2I2BA

Crystal structure of lmnadk1 from listeria monocytogenes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
total genus 69
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2bA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2bA01
3V7YA 1Y3HA 5EJIA 3V8QA 3VZCA 5DHUA 4V24A 1U0TA 5EJHA 3V80A 4HAOA 5DHSA 4DY6A 5DHRA 3V7WA 4L02A 3T5PA 2QV7A 2QVLA 2I29A 2I2AA 3VZDA 2JGRA 2P1RA 1SUWA 3PFNA 1Z0UA 2Q5FA 3V7UA 4WRRA 5EJFA 1YT5A 1Z0ZA 1Z0SA 3S40A 1Y3IA 5DHQA 2I2FA 3V8PA 5DHPA 3V8NA 2AN1A 2I1WA 5EJGA 2BONA 4WERA 2I2CA 3V8RA 3V8MA 3AFOA 2I2DA 3VZBA 1U0RA 5DHTA 2I2BA
chains in the Genus database with same CATH superfamily
4ES6A 2EHJA 3DNMA 3HWX1 1WB6A 1VXRA 4RFSA 4PS1A 3ZR4B 5HPYB 5EWJB 1O0CA 1J8QA 2XQJA 3VNSA 4D26A 3EMVA 4KN8A 1MZKA 1LW6E 5F76A 4N9QA 3OCXA 5JWHA 4UVGA 1O97D 1WTAA 3MMPA 4HO1X 1CNMA 2NXEA 4LF5B 4YBZA 3K9HA 1X8JA 3A1CA 1F5SA 4KR2A 4OHFA 1E2PA 3BREA 4R2IA 2B8EA 1U7FA 3HXOA 3NRBA 1JV2B 4JUDX 3UWMA 2AN1A 2EGGA 3IULA 4IYJA 1S89A 1SH7A 2B7LA 1S8AA 3QTTA 1D2RA 5JSZB 1VE7A 4Q01A 1HDEA 3ETGA 3QQ5A 4G4GA 3B13B 3OPYB 2ERXA 1T0BA 4OK5A 2AI3A 4PCUA 3WKCA 5AW8A 2WUWE 2X4GA 3LRPA 1ADCA 1XQ1A 1ABBA 2CFOA 1S4MA 1Z38A 1J7KA 3AIKA 4JXKA 4X1IA 4MIKA 2C88A 2YIVX 2ZBGA 1NA5A 3IE2A 1YGYA 2OHXA 2ZBVA 3DUWA 3TEMA 3ZEAA 1R6TA 4IUBS 4NG4A 3DZIA 5M04A 1DBRA 4ZYLA 1SA0B 1TNDA 1ULBA 4BVFA 3ONVA 3RAJA 3S1AA 4QPPA 3ICCA 1P7ZA 2BI4A 4EMUA 2YN0A 1VQ1A 2UZ0A 3GFGA 4YCAA 1X7WA 2B78A 2HBQA 2WM3A 5BNFA 3V97A 4YT4A 1QYIA 3H3JA 5SICE 3T5DA 1FQJA 4MWGA 5KKAA 1DX9A 4DWJA 4E6EA 1C8LA 1Y5RA 4EJSA 2P4QA 3PLRA 2LRHA 4XUGB 5F12A 4IWNA 7YASA 2O2HA 3DL2A 3WWDA 4YPVA 1E58A 2QQEA 2WUGA 3TJMA 1EYZA 2DFNA 3N6XA 4PU0A 3RSZA 3ZOZA 2O3UA 3PQ7A 4QEKA 4GZMA 4F5ZA 3R7WA 1JXOA 4EDFA 2KYRA 4JCOA 5L7TA 2CLIB 3T0FA 5JHHB 2AOXA 5SY6A 2OO5C 2P2LA 2Q1TA 1T5LA 3QOXA 4CG1A 3V00A 1V2HE 4V0QA 3GLFA 1Y1LA 1Z5VA 1OX6A 1A9SA 4BX8A 1VL6A 3G5TA 2YJ6A 2VDPB 1QK5A 5E38A 3BFJA 1HQYE 5JEKA 2FOLA 1SBIA 1U8UA 2HIMA 1TAHA 2OV4A 3OMLA 3UC5A 3L04A 3RUAA 3U4IA 2QU7A 5AYVA 1MRNA 2H7XA 1PLLA 2F1HA 3R9XB 3WG9A 2YHIB 2AMLA 5TGZA 1AIPA 2YYSA 1GY8A 3U4CA 4PY2A 1E5XA 4WBNA 5J1TB 1G19A 7GPBA 4S1NA 1VBFA 4RS4A 3C4VA 3UV3A 3GRPA 3D8NA 3B1YA 3HU3A 5BQFA 3C2QA 3CZAA 1WDMA 4Y6RA 2AX3A 4FYKA 1PR1A 4D43A 1G3QA 3K70D 2E55A 2UXDB 3G0DA 4OJNA 2EV9A 4Q4AA 3HCEA 1BEEA 3QVSA 4TZ6A 1SZPA 3BZWA 1XYVA 3BUSA 3C3BA 1PYDA 2Z43A 2QVYX 1REQB 3A06A 1E64A 1ORDA 3DBLB 3DLTA 5KCZA 4KTTE 2OOKA 1KRHA 4OO3A 4YMGA 1KZGB 