2WYUA 3P2YA 3VUFA 4D3DA 3ORFA 4W5NA 1G9XA 4HWGA 4URHA 5BW6B 1U0OC 3NXSA 4ETMA 2IBSA 1B6TA 1DC5A 1TJ5A 3LRPA 1GAXA 1SOUA 3I53A 4LVNA 3RU2A 3I6WA 4MKRA 3QWAA 5CP8A 1O2DA 2D4AA 2QP9X 3O4FA 1UMKA 4PF1A 1E1MA 3RWMB 1G20B 4DE5A 5KB3A 4LNUB 5BYJA 1N9GB 3W6NA 1XAHA 4IFBA 1FFAA 1ACJA 2CD9A 4LDZA 4LGYA 5F1PA 1E60A 3WK9A 5LP6F 1MG0A 3GT3A 1JZTA 1QYXA 1K2VN 1UODA 1E2UA 5FFMA 1VL2A 4EVSA 1SXPA 4PC6A 4DIKA 3HVUA 3EXG1 3KBBA 1CVLA 3LC1O 2WFLB 2V4ZA 3ZKWB 3QHQA 3SZLA 3L1KA 4O0MA 3GK3A 1ZVKA 3TLKA 2LCQA 1VB3A 4GF5A 5ILQA 3AB7A 1DT3A 3SICE 3F6YA 4JT8A 5DXAA 2Q9BA 5IX8A 1E9CA 3AYZB 4ZMSA 4CLOA 2O8CB 3QWHA 3ZW8A 2FEAA 2CNLA 2AFHA 3I09A 4EHAA 1NZDA 1CJBA 1OY1A 2KB3A 4AUEA 1UZLA 2OZKA 3DHVA 3L5OA 3W77A 1FX0A 3A2NA 4RXUA 5CB4A 2KMLA 5JVDB 3ZCPA 1PS8A 2BHLA 1COWA 3C3PA 5LDHA 4X54A 2P27A 3F4KA 5CK5A 5GMOA 3U60B 1TM4E 5I5EA 3CXRA 1AS0A 4HTAA 1HH4A 5FBWB 3ZHZA 4HF7A 3KZ1E 3STVA 1OQAA 2HK8A 2C3UA 1Y1LA 4YMWA 3V8EA 1E61A 2ONYA 2XB8A 1K7YA 1P7VA 3EVFA 3FHJA 2P35A 1EE1A 2ZYWX 2BGRA 1IOWA 1MBZA 4JOQA 5DBHX 2CLOB 1OX4B 3EFOB 3MBOA 3ZHQA 1J5XA 2DR0A 4RMJA 4F3TA 1B6RA 5FULA 2QLTA 4QUKA 2JIDA 4TQAA 1JTFA 2NNLD 1H9AA 2FSUA 5F76A 3IQHX 4GR4A 1E0KA 4GZ3A 2C7GA 3D5TA 3DVQX 3EPLA 3RREA 1GTJ1 1F2TA 2QNBA 4GO1A 4GE0A 4A8JC 1RYBA 1PD0A 1YZGA 1KEVA 2PUHA 1HYEA 2YV5A 5G4LA 3AJRA 3U3JA 2J3KA 1P77A 2W8BB 3OTQA 4P83A 5BMVB 5BQ3A 3L0IB 4P31A 1PVVA 4P22A 1GNQA 1U7UA 1VSUA 1T5OA 3I9V6 3TL3A 1UOEA 3TL6A 4JI5B 3ONFA 3DR3A 1U1EA 4PG4A 3ICEA 1XZKA 1ND5A 4WK4B 5FKJA 4GDFA 1G16A 4BVAA 3VPGA 3ZQUA 4O3MA 5HQ3A 2V59A 4LYYA 2QRPA 3WKBA 1Z63A 4M98A 1KZYC 1D2GA 3OX3A 4Y0NA 5G02A 2C4UA 5L8VA 4TV9A 2G8LA 4Z86A 4EFDA 4IHJF 2Z43A 1DTWA 2X9QA 2BTOA 1MB4A 5DCLA 4EGSA 2PEYA 5DB4A 3IQFA 1A5BB 4QHTA 5F9MA 4DB4A 2XDYA 1N78A 2FZKA 2V96A 5FFNA 3ZWAA 4C5AA 2NMVA 1O54A 2VUTA 2VJYA 3OZCA 1DC8A 1M1XB 1K0FA 4PPFA 1SJ9A 5LR6A 1AG9A 1AOXA 3C6KA 4A5OA 1G41A 5K0ZA 3KB2A 4UFOA 2JFZA 3RS0A 1CQWA 3AZPA 1YRAA 3M9XA 1N1EA 4BX9A 1IZ8A 3I5XA 1WCIA 2AMJA 4M46A 3SZOA 1QZZA 1T13A 2B92A 5HDQA 4ESHA 1NI3A 1O6ZA 3S99A 4F9GA 1G63A 2ASVA 5EKXA 3W5SA 2E9SA 3THRA 2JFPA 1FVFA 2AR9A 1QVVA 2GN2A 2IYQA 3N3AC 4JQZA 3JQRA 3QJYA 2P3OA 3NC1C 2C5BA 3RS2A 1YUNA 4U9HS 1RC1A 2I87A 3QVSA 2C0PA 1EQAA 5HIKA 5IAOA 4A15A 4JLUA 3PA6A 2JAWA 3LLVA 2MSWA 2CLLB 4LK3A 4ZHQA 2YQ4A 3VR2A 5IT4A 2IV7A 1NXXA 2ZI9A 4R98A 2NU7B 3B3AA 4QBIA 5AIAA 4EMTA 2E21A 3N5CA 4L95C 3WGGA 3JQCA 3Q7TA 2QV0A 1NBMD 3AUYA 5C8YF 1CE8A 3TQOA 4RWEA 1IM2A 4JJ8A 3WL6A 3D1VA 1Y5NA 3Q8LA 4C0JA 4GT1A 3R2JA 3GLFB 1G8MA 1L4FA 2C9YA 2R87A 4CL8A 1T29A 5FWNA 3EDCA 1MC4A 5CFMA 1FUIA 2E6UX 5FLYA 