1MH1A 2JA2A 2W58A 3G2IA 2HHHB 1QVRA 1VYUA 1ZBDA 3RANA 3TMKA 5AJVB 2WUVA 4AM8A 4ARZB 3M9XA 3S1LA 1SWWA 1Z9BA 1MMFB 2PMKA 1GZHB 3CINA 2C92A 3C6XA 1RMQA 2PBLA 2ZROA 3DKRA 1OJ7A 3JQGA 1DINA 1J5EB 4RZSA 4RH0A 2WE8A 3BTSA 4ZU3A 1U0EA 2OVFA 1EFPB 2YVAA 2DULA 3KEQA 4JWTA 4B3DA 1N2ZA 1XD2B 2CBGA 3M6LA 1O95D 1ZH4A 4DMKA 1BKDR 8ADHA 3ORRA 4KNWA 1XDUA 1OHHA 4QJ4A 1VCNA 2O5EA 4KFCA 3RIEA 3ACDA 1RM4A 2H7YA 3BIOA 3QEKA 2H6EA 3KVYA 5BV1A 3DAFA 5LIRA 4HNVA 4P93A 1PEYA 2A30A 3K7EA 5IM5A 4RTLA 5K0CA 4JQZA 3VU9B 2ASVA 4IZ6A 3LUKA 3UK1A 4BRSA 3BL6A 1KH1A 1Z4QA 5A04A 3NMUF 2FWRA 2VHQA 1SK9A 2YV4A 5KYKA 1W85B 4AP9A 3A2MA 4R7GA 1U2DA 1CG6A 4KGVA 5FYDA 1EFUA 1HYBA 2J5XA 1ZOQA 1Z47A 4H60A 4CM9D 3OKAA 1ONSA 4OMCA 1UZNA 3BK7A 1IC6A 4XGIA 1FTYA 4XJSA 5IT4A 3JTEA 1AUXA 2A1UB 4O4JA 1QGZA 3ORHA 1KQNA 4H9GA 3SEQA 4JLNA 5G4KB 2V7GA 3V42A 1OX4A 3ZHTA 1D5WA 5DGHA 4MV9A 1DUIA 1M5RA 3BF7A 1KMIY 2VSOA 3AJ8A 3MINB 4FR0A 3ZCQA 1FLAA 2ODPA 1G5IA 5LQAA 4J3JA 3C6BA 4NSNA 1GZUA 1HDOA 3H83A 4RWZA 2R6FA 2G07A 2ECQA 4HY3A 4QPZA 4PG4A 4B73A 5BVIA 1G6Q1 3MWEB 2GNAA 1K4MA 1FVFA 3KLPX 4HDSB 1JR4A 4L95C 2HREA 5LUAA 3U62A 1JR3D 2B4RO 4AJIA 1JJIA 3PRKE 3I6BA 3V1MA 4A7PA 4D46A 3DTNA 5JY1A 5J2TA 4BTLA 4D8TA 2Y0PA 3ILVA 3GGGA 1T2EA 2M1ZA 4KMSA 4XEUA 2EZUA 2EZ8A 5BYJA 3WBFA 1GXSB 4E03A 3UNMA 4EHHA 3PDJA 2V45A 1U5BA 1X1DA 3NNSA 4N47A 2FA9A 3BHIA 2W2QA 3DOIA 1N5RA 2BGGA 2INGX 3FNHA 1PQYA 1VI5A 1Q1ZA 1NTRA 1U3WA 1VG1A 2XUKA 3CS3A 4S1WA 2HN9A 3RYIA 1JR3E 3OHMA 3UTCA 2XGSA 3ITNA 4PGHA 4DDUA 5HQTA 3FR7A 1JFFB 3A1UA 2L18A 3NVAA 2Z1NA 4AJLA 4DREA 5HKKA 3UPUA 4GRIA 1XXHE 2ODBA 3HYNA 2OORC 1ZOLA 1P61B 1VCHA 4O4IA 2XT9A 2C3OA 3QEOA 1E1RA 2JVKA 2UVPB 2ZJ3A 3EBLA 1B8NA 2PT5A 5TX7A 3RJ9A 5FWYA 4ND6A 2OGZA 2HNKA 3OEWA 4B48A 3PC8A 2HBYA 5BSVA 7REQB 1J0CA 2PJDA 2NO1A 5C7OO 1RAIA 4PSCA 2PUCA 1O58A 3OCYA 4I4IA 1E6LA 2CMDA 3JQ8B 1THZA 1KQOA 4ZQBA 4R2MA 5K3FB 3DYVA 1Q2UA 2R7AA 2ZRAA 4UHFA 2XAUA 4G0XA 2DFVA 4XYEA 4B2LA 4IINA 1Y7HA 4CF7A 1QYCA 4KN9S 1Z15A 2CL5A 3ZPXA 4EQZA 2WP8J 1R21A 1VFNA 3JWEA 1J0BA 2GCPA 1LZLA 2ACVA 1TVCA 1V26A 3PLNA 2X5XA 1DX4A 3I73A 1NTOA 4FLEA 1KMMA 4RACA 5TQVA 1NQVA 3SBXA 2JD2A 4P2BA 3FYUC 1KWGA 3NC0C 3CSDA 3OT4A 4NAVA 2VYNA 2YHBA 4OUDA 1Q6YA 4RV4A 3OZUA 2QYTA 3GLRA 1U2SA 1P4HA 2JIRA 1QIIA 3TNLA 5FEUA 2V4UA 3FB4A 3ICPA 2BH9A 3B2QA 2GVDC 3V3KA 1MN6A 4P36A 5TEVA 5CT4A 1N7GA 1NU6A 3H5AA 1MEEA 5JEOA 2LIVA 2WWWA 5EHIA 5JROA 2YYYA 3HUTA 4LMRA 4R8SA 2AKEA 2AI1A 2GXQA 3AF2A 3L07A 2JJ2D 