3O90A 4YRBA 1DAPA 1RKUA 4ANFA 4RKRA 4G23A 1CCWA 3EZGA 3ZBQA 4BO7A 4HH0A 1N2JA 2QTVA 1PL0A 1NJ1A 2RHMA 4HQ6A 5DOZA 3FTDA 1Z7YA 5JE8A 3R3SA 3GD5A 4BO5A 3U81A 5A1TA 2HO4A 1P0FA 1P72A 1ZCFA 4O4IB 4WZBE 4EB6B 3RIEA 1DCMA 5AHRA 3KOOA 2W8ZA 4NAVA 5EYPA 2C61A 1ZN8A 1R50A 4E5VA 2IYFA 4MKHA 4AP5A 2CL6X 4PAOA 1X38A 4HB4A 3EBOA 3WLEA 5DLQC 4D9BA 3OJWA 4DA0A 4AF7A 4ND4A 5LP6A 3EGCA 1M72A 1L5KA 1SU4A 1VKOA 1UMDB 1YJAA 1ZP6A 4GGMX 4C05A 1ZOSA 3NCHA 5KYXB 3VYSB 1IJBA 3K5HA 3CUVA 3RSCA 3WGZA 5KVQA 3ERCA 1FNMA 3ZHCA 3D4PA 4C04A 4HD8A 3M4ZA 4ZOEA 4LVCA 4NYIR 4PQGA 4O2AF 3SBXA 2AOTA 1K7FB 2CMDA 2Q1SA 2XYRA 5JV5A 5KYWA 4UAUA 3WL5A 1GTZA 1G8HA 2ONJA 1TYCA 1L5VA 2I4RA 4K0KB 4MVJM 1U0BB 2ZUDA 3DDUA 1MZPA 8MHTA 2AVDA 1JIQA 1GT6A 3PHLA 3QLJA 3CF0A 2VHCA 4NFHA 3U62A 3PWZA 3TLEA 1Y7HA 3OTWA 4JOSA 3KKOA 5EUQB 2AI2A 3NHZA 1ONNA 5C34B 5BUZA 3FBTA 4OIFA 3DZIA 5ALUA 3W04A 3ETDA 2NVUB 3AF4A 4IFTA 4CTMA 4RMNA 3HB4X 1L4NA 3U6KA 2XZLA 1FCJA 4XWGA 5IWAB 4K2HA 3V2UA 2IUYA 1BW9B 3D3EA 2R5FA 1P33A 1VBKA 4XXHA 3QVGA 3K09A 4XYLA 3N76A 3E48A 3IBTA 1SWVA 5KNDH 1WZEA 2VJKA 4IIYA 4QGBA 3HDQA 1D0IA 4RK6A 4UMEA 1YRWA 4WE3A 3K8OE 4WSOA 1XN4A 4Y2XA 3DWFA 3RFUA 4MQEB 4KXXA 4P98A 4CMGA 1XZCA 2IS4A 2ZQZA 1KOJA 4GYYA 5F4ZA 3U3XA 4DDKA 3SC3A 1VPTA 4X95A 5TRTA 4I55F 1T9DA 2GD6A 3UZUA 3QEKA 1TVCA 4DDHA 2FRVA 2QL7A 4AG5A 2GF0A 4RJIA 4D8WA 3CUUA 5KSWB 3ICVA 1EUCB 2I2BA 1P8JA 3SS9X 2VDMB 1RKVA 5LQNA 2GAIA 1Q5PA 4IS2A 1SG6A 4FMDB 4Q1FA 5LQMA 3D7RA 3T06B 5GWXA 1U3VA 2BL4A 1CSEE 2J6IA 3KX2A 5A02A 5CX1A 2VDWB 3LCVB 4EX7A 3ZDDA 3H4IA 1W4ZA 3F74A 4PIMA 4RIEA 1MV5A 2VHJA 1QK4A 3I42A 4B6OA 2RKBA 2DUUA 3ES9A 3HKEB 4C1NA 5TARA 3ORHA 5H0IA 2OO3A 3AM5A 4PG7A 2HMUA 2O8BA 2IGBA 5B1HA 3TSOA 2WE7A 1A7JA 4GXQA 4XCXA 2HU2A 3N28A 4EPXA 1OIVA 3U49A 5JD6A 2Z3VA 4QGHA 3M49A 3O1JC 3OQOA 1DOHA 1IPFA 2PO7A 3OJ0A 3TUJC 2ZZMA 4FUTA 4QTYA 2HLPA 2QT1A 5I7OA 1KZGB 3UYKA 4TYWA 5FWYB 4JONA 4O29A 1PLLA 2WZCA 1C7EA 5LWHA 1B93A 1QKKA 4CI9A 1R6TA 2CHUA 2I66A 3EG9B 2B78A 2J09A 4IV5A 1MVLA 2V6BA 4HXEB 3Q9UA 5BSRA 3DV9A 3C1UA 4RF2A 2B1JA 3Q9LA 1O89A 3VU1A 1V5WA 4MHSA 3I2GA 3QLUC 1US8B 2PWBA 1JDZA 4PCAA 4LYAA 2ZIEA 1HYBA 3M4NA 4WXHA 2BONA 4CM1A 1OLSB 3GLTA 4S1NA 3RBAA 1C0IA 1DU4A 3EFHA 4PLTA 1Q83A 2FPGA 2FPWA 3EQ2A 2CDAA 5C8YA 4LCJA 3TR6A 5KTYA 3O4JA 1Z75A 4HNQA 1N6NA 4JJGA 4UJ5A 5CT8A 4QLBA 2X41A 3G7SA 4UEOA 1QX3A 1IG3A 3D6AA 3OQBA 3IUSA 4N6GA 4N3CA 4C2AA 1QTNA 3MGGA 3QTLA 1PEDA 4HWTA 1P8AA 3L06A 1IUPA 5L7YA 1RFLA 3IHWA 2W4IA 1PUIA 4RGYA 5A3VA 3UJ9A 4B40A 4DC9A 1DWPA 4DPKA 4E31A 3IPCA 2EV9A 1U8AA 2BMEA 3PT9A 4RK5A 1ADGA 2DQSA 1QVAA 4JI3B 3T12A 4M1EA 3VM6A 1V8PA 3SC6A 4DB2A 4FB5A 2ZBEA 4R1SA 1LQUA 1E18A 4RY8A 4IQGA 4ENSA 4FEGA 2XNKA 1E7YA 3JQ7A 3DUFA 1U28A 2VOJA 1CQIA 1J21A 2WTNA 2V7GA 5ED0A 4OSEA 5B6IA 4GLJA 3GBSA 1OAKA 1L4BA 3V34A 3FHTA 4NZNA 4R05A 4I50A 4Q1AA 1QPGA 1SZPA 2GASA 2D0PB 3AEKA 1UJ2A 4XB1A 1CJUC 1KORA 4KX5A 4X60A 1T3ZA 2QW0X 2K2WA 4KOEC 4EJ0A 2W2KA 3AOEA 3GH3A 4KWHA 4AY5A 3DBLA 5IEJA 5HX7A 4C5BA 1WW8A 4OQLA 3LX6A 1FJ2A 5B2EA 2HJRA 5FI5A 1ODCA 1P39A 2UUCB 4BZXA 1TJYA 5JSUA 4WDRA 5DK4A 1KU6A 2DCMA 1Y5IA 3ROMA 1BE0A 3CO5A 4HDQB 2DUWA 3L18A 2IZ5A 3VRHA 4ZT5A 2XIJA 2UDPA 2FMUA 3F67A 4HH4A 2Q62A 4KXWA 4Y6QA 5IKXA 2Q5JA 1X1TA 3AK4A 5CVJA 3P7MA 1B41A 5EHQA 1CY7A 1COWD 5F64A 1M34A 3LY9A 4OXKA 4E2XA 2VJNA 3QX7A 4YJ2F 4Z9FA 5J2TB 4V3BA 1Y6FA 1X7DA 4RK4A 2XMBA 3EXAA 2ZWMA 3HFJA 3HNOA 5FHRA 3ZLBA 3G8BA 2ETVA 3ANMA 3AR7A 3HDYA 1U7FB 1SCQA 4IX1A 4PZDA 2FZCA 4LDPA 3K96A 1KOGA 3I04M 1OFUA 1PR4A 2VRCA 2R4QA 5L3QA 1MV8A 2EP7A 3R7WB 2ODAA 1T9HA 3DD1A 2YV4A 1HQCA 3BHIA 1GAEO 4GEKA 5EKDA 4DV2B 1JR6A 5A3QA 1YKFA 5AH0A 2Z1NA 1RKQA 3H2JA 2QEQA 4FCWA 1FP7A 3D2CA 4I1OA 2B3TA 4D79A 3L8ZA 4GVLA 3OG9A 3INNA 5IF9A 1Z07A 2BKLA 2W6PA 3BQMB 3PTLA 1K3QA 3IELA 4DG8A 1NI4A 4G4SO 1TLTA 1UK6A 3IP5A 3DT6A 1T15A 4JI4B 2WIKA 3NR2A 3OQNA 1I13A 3UCEA 1T34A 1ZVMA 2GKSA 3IP7A 2VDRB 1I4LD 2J3HA 4PYQA 2Q4BA 3QFRA 2WBLC 4F9EA 1KQGA 2OUIA 2O50A 3AVOA 4F6CA 5I9SA 2GXAA 1UPFA 3DEFA 3ZG6A 4YECA 1UINA 1PT8A 3HFGA 4PSCA 4QSMA 4XJSA 3D43A 5H59A 3ZTWA 4BCCA 1OYOA 2X0NA 3UW3A 3RHSA 3W2TA 4PFSA 1KK3A 4O4LF 5ECDA 5ELLA 2CHGA 2YJ6A 1AKTA 1NBIA 4PO1A 4V0OA 1EAMA 4PX5A 5BV7A 1RJFA 2NXJA 4WY8A 5A1JA 1T25A 3BRQA 5B2FA 2NSJA 2QP3A 4P9NA 5FTKA 2NACA 1UZUA 1JKFA 1NBAA 4RQTA 4YASA 1V1RA 1JG4A 4BU0A 2OCGA 2G77B 1VHTA 2GYUA 2VTVA 2ZDHA 4BASA 3DULA 1XL1A 4AMGA 4EF6A 1KSJA 3OCCA 3HG7A 3RHZA 5G3ZA 1AMUA 3ACBA 5TS3A 1A9TA 2CB0A 3FFTA 2QSJA 3L9XA 3SEZA 4LQCA 3TCXB 3WK8A 5KOJA 2K87A 3R5TA 3VR2D 2ZCJA 3M1YA 2ZU6A 5FP0A 4C4AA 1SCAA 2XQKA 3O92A 1E6UA 1UH5A 1RADA 2R1ZA 4WASA 5FJJA 3ZXUB 4KQMA 1RWMA 5FPPA 2WYWA 3ISTA 4CLOB 3OT5A 3QU7A 1NKTA 3UHPA 2AFHB 1JTEA 2A9VA 3R0IA 4EECA 2PZAA 4JWTA 5DT2A 4YQFA 1FX0B 3I5YA 1NLYA 4B83A 5CB4B 3CEJA 3ZCTA 3V8MA 1AD2A 3H3JA 3LKBA 1NOKA 1GPYA 4NDNE 3FJ1A 4U3JB 3C3DA 1TM5E 1XIVA 2FFQA 2OXRA 1KZ7B 1ZRSA 2YHSA 3BXEA 1ZSVA 4MVCA 5DNWA 3U9TA 2XKBA 4BRUA 2BAGA 5LBIA 4UNRA 4F96A 5TIIA 3O9MA 1YNOA 4Q16A 5IHPA 1Q15A 4F5YA 4R1TA 4OI1A 1IULA 1E3IA 2FF4A 1L7QA 2TSYB 1ZI6A 3BICA 4U63A 4OKIA 1XTUA 4XWTA 4DDTA 3EOBI 3AVVA 5F5XA 4HDSA 1LI4A 4RVOA 5LLTA 2PUEA 2COUA 2PKYX 2PMFA 2FRDC 3FM8A 4ITUA 3HSYA 4NFLA 