4JIWD 2H2WA 2QNBA 3FRJA 1IOZA 3M4XA 2E4YA 3PXCX 3RSOA 1AQJA 1XQ9A 4JBXA 3L8MA 3S2GA 4A6EA 5KREA 4QUKA 4ZALA 3MLAA 1YC5A 2Z98A 3MT0A 1B00A 3NH6A 3MS4A 2H5IA 1QC5A 2REXB 3UW1A 2SBTA 2OV8A 3X2SA 3RREA 1Z0KA 3PDCA 3ZNPA 4JB2A 4BRWA 2JK0A 4D5GA 4EHBA 2WSYB 4EUSA 2WQ6A 1JIQA 4ND4A 1FLDA 2C8KA 3MFYA 3D1LA 4BNJA 2YYZA 3VPBA 4TTQA 3D2LA 3ZTYA 1IIRA 3VJKA 1RZRD 1M3SA 4OOFA 4F91B 1D5CA 4TWRA 5DBGA 3JARA 1YRLA 4XVCA 1H2ZA 2PCJA 3EPKA 1BE0A 3HV0A 4JI1B 2X6RA 3IPXA 4NV3A 1NW6A 4H0NA 4XVUA 5KQRA 3LL7A 1U80A 2P9CA 5J4YA 1WCYA 2VUUA 4MS1B 4G86A 1KORA 4XDZA 5IP5A 2VJMA 1AKYA 1JHDA 3H5OA 4ZXFA 3RAGA 1P1HA 1Q7CA 4WZAB 3VSCA 3EPHA 2HPZA 1JLKA 2BCEA 5FQNA 1UC8A 5LJLA 1HT3A 2PQMA 1XK7A 2XIQA 3BDVA 2PT9A 3IQDB 4YMWA 3VHRA 4DG5A 2YFKA 1AK9A 1D6JA 2Z3ZA 3BB3A 2Q2VA 2X0KA 4KLCA 3KOZA 1L5QA 1BDJA 1QHYA 2GBFA 1UM9A 3H0KA 1WXHA 3LM8A 3U7JA 4D2IA 1P4GA 3L1HA 5A5VA 1N9KA 1W4LA 1XMPA 4OF4A 3C48A 3IKLA 3ZXIA 3H04A 2WIFA 1M73E 3LLMA 3ERCA 2RGAA 3DXYA 4JC8A 4B7AA 2FFJA 3HKBA 2CZGA 1QWTA 1W46A 5IAKA 1DIBA 5FNVF 4DWOA 4BY9E 1JSRA 1H4SA 4DABA 1EJ2A 4GOOD 3DBVO 2W6IA 3EH2A 121PA 1YAHA 1P1JA 2IYNA 2V6FA 1PZHA 1Q19A 2I6FA 4MI3A 4DC1A 5JCPA 1PKXA 3ZLJA 4FVTA 3REGA 1ECGA 1OFUA 3C0KA 3H2YA 3LG2A 4KC0A 1GV1A 1KSFX 3P2EA 4FB4A 2WNIA 5H68A 4EQ6A 3QXHA 3UJNA 1ESEA 3EN0A 2WK1A 5THKA 1N3IA 3FSGD 2JFFA 1QDUA 3HZOA 3FUXA 3GCDA 3K5PA 2XTZA 5THXA 2E5FA 2J9FA 2R44A 1WY7A 3KQNA 4B46A 4FZVA 3GDOA 4UMFA 4AZVA 2A35A 3TXYA 1XROA 1F0YA 1F8XA 2JQJA 5EJFA 3O8BA 1S0UA 4BFLA 2Y1LA 1ORRA 1MNAA 4E11A 3FDIA 1DCKA 3AL3A 1V25A 2FE1A 3H11A 4N3GA 2XNDD 1OYVA 3SHOA 4F8JA 1OD6A 3W3AD 2VHEA 3MVEA 4HXGA 5HFNA 3WRWA 3GLHE 5JRZA 1GD1O 1DDGA 4NMXB 1G20B 1QG4A 1T5SA 4K40A 3ZCXA 3ZV3A 4P5PA 1RYYA 4C7OB 3QVVA 4HNQA 1YB7A 3MMXA 5HJ7A 1M6YA 4F4CA 1RNLA 1K7YA 4YUXA 1J7JA 3UHJA 4H1VA 1II8B 1K7XB 3BAZA 4CKYA 3ANXA 1M83A 2PD6A 1D1TA 3WGMA 3ZW9A 3R0VA 4ER6A 2CF5A 1NBMA 1K7CA 4GI1A 3VR1A 3G0HA 3ET4A 2Z9CA 3FWYA 621PA 5K8TA 4JP3A 2J3HA 3I6YA 4J94A 1KEWA 3FZYA 4L9AA 1A9RA 5HOQA 4F85A 3VPDA 2VT3A 2BTEA 4B5LA 4CKWA 1GXCA 3BHMA 1CCWA 2M6KA 2CHFA 4IIFA 4QDKA 2BT4A 4HYYA 3UMRA 4BZQA 2QXYA 3LYLA 4XB2A 2ONKA 4DIMA 2Z6AA 3USZA 4L8FA 3RV3A 2P7HA 4IDGA 3U7HB 1YULA 2BN4A 3O8LA 3TRJA 4A03A 4F60A 1CEYA 4RH3A 1TVMA 3DP7A 1U9ZA 3MWKA 3KQQA 3RVOA 4UU7A 1XDGA 4WE3A 1KZ6A 3ZX4A 2B9VA 1NDHA 4M88A 4AYWA 3TTSA 4J7XA 5HIAA 1I2MA 4I8XA 4MYSA 4GSYA 4K8OA 2J45A 3L01A 5AKKA 1RFGE 3VDXA 4C3OB 4FZJA 3HZRA 4C4TA 5BSKA 1C4XA 1O4WA 4H7IA 4PFQA 3RTEA 2G1KA 3AHHA 4YX9A 1W36D 1KR2A 2EP8A 2MWMA 5K4GA 5AKHA 4AJ9A 4TN5A 1IY8A 2KSQA 1W29A 1X7DA 1VI6A 3DEAA 2BMAA 2BHSA 3W06A 3O3MB 2R6GA 4H3SA 2OM6A 3EMDA 2GM5A 4LOKA 4QTTB 3V55A 3VZDA 2Y1KA 3A1DA 1FK8A 5AW0A 3U4MA 2CVOA 1ZUWA 4Q24A 1Z5PA 4LRSB 3MSXA 2ZAGA 3BQ9A 3PC4A 2XUIA 1HTWA 2ERYA 2WDPA 1SC6A 3CB4A 1FU8A 1S3SA 4IIDA 5EKUA 5EYPA 1OXSC 2R5FA 3HL0A 4NE7A 3WAKA 1RXVA 3GMDA 1JPNA 2JDIA 4TN1A 1WB9A 1DOAA 1UJBA 3SG0A 1NVKA 5HYVA 2FZWA 4F93B 1E4OA 3GW8A 3REOA 4D8VA 1GTVA 3KUKA 2MSKA 3ZV4A 4E2FA 3AUAA 3EEQA 1YIOA 2FTKE 3GG2A 3I01A 5HEKA 2PZKA 1MG0A 1CQXA 4I6EA 5LZ9A 3FRHA 5H82A 3X44A 4BJ6A 3ZV5A 1ODTC 4PW0A 4YAWA 4Q5IA 3Q7QA 2GXSA 3DLCA 1VRVA 2PZFA 4RQBA 4OP3A 5EMLA 1O54A 3KB6A 1ZK3A 3Q85A 4RD4A 3OFSA 2ZRGA 2Z5FA 4WKBA 1EM8A 1JJVA 3VC7A 4OQPA 2VK2A 3MGKA 2HU2A 4Y0NA 4C43A 2V9PA 4F1WA 1MO2A 3CWZA 4ZODA 4ALNA 3DR5A 3ADDA 1G8GA 1HYQA 1SKYB 3IHLA 2O7VA 2I6UA 3IEUA 1I4WA 1JWLA 1KO5A 2WT8A 4KQXA 1KMQA 2NO6A 2OSBA 2IPOA 4GO1A 2BAGA 4BNNA 5TVGA 3PNMA 1PL7A 1O96A 2VQEB 3GJ0A 3NLLA 3LX4A 2FZVA 2QENA 2Q0QA 3CSSA 4K0RA 3H11B 4W5RA 2Q1WA 1E92A 4OI2A 4IDPA 2H4FA 5SV2A 4W8HA 3DTTA 4LZLA 2VJAA 4NICA 3NEJA 2R8XA 3IOEA 4DZTA 4JT2A 2XRZA 2B4KA 1EFVB 4P7KA 4EF6A 3EODA 3HSYA 4EJSC 2XTJA 3E5MA 4MJ7A 5J4HA 4AO6A 1JQDA 2IGTA 4PLYA 2VHTA 1WUIS 1H0SA 3MJSA 4LWOA 3PXXA 4IIHA 5HP4A 3TKLA 2C83A 2EG5A 3F47A 2FVXA 2JLCA 4TL9A 4B8ZA 4FFSA 4JGBA 3PC2A 4XVRA 7REQA 3M6VA 3O8DA 4MICA 2W2PA 1SHUX 3CNEA 3JALB 3NANA 1A5AB 4KMRA 3UNXA 3VRHA 3B3JA 3TYXA 1KEKA 2Y9PB 1NGSA 4E14A 2PR2A 4B3HA 2PJRA 3P9IA 1P4AA 2AJLI 4MKZA 1TAGA 2AXPA 1L4EA 5ALOA 4AG6A 4DRYA 1L2TA 4QYIA 3AERA 4QASA 4UHDA 2FPPA 5KIAA 1GPH1 3MS2A 3C5CA 4IF6A 2C3UA 4UHCA 5E95A 5KPJA 5BN3B 5JH7F 1N25A 1X80A 3HBAA 3CO0S 4F9GA 4OXNA 3MJRA 3HVHA 3KM0A 1RI5A 2WV9A 4XX0A 3UENA 1N34B 1XNRB 3RK1A 3GLHA 2ZCVA 4BO2A 5I8WA 2OZLA 3SY8A 3ZE9A 4AJNA 1LF5A 2J3QA 2OHVA 2ZANA 4WZZA 4CKXA 1KYQA 1OWPA 2C3MA 2NT3A 2ZDHA 3KWLA 4X8LA 5EWLA 3VI3B 1TF7A 1KQPA 3L0PA 4B4WA 3O0DA 3KYJB 4FBGA 2DT8A 3DOHA 3F5FA 4ZEWA 3P2MA 3W6ZA 3WAJA 4MVJI 2FMHA 3L05A 3LK6A 1N2CB 1KDRA 3K0KA 4Q9HA 4AUNA 4Z7NB 1ACJA 2XA9A 2JAXA 2ZZKA 3L8FA 5B6PA 4CGZA 5EKXA 3A05A 3ZH2A 1XE3A 3G5AA 3GAMA 5LDGA 1SK8A 1TD9A 4NRDA 4FFMA 4WZBB 3RFVA 3D2BA 3DWFA 3OIFA 3UCXA 1QG0A 3ZZUA 4EIWA 2C2BA 2CFIA 4HJXA 3PGJA 2PPLA 3EQ2A 2WKQA 1V1JA 2XSZD 1E1RD 1QO9A 5E7IA 5CT5A 5HBRA 5IMSA 4PZ0A 2QOEA 5K0BA 1TLLA 2HU8A 3TNDA 1E2FA 4F4DA 1Y1SA 2ZSIA 2EFYA 2JLBA 1LI5A 3RUPA 3T0GA 2GZRA 