1K7CA 4Q9JA 4G4JA 4MVJE 3SIWA 4DYDA 3KEFA 1TC1A 1F2TB 2YYZA 2BVNA 4X62B 2YV3A 4UMFA 3FDFA 1PYGA 2EKPA 4TL9A 3OX1A 4QT4A 4GP7A 3CIOA 1PNRA 1O5IA 1OZ0A 6ADHA 3FRIA 3R5FA 7AT1A 1CZRA 2IZ7A 5M7EA 2OZEA 3BVPA 4Z1MA 3BMQA 4YR7A 5J58A 2GZSA 3F3YA 1OFUX 1UP6A 2J59A 3EC7A 3RTAA 3EAFA 3ZCRA 5KDLA 5K8TA 1ZD8A 1P4RA 3B60A 1NZFA 1V8DA 4YO8A 4TV9B 4AJEA 3UBMA 2JH8A 4EEZA 4XZ3A 1ICEA 1Z4MA 3O2NA 1DTWB 4LTNA 3NTVA 2QF7A 4R3UC 1SXIA 1G4UR 1E1LA 1T9GR 5C1IA 4RWZA 1VE5A 3B3FA 4RKFA 3K5WA 1QCDA 2VDOB 4QRHA 3ANLA 3H5VA 3E9QA 4GVXA 1SKBA 4IY1A 3REQA 1OUMA 2ZRLA 3GD7A 3AJEA 4B2IA 2VPWA 3K5PA 1V43A 3ER8A 3WFZA 2QR2A 3WLIA 2PZFA 2NQ2C 4KIUA 4Q9HA 4YDQA 5J47A 2CJYA 2RD2A 1WCIB 3RFCA 2HSGA 3V1TC 4FFRA 1PR6A 5EHXA 1F8XA 4OQNA 4F8JA 1WLSA 2JI7A 4XW2A 4S1OA 5JADA 1MZVA 2IYYA 4ER3A 1RQRA 4TV8A 5IAEA 3UXMA 3PVZA 3FXAA 4K05A 4UVEA 3ZD7A 1PEKE 2F59A 2UXDB 4EG1A 2YQ5A 3PC8A 4W1RA 6YASA 5EXPA 2F1JA 2C5GA 2OY0A 2RGXA 3TSWA 1K89A 3H04A 2L69A 2BKUA 2QRJA 4C0SA 1EP1B 1ZDMA 3ZBTA 2CLMB 3UC9A 4ZHQB 4WOBA 3LUHA 2YMQA 1T2AA 4FHDA 3QBEA 1SVSA 1PEYA 4PU0A 4TTIA 1CE8B 3QI2A 4UEWA 1TM2A 3OA0A 3P9IA 4RF4A 5DI9A 3MTJA 4LZOA 4Z8YA 1YQDA 4TN5A 3GFBA 2B34A 1ZMOA 2I5PO 3PXUA 5D51S 4ZEOA 2P3LA 2VPQA 3IAEA 3WIDA 5ADVA 1ZM9A 3I5MA 3FDZA 4PYIA 1EFPA 2R25B 4RAQA 3R77A 1T8WA 1GQRA 2ZRQA 2X1VA 4ZANA 2JLXA 2QTVB 1KDVA 1R0LA 4D6XA 2JHFA 3M1IA 2IUSA 1TM3E 1Z6QA 3NASA 1JAHA 4OQDA 4M0CA 2RHCA 2FN9A 3OSZA 4PLYA 3VHRA 2QRHA 1HF3A 1DX9A 3CT6A 3OX2A 3PVCA 1OKKA 2OG2A 1AUXA 4O4LA 2H52A 2OAGA 1Z6ZA 1X8XA 3NGXA 3KVNA 1K92A 1W52X 5EHNA 3TR0A 3UHFA 3DZBA 3GP5A 3L7JA 3OBBA 4JN6B 3IODA 1E2JA 1E79A 3SZ3A 3EGWA 1W4LA 1XDWA 4KDCA 1DSSG 1CC1S 4TMZA 1QTQA 3YASA 1GPMA 2ILVA 4LDJA 2JBWA 3JAMA 1CR2A 1JXAA 5LP6B 4MDEA 4LOAA 1D1PA 4LECA 4BWGA 4M83A 3ZVRA 5H8WA 2JNWA 3PWTA 4RZSA 4UU0A 3SF8A 5JWRA 5BNIA 3K9FC 4RADA 1JZSA 3ID6C 3VR0A 3KD3A 1SVUA 1P0CA 1NYLA 1E5DA 2B9VA 1SCNE 2H4ZA 1PG2A 1RWWA 1X2EA 2AOTB 3DL4A 3H9CA 3I6MA 2G6BA 2HM7A 1J6UA 2VJOA 2Q6LA 4QDZA 3Q72A 1NW7A 2QG6A 3C15C 4XARA 5L3ZA 5FJIA 3T3HA 2HA2A 3FPLA 4EB8A 2JPDA 3UB3A 2WKWA 1WE2A 3NHAA 4FJ2A 4HMOA 4RQBA 2RAFA 3NDJA 3ZU2A 2XPCA 1RIIA 3P9NA 4ARIA 4YJ3F 2MMCA 5A0TA 4OUKX 1JQJC 3QVGB 4TMFA 4I66A 2QORA 3QPBA 3VQTA 1L5YA 2GYWA 4QXQA 1SCUB 2Y71A 3HA7A 4Q1BA 4DJTA 2D0IA 3QVUA 4BGUA 2XDAA 3O3CA 5CXUA 2ZI3A 3AL2A 3S7ZA 1F7UA 1AKNA 1GQOA 2JAOA 3NG1A 3Q0IA 5AUOB 4BNUA 1MNQA 4KVFA 1CS4C 4FC7A 1P3JA 1AXRA 1N5LA 2ZRKA 1P4JA 3N7AA 3WNDA 4EZBA 4NMXB 2BEVA 3K9HA 4PEVA 2OQRA 4B3TB 1U90A 3S55A 3RVRA 3EIXA 1JQEA 1QNLA 4GMGA 2PRSA 5CX1B 2QAGC 2FP4B 3ANYB 2W6ZA 3EQZA 3I2HA 