2RH8A 4AWXA 2QTMA 4GVPA 3PJRA 2BKVA 2XZLA 1L4UA 2GDZA 2IXGA 2IBMA 4FFWA 4UREA 4X7BA 4DVGA 1SC4A 5TS3A 3AIOA 3VU9A 1GOTA 3ZK8A 5AM0A 5ELXA 1MAVA 2IXTA 4OBEA 1QLHA 4YPOA 4KSYA 2X22A 1M0SA 2GJ9A 5CPFA 1TJ4A 3DTVD 3HEBA 3OIDA 3IILA 3BSSA 1MORA 2QRMA 3DUFA 1IXSB 1R6VA 3O9MA 3J81k 1WSDA 1S5PA 4GZ5A 4JK3A 3MRTA 2JHCA 2QKYA 4RW0A 3TQFA 3VV3A 1Z73A 3LQQA 1N6OA 2A92A 1T6XA 2PWPA 1F9AA 2ZRNA 1J1UA 1RWWA 1Z5NA 2JCBA 2DEUA 4LDNA 4B7XA 2B35A 4ZCPA 4DSAA 2G5TA 4YUAA 5AI5A 1J2EA 3KSRA 3QNWA 1BWQA 4KXWA 4QSHA 3I9LA 5AOBA 4RA9A 5DNWA 2UVQA 1YGPA 1UFVA 2VPWA 2HJSA 3R3XA 4X97A 4Q9AA 2TMDA 4X8HA 5BSTA 1EFVA 1XTZA 1GILA 2RONA 3TCNA 2CLCX 4RD6A 4XD2A 3IO5A 3WB9A 3W5HA 3H5LA 3DD5A 4LE2A 3C5HA 2QAIA 1GDHA 3ZVNA 1EUQA 3HMKA 2X13A 5G0SA 2I1QA 1FPQA 2DTEA 2FW1A 3NHZA 2EGHA 3FXAA 5JS8A 3I6UA 3KT3A 1ZJ6A 2RCYA 4INAA 2EU8A 3TW8A 3SQXA 2C7QA 3WICA 1ARZA 2VZ8A 1OLSB 4BX2A 1CZKA 1I3MA 1U8ZA 2BKLA 2JGAA 1C9DB 1VIYA 4KI7A 5MHTA 2XWPA 3W4KA 3ZWVA 5DBOA 3LOQA 2JFPA 4RD3A 5DI3A 3UC9A 5K7SA 3FOEC 3MOSA 5BPHA 4G1UC 4RM2A 4XGNA 2D62A 4V0KA 1VMKA 4LPSA 2FZCA 1QIJA 5IJXA 1T2DA 1INLA 3EEIA 3QLUA 3ROFA 1WNTA 2EXXA 5JC1A 1G20A 4DJDC 3B6KA 3BTOA 1SXPA 2XDAA 1TO2E 4MVJE 4TTIA 3V8NA 2ORWA 1HC7A 1K27A 4WOBA 4UQLA 4FYJA 4HGPA 3HCBA 1IG0A 5GMOA 1QQ5A 3ZBQA 2MINB 4PVCA 2XCRB 2IU3A 5DHFA 1CFZA 1EINA 1U28C 5AVJA 1HYHA 2PMFA 3HFGA 3ZE6A 2UZAA 1HE4A 2FMFA 4KJZA 2GO1A 2B3TA 5CCEA 4PXAA 2HQOA 2OG2A 1SC1A 1TIPA 2PD4A 1SUSA 2Q3JA 1RHKA 3GROA 3DT8A 2ZTVA 2FLKA 5AVYA 1AA6A 1NFRA 2I91A 4X1YB 2P0EA 1ZICA 1V6CA 3F3SA 4NV1A 1ZK2A 2W8ZA 5CYOA 5JVDB 1D1SA 2OGUA 2KHZA 4PGAA 4JBGA 2VTBB 4DCTA 4D3YA 3WX0A 1K6EA 1X7WB 3NBUA 4Y2UA 1MX5A 1ZD5A 4CT4B 4XQEA 1BCSA 1ZRHA 4JLMA 2DQZA 3DUFB 4ZVTA 2BR5A 3L6BA 4DLNA 3UAVA 1KI6B 5FCDA 1XAJA 5BQ5A 3F71A 2FFQA 3EH1A 1E61A 1OY1A 4U9UA 1FTWA 2ZYHA 3YASA 2H2DA 2JA1A 5AVUA 1R12A 3RRMA 3A9UA 3I61A 1Z0JA 5JMTA 4M21A 1BU5A 1T4CB 2IS4A 2FX3A 2Q7XA 3CG0A 3AF3A 3EIQA 1RC8A 1YK0A 2ERCA 1V1RB 2ORVA 1SXHA 5FR1A 2G63A 2VSNA 3TFOA 1I5RA 2VPYA 2YR0A 3G82C 2NYAA 3FIJA 3GLSA 3LCCA 2IHYA 3IR5A 3QHPA 4LE1A 4YV1A 4LF6B 1LTKA 3K2QA 3OPYA 5LMCA 1YR7A 1YL7A 2PJUA 3KZOA 3H2BA 1MJGM 3N9IA 2JC3A 3E27A 4I9UA 4TTPA 3RD5A 3IBFA 1F8YA 2BMVA 1XU4A 1FUUA 1R16A 2Y1EA 2Q0HA 2YUTA 3C4JA 3QVLA 1E9FA 1XCLA 5T4BA 2FQ1A 3UHAA 4CMEA 1DIAA 5PGMA 1BS2A 3KQMA 4PTYA 4AROA 3Q6MA 1EDOA 1PZFA 2X6TA 3OPNA 3DZCA 3AUSA 3Q9UA 4YFYA 3K9NA 1XQWA 2JVIA 1HDRA 3L7OA 3MTIA 2JJ8A 4LXGA 5KINB 2RGYA 4JU9A 2O0MA 4QUDA 2R86A 1C7JA 1H1DA 3EIFA 1JLLA 5MGNA 4U7JA 4L4UA 3VR3A 1AF4A 5HZMA 2X8LA 4MVXA 4BV2A 4AJHA 1IY2A 3L8CA 1H6CA 3U1BA 4AJJA 2UDPA 2I80A 1J99A 3ZJUA 1ZONA 3LZ6A 1AGPA 1DJNA 1FVOA 2B6HA 4FE4A 2Q2QA 1A0OA 1UZUA 5LQMA 3VI4B 2IKSA 2KLHA 3AONB 3DMTA 4P3OA 2JANA 3I1IA 2F2TA 4RIIA 4C0QC 1Z13A 4BQOA 3RS3A 2LXNA 1TX4B 4KODA 4L3WA 2UZ1A 3KKEA 1AU9A 1P7WA 2GCOA 1R37A 3DQZA 1KVUA 2ONZA 3ETEA 3NDJA 2C8JA 1QC5B 1S2IA 2IITA 3GEBA 3HY3A 1A88A 1ZMBA 5KTTA 5AW2A 1E5VA 1NYRA 2BFFB 1Z2CA 2PD3A 2XA2A 3QPAA 1AQNA 2CLSA 3RYCB 3D3NA 3AUKA 3DO6A 4LNAA 5BSGA 1I5OA 2DPHA 1E77A 2R7MA 1SUDA 1VB5A 1Z5UA 3GOQA 4BVGA 4JL6A 4O1HA 5KNDH 2OHOA 3ZKAA 5JH7B 4RS3A 5I9SA 3HA5A 1WZNA 2GEUA 4NZ9A 4A5OA 4EJFA 4FW8A 1TC1A 1E2KA 1YMQA 1WXQA 3MEQA 1M33A 5FNVA 4JGGA 3T5GA 4DXHA 3GLFE 1FP2A 4MW0A 3LQFA 4BP1A 1N6HA 4N76A 1P17A 2EHDA 2LP4Y 3IC5A 3L7NA 4J8PA 1XYYA 4CUJA 4G07A 1JIIA 4AICA 4ECEA 2GM4A 5KVSA 3HI6A 1FRVA 2XUDA 4OFZA 5DEIA 3E1GA 5HGJA 4QU9A 2GVNA 1MFZA 1Q3KA 1QMGA 2XECA 3EAFA 3SVZA 3GGJA 5H1YA 1Q0LA 2ZYWX 1QPBA 1YSCA 3LRXA 5SYNA 3WK9A 1NN5A 3VNRA 1P4SA 2BFPA 3S70A 3ZD8A 2EQAA 3UUFA 1UM9B 4OYHA 2OCGA 1SBCA 3K0FA 4TPKA 3TMAA 5K3FA 4QFDA 3JCZA 4A2QA 5EZYF 2VP0A 2X0RA 3GBPA 5JCXA 1WQ3A 2PMEA 4NPCA 1RZUA 5U1PA 1GRCA 1YJXA 4DW8A 2OECA 1OKKA 3RSFA 4Y1RB 1RYBA 1YZQA 3WP1B 5B57C 5C1PA 5L3SA 2B8NA 2GX6A 2OP0A 1YVRA 4QLBA 4DC9A 3SR4A 3UAYA 3WFZA 1SA0A 4CMJA 3NETA 4PPYA 3OLCX 1T2NA 2XT9B 3I23A 2G88A 3A0RB 3E9QA 5AXDA 2FKNA 3THSA 4K9MA 1XV5A 2A86A 4WCFA 2ZDQA 3WO0A 2QTWB 1MJSA 1R3DA 5HA5A 1RWQA 1CFJA 3WQSB 4A10A 3VKFA 3OJEA 1HNNA 2HJGA 3AEUB 4X84A 4AKGA 5DLEA 2AG1A 1RP1A 4A0FA 4O4HB 3KEFA 1XF1A 2FR1A 5UKDA 5IRCD 3P71T 1JTEA 3Q6NA 3MTBA 4MLDA 4B17A 1PNRA 3OU7A 3BS4A 2P90A 1PU2A 2X77A 4TV8F 3RFFA 2HHJA 1PJ8A 4KR0A 4EGJA 2LBPA 3KJNA 3COSA 5DDIP 4PYMA 3AY0A 3JW8A 2IUFA 3SF0A 2I8AA 1C3EA 1OILA 3EULA 4L78A 4TVBA 5HS6A 5MN5A 1KJNA 4RFLA 5G0UA 2HRDA 4FNAA 4DGSA 4YJHB 2QLFA 1YBVA 2CNLA 2P91A 1AM4D 2HMSA 3RSSA 2AS0A 3T34A 1MXFA 1QUFA 1ZAKA 1SVOA 2BSAA 3Q9NA 4HAYA 5AI9A 4Z0HO 1Q20A 2VQ3A 3WWYA 4B35A 4QHTA 5B3LA 1WVGA 4DLRA 3LCMA 4Q4LA 2XJ4A 4WMLA 1O94A 3DE0X 5JPCA 3KUUA 1S7CA 1KNQA 2Q1SA 4NATA 1NQ5A 3E5NA 4BNUA 4DTIA 4F1JA 2GN0A 4CQLB 2P3QA 3CZ5A 2EX4A 3AEYA 1UZLA 4P7BA 3TLXA 3TKAA 3QVGB 4AZTA 1NN1A 2Y1OA 3PPIA 4ZEXA 5IJ0A 4C05A 1IQ0A 1TJYA 2IFTA 2XITA 3C3CA 4C01A 3OHPA 3I9V1 1KQGA 2FUCA 3AR3A 4WFQA 5AW6A 4WN3A 3CLVA 5K0GA 5TJHA 5DCYA 3DXFA 5F33A 4O4IF 4AB1A 4CKBA 4DSZA 3EY4A 4PQFA 3BK2A 