3BGSA 3DV2A 1ILEA 2Z8YA 4QGSA 4KUHA 2FLKA 3G8CA 4IIEA 4OAQA 1JFLA 3CS3A 3RFTA 4DIBA 4UNQA 2PGIA 1E59A 2YY5A 4ZIRB 1FIUA 1H1DA 2EOAA 3B89A 4Q4AA 4TL6A 4TYMA 2O8BB 1D8AA 1XYVA 3IP8A 3OF3A 3SJBA 4BVKA 4EW6A 1VMAA 1P74A 1WU8A 2ZYHA 3OZXA 5BORA 2YXBA 4YRDA 1U8EA 2C3MA 3E22A 3HEAA 3NOXA 2PCLA 2R9VA 3J7AC 1WSAA 3K6SA 4M1OA 1PG0A 2OHVA 2VRCD 3CO0S 4V1CA 3IDOA 1CS0A 1PT7A 2HLNA 5AKXA 1R9JA 2PSHA 4EYGA 5JRDS 2EBFX 4AJLA 2CXPA 3U44A 3WO1A 3ZS9A 3A70A 2BT4A 5I9MA 2WAMA 2ZKIA 4MQ5A 5D1NA 3BWCA 4C1BA 3CUKA 3RSOA 2PUBA 3OPYA 2P9JA 4V0LA 2VYVA 2O4UX 1YBMA 3RKUA 1EM8A 4H4EA 4TXNA 2Q9CA 4JBNA 3TTXA 3QMWA 4J0JA 5MHTA 1B1AA 2KBFA 3SDBA 1AN0A 1VRVA 2C0CA 3COWA 4BNZA 4YUXA 3LCUA 3R74A 5CA1F 4I9UA 1DRUA 4X90A 3WWYA 3HL4A 4QUJA 4QO8A 5LA6F 4IFEA 5BN5A 4IICA 4YROA 3ZJUA 1PFWA 3VX4A 1AO0A 5I3CA 4ALMA 4GLFA 1EG7A 3GVCA 2G70A 2W37A 1H2HA 2X0FA 5AW1A 2ZRJA 2FGJA 1UJBA 4C78A 1SQ5A 3ZVKA 2VI5A 1E6EA 1JFSA 4MUMA 3UWSA 2FPGB 2P2ZA 3LW7A 3HL0A 5C8YB 3MM4A 5IASA 4Q66C 1WXXA 4N03A 5HXAA 1YTLA 4ARUA 3A1EA 4FX5A 5HSGA 3BN3A 4CV1A 3BMCA 1EFUA 3VYTB 3NVMB 3MXOA 5B57C 4MW0A 1JEOA 2O3JA 2YWDA 1ZBQA 4WFIA 3C3JA 1VJCA 1PKXA 4JELA 2X9LA 2L17A 2B7LA 3HCPA 3JAKA 4FLMA 4MPPA 1GRRA 3FFBA 2X1HA 3ZE0B 1BWPA 3HS3A 3LF1A 2VP3A 4Q3EA 1N6PA 3DUFB 5EP1A 4CKZA 1CQIB 5KHLB 2F9LA 4FXOA 4L5BA 4OHFA 2DT5A 4RE6A 2PYDA 2F00A 5FTWA 4NH4A 2FDCA 1P2GA 1QP8A 3E3LA 1P5FA 2AG5A 2QL6A 2R68A 2WFZA 3NXKA 4I50B 4JEMA 1YAHA 4WCDA 4PZ0A 5DISB 3AEKB 2XB6A 3GBVA 4X66B 4YMVA 2RJNA 3FZYA 3AR9A 2DWOA 5JUWA 4TZ0A 1NWCA 2ZQ5A 3DCJA 3BRCA 4JLWA 3DBLB 4NV3A 4CQJA 4OL0A 2D2XA 3MJTA 2PU7A 4OSPA 1PJBA 2G5GX 2XMDA 4NCHA 5E95A 5LXTF 2CNBA 4YLGA 4LBYA 1FHQA 2WJPA 4Z0PA 3KJGA 2P2NA 1GSIA 2W43A 5D7NA 2Q3JA 2W90A 4UMVA 4LHZA 3A6EA 1NN0A 2DFLA 3E4CA 3NAGA 3PRJA 4U39A 4CIDA 1IATA 4B4OA 2Y9MB 4Z2AA 1ZM7A 1O6BA 1G17A 1NNSA 2XHZA 4FI3C 5JR3A 1J8QA 4UVHA 4DUZB 3ICQB 1M34B 3ESYA 4MCIA 3ETHA 1SZDA 3GL9A 2O7QA 3V1YA 3AB8A 1ADYA 2GAAA 3B38A 3ZWPA 2KS6A 4QC2A 4BRWA 1GDHA 2OR3A 1NKVA 1BQ3A 3G85A 1VHWA 1U3CA 4KXNA 4CT0A 1PGOA 4K86A 2R47A 5B4VA 4WKOA 1S3IA 5EWLA 4HEQA 1YOVA 3CLSC 4BX2A 1UBEA 2G82A 3TLXA 1AURA 4NP6A 4GMXA 3SHTA 3V48A 1X42A 1YFLA 5L3QB 4TKZA 3IT1A 3Q3CA 1IBMB 1NNUA 5IABA 1WBJB 5BXQC 1B8VA 2QQ0A 5DW3A 2IOFK 2KB4A 2BGTA 1VYTA 4MWEA 2QXTA 2G0NA 3HO6A 5JDIC 4HGZA 4ZYVA 1P3DA 5CNKA 5IYZA 2Q4EA 2WWRA 4IRMA 1ULTA 4A3SA 1C7FA 3EF3A 2XIQA 4LBZA 4YQEA 3QKRA 1ZNYA 1L8LA 1NI4B 4Z3DA 3JQFA 5SYMA 2O2JA 1GP2A 6Q21A 3QV2A 4Q9AA 2B6HA 1KI7A 3QKIA 4YGYA 3O75A 2V9ZA 2F3TA 3ISVA 1RRCA 1ZJYA 2Z57A 3IX7A 3OCWA 3GFFA 2GN9A 3FY4A 3ITNA 1MJFA 2O5CA 2I7CA 4J1QA 3SDSA 621PA 4J75A 1ISHA 3KYIB 1WHTB 4POAA 3TFQA 1RLOA 1KVQA 4BVHA 3TXAA 1DQSA 2VCHA 2CJPA 3ZCSA 4D46A 3TN7A 3AR8A 3S1AA 4JL8A 1PYOA 3HJRA 1BU5A 2J9ZB 2O0LA 3N8HA 3O1LA 3COVA 4XYEA 3SP1A 3USZA 1XV5A 3QEAZ 1TIBA 5AK4A 3D8TA 3SKXA 5J4YA 2OKGA 2CDRA 3I2KA 3X1MA 4CV2A 5FD8A 3NIWA 4JZYA 4KFSA 2WHPA 4QXAA 3VOTA 2CVFA 1W2WB 3SBOA 2XE8A 3F5DA 3PPWA 2W83A 4IUCS 4PSVA 3GT0A 4TZKA 3CPHA 3ZIAA 4QARA 1PSDA 3JYQA 1TOAA 3ZE9A 3GRRA 4GMDA 3WWDA 1OYYA 2PQ0A 3K1AA 3WLLA 3CRQA 4CBVA 4JYZA 1P75A 4BECA 4B34A 2IX9A 2AZDA 2YUIA 3CZRA 3PD0A 4G1UC 1LPNA 3NTOA 3P2KA 4JLJA 4MEAA 1QV7A 4FYIA 1CUJA 1MX9A 4YUAA 4NJEA 3QFSA 1PL8A 5KOJB 1K63A 2DR3A 4JS0A 2L42A 4FYXA 4F06A 5CA1A 2QK4A 4LF5B 1CEXA 4RV9A 3HTXA 1GZVA 4JSYA 3SQDA 4Z99A 1E4EA 5LA6A 2G0TA 1DG9A 2PD4A 13PKA 1JAZA 2HO5A 3RNLA 3MJSA 3KXDA 3N8NA 2OQVA 1GGJA 1TF2A 2JLCA 3IVRA 2C88A 2VTEA 1RI5A 3PGMA 4H3SA 3ZWNA 4XWOA 1Q7BA 2XNHA 3KZNA 3FR8A 3FWPA 3PPYA 1E3JA 4Y9TA 2B94A 2QNRA 3ER6A 5IP5A 3SS8A 3EQ8A 4A0QA 2NO4A 1YT5A 2EP8A 1E92A 2W71A 3V80A 3IAS6 3U48A 2MT9A 5BUQA 3HJUA 2ENWA 1RP1A 3HBFA 4M8LA 4MX8A 1BJKA 2XE6A 1FFHA 1E4OA 1JAIA 1O77A 1OKKD 3VTZA 3I58A 1D5CA 3B5IA 1V3UA 1ZRNA 2QJTA 3IXLA 3M5CA 3TE7A 4HDSB 3ZX5A 1WDKA 2QZJA 4CQLA 1XQVA 1E79D 1CEQA 4GOLD 4KBGA 1INLA 1SVKA 5KWVA 2FWJA 1WV1A 1P5JA 1YI0A 4MWZA 1B14A 1FSZA 1KJJA 2F9FA 2W4MA 2WVGA 3FGOA 4IMIB 4R7GA 2J0QA 4EBBA 4BRZA 5CBPB 2IS2A 1PRYA 5ARDA 3WIVA 3C5CA 1L5OA 3MBKA 3BFJA 4ZMRA 3INTA 4GRAA 1TZCA 3N8KA 4NDZA 2QB5A 1H42A 3ANTA 4K9PA 3F5FA 2HTEA 4REMA 3KOUA 1GTRA 5BNWA 4AKTA 2WJVA 1JA9A 3BMQB 3EJ6A 2ZAIA 4Q9DA 3S2ZA 4C4TA 1O3YA 1E5VA 1K8RA 3IIKA 3GQVA 5AIBA 5HR5A 2WM2A 4JSRA 4QULA 3VVLA 2JI9A 2P9GA 3TF5A 3EZFA 3HWWA 4UATA 4D0SA 1R4MA 3BXHA 1C7RA 3I05A 1NDQA 3AHEA 3NAZA 4BV9A 2FWPA 3LVQE 4MUHA 4AF6A 4BWVA 3REQB 4FFSA 4HB0A 3CR3C 2X5XA 2ZOSA 5GJWC 1XFDA 3A3KA 5H83A 3H42B 3Q5GA 2RI1A 3R4CA 2VIIA 1PDWA 3R0QA 5IAGA 1YE3A 5A7HA 1YA8A 3QOWA 5E4TA 3UGTA 2XW6A 3HWRA 3OMXA 4X1OA 2CXUA 2VZ0A 3CYFA 4UVIA 2I2WA 4GUDA 2ZE5A 4DTIA 1PS0A 4EUHA 3H6GA 2XCQA 3NTQA 4FSDA 1DFGA 3ZWMA 4Q48A 2Z98A 4KQGA 4TV8B 1Y1KE 3LY8A 4RORA 1KVTA 4D80A 1HT0A 2WT4A 3P19A 3T7IA 3DL2A 3GVPA 3LUKA 4RJTA 5JTTA 1DUIA 1Z5NA 3KZXA 2IKSA 4UREA 3ZY2A 1SZJG 4EJMA 2Z1MA 2CJWA 2GBIA 1M7BA 1PZHA 2FTKE 3GJXC 2HNAA 4DG5A 1PD1A 2A0KA 3L07A 5JALA 3GLIA 1W6RA 4IZIA 4JUIA 1C9NA 4EFNA 3EWAA 1U4SA 1TJPB 5HKOA 3W9BA 1V4VA 1TXGA 1BS2A 4DJEC 4BO1A 1FJHA 5EJIA 1YO6A 1AHNA 1Z0FA 2J9GA 4HWPA 3NVKI 3F78A 2WDZA 1VSBA 4H1VA 4JP2A 3DXXA 1G4AE 2MCFA 5LB2A 2FN7A 4P4UA 1LLUA 2CF6A 3C3KA 4JVSB 2VDUE 5B37A 2NTYC 5AUQA 