1FUYB 1KU0A 1PL8A 4QXRA 1Z0IA 4RZUA 1K8XB 5BN1A 5I45A 2C03A 2EW1A 4W7HA 4RULA 2D1QA 5KYUB 2EL7A 3LDHA 4BO9A 3RR2A 2ZRDA 3O4JA 4TS4A 3RJ5A 2Q8QA 3AVPA 1U9YA 4EAAA 1YI0A 3TZHA 3ORYA 4BQQA 4XKJA 1HL3A 3ADOA 1E0JA 3FSEA 3PFBA 4EUNA 2G5PA 3TN7A 1FS5A 2VZEA 2HMWA 2G77B 5F5NA 5AHXA 5JSHA 5E1MA 2JD1A 2Q5CA 4DJFC 4TYNA 1FRQA 2EIXA 4QBHA 1L5KA 4RLHA 2W8BB 2QK4A 4J75A 1NW8A 1U02A 2CGEA 3L77A 3GJZA 5CLGA 3MJVA 4JLBA 4OX9B 3ZYZA 4LYYA 1XL1A 4JUFA 2BPOA 4NEGA 4N18A 3EFBA 5AJXA 3Q87B 4G37A 3WLRA 1MB9A 3FDFA 4RD0A 4XLLA 2XNJA 4CFZA 4CKEA 4DPKA 4F7DA 3OZXA 3K71B 3P45A 3FYSA 4BUJA 1LPSA 5DGCA 2FFRA 4YXWA 2BI7A 3L0OA 4ZCLA 3PXGA 3K1AA 2OD7A 2RGUA 3MB5A 3EGVA 3DYBA 1E99A 3NOQA 1SUFA 1IUOA 2OXEA 3OQJA 4L5IA 4JXZA 4OCZA 1AZLA 1BXZA 2WJAA 3H8VA 3ZBUA 5CTJA 5LLTA 2YC4C 3IVXA 4A2CA 4B3MB 1AKWA 1FFXA 1Z8FA 4DG9A 1H2XA 5A6VA 5HCNA 3T3OA 1IVYA 4L8LA 1BYUA 1ZITA 3A4VA 2WAOA 3K0HA 4KSCA 5KSZA 3TQQA 3RU2A 5A0TA 4R1QA 3SVLA 1WB5A 1L7NA 4OGWA 2O8CA 4L02A 2EP5A 4M36A 1XZIA 4FYWA 4KYTA 4QRDA 2IPNA 3OX2A 1TTQB 1V3VA 2FWJA 1AD2A 2DY0A 1YS7A 4L8GA 4RF3A 1Y1PA 2ZWPA 4RKWA 1G9TA 1ZPDA 1XEFA 3LUGA 2PUVA 1PFYA 1XZKA 2B61A 2JH9A 4MKIA 3FWKA 3QF4B 3T5BA 3U3DA 4M1OA 2IPXA 3M9LA 1QG2A 3P9NA 4N5IX 1L3CA 1YFZA 3DOUA 3G7SA 4ML3A 2GJKA 3A6EA 4PNPA 1V9CA 4ESOA 3TS1A 4RHUA 3D7SA 2V7TA 4IDHA 1U2TA 2E85A 4PLZA 3SC2B 2D06A 2ZJ2A 2FX2A 4DDMA 1IHDA 3NHFA 4YWHA 4K03A 1NP7A 2DHQA 2D1SA 2UZIR 2FF4A 4DB2A 1WL8A 3FUVA 1RLTA 4XZ3A 2A4MA 5JU6A 3JQAD 2P9HA 4E70A 1TQ8A 3JYOA 1KVRA 4MKFA 3VTZA 1BG6A 1IPEA 2C5LA 1YZTA 2C8LA 2CBXA 3AU8A 3HZHA 3LPNA 1PRYA 2HPAA 1SMKA 4X6UA 4KOAA 3JQGB 5B7QA 5JOQA 2VQDA 4KPGA 1XJWA 3EAQA 2DWPA 4V38A 4ZTZB 5EJGA 1ZCZA 3TTWA 3W6UA 3D7RA 4MS1A 3RHTA 1VMAA 3LLSA 5EXDA 4EI2A 2QPAA 3BGSA 3EXIB 3FNBA 3U39A 2YIJA 3FA2A 1NVUQ 4DEYA 3S29A 2I4RA 4DKJA 1J0DA 4LGMA 3BGWA 4YQZA 1I2CA 3EF0A 4IJVA 4N3AA 3WY9A 4Z4QA 5H5JA 3E9DA 4HC4A 1D6SA 2X1MA 3POAA 3PHGA 1XUOA 2BKEA 2YJ5A 3E3OA 4QT4A 2M1XA 1H8EA 2XCUA 2ZITA 3NDIA 1J4OA 3Q11A 4UTOA 4X1KA 3AC0A 3L8DA 1U2RA 1I94B 4Q9JA 1JWAB 1I4OA 1DAGA 1AZSC 4D96A 3KAPA 2FSHA 3IP5A 3ZY3A 3BJIC 3TIIA 3IIKA 4ZEVA 1EP3B 1MAHA 1XXLA 1KS9A 3IAS1 3E0XA 1RYNA 1LV7A 2F8MA 4LEIA 4TKLA 2Y6VA 4B1FA 5CEEA 3HTXA 1V96A 4YXWD 4J90A 2J0QA 4O1MA 2F3UA 2ZIGA 1NI3A 4GVLA 1N6KA 4EFKA 1J0EA 3ZUPA 1ZAYA 3EASA 3NC4A 2YWDA 5A4AA 5EIFA 3A11A 3IHTA 1EFHA 4JMLA 4EBBA 4KRXA 1MTOA 5T67A 2ZXUA 1QRUA 3Q2KA 1MDFA 1J0XO 2QTLA 3OQHA 2BHRA 3PS9A 4LDZA 2BISA 3VBEA 2VO1A 3G2PA 