2DM6A 2JEOA 1FYWA 1Z47A 3FDZB 3UAZA 3ZGLA 3L0PA 1CXZA 5EIAA 3R6DA 1HLDA 1UQRA 5FBRB 4WBNF 4H35A 2FJUA 5MGNA 3HXKA 3W8DA 1QE3A 2P1RA 4F3CA 2J5BA 4LE2A 5AKKA 4PZCA 2H6EA 2G63A 4F4IA 2IPNA 3I1JA 2OD7A 3K3PA 5JLAA 1IJEA 3GHHA 3LXUX 4K3VA 5BOSB 3ZDAA 1TZBA 4L28A 4M9QA 4F92B 1YI8A 1G8JA 3I9NA 3OT1A 2QR3A 4RMIA 2JAXA 1H3FA 4NMWA 3FRJA 1OROA 1M8GA 1UBCA 3HKBA 3I5UA 4JYAB 1V3QE 2ZIUB 5JJBA 4YDRA 1ISMA 2Q4DA 2HA7A 3AM4A 2VYVD 4N5IX 4AUKA 4DLBA 1W0JA 3OF2A 3IB6A 4ZP1A 2CC2A 1YUMA 3BGVA 2FMTA 2INGX 2DY0A 4GM4A 2ZUVA 3SF8B 2OHGA 3PUKA 4MUXA 4N5NA 3G6KA 1OXVA 1OWLA 4Y7CA 3PHGA 3DZKA 3E05A 3ELUA 1Y5LA 2GAOA 4R0VA 4IP0A 4WOKA 1WZNA 2GPBA 5DSZA 3HB0A 4N01A 5ALPA 5DULA 2W70A 4EPTA 1G5QA 3FM9A 1H3EA 3KQWA 5JS1A 2N1BA 4LMRA 1GAQA 5AW0A 3EBLA 4ILKA 4EB0A 2QUJA 4TWJA 2DFDA 1SCJA 2OV6A 2R7LA 3V7YA 4GYJA 1BSVA 1CJCA 3Q1KA 2B2CA 1TO2E 2JAHA 4GZMA 4P80A 4TXLA 4INJA 4ZQFA 5GZ6A 3RVQA 2NP7A 2GK6A 4FOOA 4CIYA 5L51A 1N77A 1Y34E 2FRDA 4EWLA 5ES4B 4I2VA 3U3ZA 3ZV5A 1EX6A 3TFWA 1A1VA 1HRDA 2VYQA 2C31A 1R5JA 1PBNA 2QIOA 4OHYA 5TQ0A 5FTLA 3OJOA 2ZYIA 3P32A 2IYWA 3EFBA 3DD5A 4QATA 1RBMA 2ZTMA 2MYUA 4GX2A 4L0CA 5J9FA 3ZIUA 1CUHA 1XUOA 2WU4A 1T26A 2B8TA 3CMCO 3OCVA 4G0XA 3LWZA 4KPUB 4AN0A 1FTYA 3FRHA 3FZNA 4BLUA 2WQ7A 1YQQA 2EX0A 3JYLA 1VLMA 4BN4A 2E6KA 2M32A 3TDNA 1FRZA 1I30A 1M2GA 3SNHA 1M5TA 1R0SA 2R6GA 3RC1A 2YY6A 4JQSA 4UW9A 3EIWA 2WABA 3IIIA 3EEYA 2UVPA 1H4QA 4WN9B 4G2TA 2FKAA 3LDUA 4D9GA 5HJ7A 1B42A 1EP9A 1USUA 1AK9A 4NESA 2QTGA 2Q99A 3UXYA 4CMCA 2E5WA 2ZYGA 3HJCA 4N5HX 4DVGA 1AE1A 3W3AA 4Q05A 4O1IA 5DHFA 3R6LA 1E66A 4WA7A 3UAOA 4CG0A 2R8YA 3BRWA 3Q4GA 4BVEA 2G9NA 4CU2A 5HWSA 4D4KA 1YZTA 1CQPA 3KUDA 3STTA 1N8SA 5CFOA 4GX1A 1NN1A 3HMKA 4M1YA 4RJLA 4Q4AB 4LJRA 2VPZA 3O93A 3KT9A 1UKBA 5E9WA 5HGJA 1H8HA 3A1NA 1OX5A 3JW8A 3VXKA 1QVRA 4JB0A 3Q7PA 4GRDA 1P1IA 3F2IA 4W5WA 2YV1A 3E22B 1USGA 2QJFA 2GXSA 3RR2A 2D06A 1GZ7A 1U65A 2EKZA 2A88A 3X2EA 5HIMA 1KXJA 2PH3A 4H59A 3K6SB 1TVKA 3NIDB 4ON9A 4Y8VA 1CS0B 3IJ5A 4GPIB 4MWDA 2FH5B 1N34B 2FEZA 1OW3B 1MRNA 1ZLXA 2X2FA 4MUGA 2WZBA 4WCFC 1XJWA 3U44B 5DP1A 2I3DA 4MV7A 3VNBA 4ZJPA 3OPYB 1GD1O 4X6UA 3RROA 5A6VA 1EQUA 3WYNA 1X7ZA 3JALA 1S7GA 1Z2EA 3CKKA 1K68A 4BO8A 1E2NA 1K86A 1VLVA 4PIPA 3VO8A 1TGYA 4IGKA 4BAZA 3L0DA 1E7MA 4PZZA 5DM0A 5TT1A 4QAJA 4PHFA 3T5MA 3EIQA 2JBAB 1I3KA 1O9HA 2ZRAA 1OASA 3AJDA 1FYFA 4J3JA 3OEWA 4M49A 2AHRA 3O31A 5DF1A 1OLUA 2HIGA 2XGMA 3SEAA 4CMAA 4YRIA 2YXNA 5HMMA 4BNFA 3DL0A 1MA3A 3FOCA 2R2GA 3WK6A 1KSFX 2BLNA 4M9RA 1UK9A 4Q7EA 3NBMA 4WXRA 5IDVA 3A37A 2G1JA 4AKHA 1E94E 1VJDA 2XT6A 1E9SA 2YNMA 4ZDWA 5KIAA 5LMUB 1LNQA 3DA8A 2NQ8A 1JQDA 3TBHA 2EFGA 2SICE 4DXDA 3BMCB 4FKMA 4TM7A 1CVIA 1BA2A 4JQCA 5LMZA 3TM5A 4WBNA 3D2LA 3U1TA 1NPYA 3BK1A 4L16A 1R0WA 2AWOA 4ZCLA 3DAHA 4EY6A 1L6RA 5ENVA 4PO3X 2WKPA 3VR5A 1HDOA 3TAHA 2HHAA 3IP1A 3KSMA 5EOVA 4AJ4A 1AXEA 4F84A 3ZIAD 1UBNA 4R5HA 1B6GA 1I6LA 1PZNA 4W63A 4RFLA 1H5UA 3QLTA 1TZJA 4JJ7A 4EUSA 4GBED 3GRAA 2QU7A 5JJ5A 3E4DA 4BNHA 5BRJA 5GZ1A 4EYEA 3AR2A 1DPGA 3F4LA 3P2JA 4RVUA 2WI8A 4JVLA 5KHAA 1IY9A 1E1RD 1KPHA 1RACA 2VWGA 3EVBA 4FI3F 4PTYA 4UU7A 4W1PA 4XWYA 5L7TA 3V3KA 1FJXA 3C1OA 3DOEA 4L5AA 1N2HA 4M9ZA 3Q9NA 4ZO8A 3FNGA 4YB8A 1PL6A 2FCAA 5BWCA 4EAAA 3C74A 3E9MA 3NNNA 3ZW7A 2B8NA 3TGLA 4E6EA 4GECA 5SZHB 1LX7A 1LSJA 1UPXA 2JH9A 1CY2A 4KNWA 3MTGA 2OBYA 1BROA 1FQKA 1MJGM 1Z6PA 3RCBA 3WDLA 1I80A 1Y9ZA 1R66A 2XQJA 2Q4TA 2QNIA 2D5IA 3A6FA 4LC9A 4DIOA 3L93A 3CINA 3CKYA 1T1GA 4DCOA 5CT4A 4H6PA 4JUDX 4B71A 1YR3A 3OZDA 4HN4B 4CIXA 4QUGA 3F5QA 2Z0MA 1NMEA 4CEJB 5EWLB 4GI1A 3NJRA 3GDWA 1IL0A 2VT3A 3L41A 3RO7A 3MWFA 3WYDA 3NO4A 3ZUGA 2JI6A 1N5JA 4R54A 1ILWA 1ONOA 2YFYA 1C9KA 1VSTA 1W4AA 2BHSA 2FVYA 3R8XA 3SM3A 5A4IS 5FUXA 3NONA 5HE8A 1HE1C 5TT0A 1CR1A 2EKLA 3UPUA 3ETJA 3A4MA 3PJGA 1AC5A 1M83A 5BNFA 1CV2A 5CCXA 3D0OA 5A5FA 5IYZB 3NBFA 5CRIA 3WGOA 1VKNA 1U8XX 2HDNB 1G5TA 2W6QA 3RYHA 1BX0A 3EMKA 3N53A 3AF6A 1NY6A 2ORYA 2EJBA 3BSFA 3SHVA 3GJQA 1M2VA 3DLPX 2BSXA 4N7JA 1IE3A 1JDBC 6LDHA 2IUTA 3QTTA 4R2IA 4EJSA 1IPHA 3IIMA 4ZU3A 3WQRA 3EODA 4KHPB 2CE2X 3ICOA 1HYHA 3JV7A 4NH0A 2HR1A 1JWBB 2V1XA 3IA2A 2FLVA 4C22A 4E03A 4CMJA 1MEJA 1LJUA 1TMGE 3RSQA 4CL0A 3GDFA 3CW9A 3S1AB 2W4QA 4K6FA 1N5MA 2REBA 5DLYA 6GPBA 5DBFA 1YDEA 2QTAA 3TINA 4H6XA 5CJ2A 1N6IA 4BNWA 1O4VA 1S2OA 4UM7A 1E5TA 1QMPA 5E1OA 4CTOA 1C3JA 1ENZA 5A2QA 2IPAB 1Y6ZA 2OP1A 2MSCB 1O5OA 5DM60 1VIMA 3UKDA 1XLTA 1OT3A 2ZIAA 3L43A 4Y9UA 2IHTA 2GYYA 2CVZA 2J4DA 3DTVA 3OZVA 3ILHA 1L3CA 4JBWA 1J0EA 4F91B 1RR6A 3D3KA 4RQAA 4L5YA 3H2SA 3K1AB 3P94A 4X91A 2QQGA 2B1IA 3CZPA 3DTNA 4MHOA 4M53A 4M0FA 1F0YA 2NUPA 1T2VA 2UUPA 3NDPA 3RS5A 4NJEB 1E9AA 2G4VA 3G2IA 3LX8A 1U8TA 2QW1A 1ECJA 3R3WA 1DC4A 3K2QA 5CVVA 1NT4A 3SX0A 2ZB2A 1UZAA 2HA5A 1ODTC 2PGJA 3L79A 3ND7A 4R1OA 4BQIA 3FJYA 4RVFA 3U7GA 3CEAA 1DDIA 1E4EB 4QXOA 3A2MA 4LQ4A 3HO8A 3PXCX 3LC0A 4Z8XA 1MB0A 1OPXA 4G41A 4YMSA 3MWEA 3AIIA 1OREA 2Z08A 5AJXA 2K7FA 4IL5A 2W42A 1ZINA 2HF2A 2P6PA 2C4NA 1JR3D 1UT6A 2CBXA 1N3YA 3BD6A 2I4OA 2XVAA 2J3JA 1I7DA 1R0KA 2IKQA 1NXPA 2C5SA 3ED5A 3PR1A 4U7FA 3LUBA 2QY6A 4KEAA 1ZK3A 3OE4A 4CEIB 3ZHSA 1IBRA 1GPLA 1HC7A 2M2IA 1YB2A 3HQ4O 4FIDA 4HAYA 3QUAA 3LY5A 1HORA 3NHKA 1E5XA 3SXPA 1T2FA 2NO7A 3RBZA