2ZR8A 4MQUA 5A02A 1CR6A 3X0DA 1WXWA 2WIGA 2GJ4A 3LF1A 1G21A 3AR5A 4EA6A 2MU1A 3N2GB 4LSZA 1EUCA 4PBSA 5T3YA 1D2EA 5CJPA 4HGYA 1M2OB 5K20A 1WS6A 4JP8A 1GV0A 3EC1A 1EIZA 3DHVA 3K09A 3KFXA 1M2EA 2AG8A 5GJCA 2JDID 3N7UA 1CWUA 2D2IA 2O5RA 2D3WA 1UJXA 2COEA 1O5OA 3MPOA 4WUTA 2LTAA 4HL6A 4ZAFA 5H7XA 3W8NA 1SC9A 3CO5A 3ZX5A 1E2LA 5D85A 2FFBA 4QPDA 4YASA 2AQHA 1D0IA 1CB0A 1IAVA 2LPMA 1D7OA 2FWBA 5JLAA 3A27A 4NOMA 4YYZA 1O03A 2QG9A 1NBAA 1O7JA 1UKEA 4IYRA 2PL9A 4YMHA 4YJFA 3S55A 3VH1A 2GWHA 4MGZR 4UD2A 4CLXA 4XE5A 4IOMA 3ZZNA 4NJEA 4PLVA 3OI7A 4DV7B 2CSXA 1Y0BA 1JIUA 5KKCA 3S81A 1TUEA 2QVCA 3CM0A 3VYWA 4BNKA 2BBWA 1PT6A 4DCGA 5ALIA 4CKCA 2R60A 1FDWA 1OBHA 4CIVA 1WKCA 1PYGA 1YRWA 5A4FS 1E6EA 1SHKA 3EQ6A 4ND1A 5ALLA 1EX9A 5LP6B 3SK0A 4BKPA 4PC3A 1CPYA 2O1XA 1A71A 1J00A 1P1CA 4YR9A 2P5YA 3GP5A 1XU7A 1GNVA 1VHLA 5JLJA 1WETA 4B3BA 1KNXA 4GEKA 1FTQA 2P62A 1OH7A 4RO0A 2BGIA 3EGDA 1GM5A 1X87A 3E4DA 4FM9A 4ACAA 4K46A 3ONDA 4RPCA 1O6ZA 2CJPA 1YCGA 4BNTA 3N6VA 3I9JA 2YRFA 1OZGA 4C0SA 4XSGA 1U5CA 4Q1DA 2CCGA 2Q9AA 5DHQA 2C7VA 3PGA1 2HCJB 2HSZA 1RZ3A 4D9HA 4UFPA 5LQRA 3D7NA 1Z4LA 1SQFA 1WPGA 2QYOA 1Y9JA 5CA1B 3A2LA 4C4AA 2GERA 3S2IA 3RADC 4J4HA 2F1RA 1CY1A 5JYDA 2REBA 3PRHA 2F1KA 3O5AA 1DC8A 2QL5A 3OM1A 1E9VA 4G65A 2NSHA 3J7TA 1G17A 3B6JA 1FTSA 4FKBA 4JH0A 3MHPA 1RBZA 1PG0A 1XTPA 2X9GA 2Y92A 4JLDA 3T9EA 3UAXA 5K8IA 2HB6A 5I7HA 5KOIA 4XYBA 5COBA 1EK0A 3VYRB 1I7SB 1VLLA 1H2WA 4MA0A 3FPAA 4L2IA 1E1LA 4YO8A 2I3DA 1OBVA 1P5HA 1TVEA 1W85A 2F8TA 4Q05A 1OFIA 1V3UA 1LPAB 2O2SA 4O25A 4RVDA 4JUCA 4PHHA 1P45A 1RLMA 4GL2A 2VPIA 3L4EA 3LKZA 1GUDA 3RS7A 1MOPA 1W0JD 1J4PA 3LBFA 1XQYA 4CL3A 3BD6A 3DWIA 3KFLA 3K4QA 3ZHBA 1FS6A 2ILVA 2VAMA 4QXMA 3VYUB 2IIVA 3K0AA 4LWZA 4HWSA 4TTVA 2J4DA 3FGNA 1FUKA 1SZDA 3DPSA 4TWJA 4AWBA 3BX1A 5B58C 5GADl 4ENPA 4B83A 1ONNA 3BH7A 5JG7A 2FPIB 2WJ3A 4BNZA 4MX8A 1ABFA 1OXKB 1SKBA 3C6KA 3SDZA 1VTKA 2PX5A 1PEDA 2ZI4A 3ED1A 4M3NA 2I8LA 3AFNA 3G5MA 4I1RA 1M66A 1DBIA 3P26A 1V5WA 4QQFA 3SDSA 4TWIA 5TT1A 3TNYA 2ECFA 2DHDA 1L6IA 2R8RA 3ZS9A 4AJ2A 4H3HB 4F6RA 1P3JA 1UOPA 2ZR0A 3QKUA 3HYSA 4I14A 2I7CA 1ZSNA 4RVFA 4F3KA 3M2PA 3NVMB 3H2GA 3RVMA 3SC6A 2XBUA 3H5RA 5MFPA 5FRDA 1NT4A 4K9PA 5M5BA 3GVHA 2I2BA 5IVHA 2JGJA 4GC5A 1KFBB 2AFIB 5JEDA 4LSMA 3DCJA 3EGDB 4G01B 3BKXA 4M37A 1FUIA 1DSSG 2SHKA 4LAFA 2DQKA 1OPXA 1UDCA 1JI3A 1GNPA 1GYRA 2A59A 2C3PA 3PQ5A 2PAFA 3F2IA 4LYAA 4OBWA 3LWZA 3TLBA 3QNMA 2JGRA 2NO7A 4Z51A 4FEAA 3EQ7A 2XIJA 2G4LA 3BJZA 1NVBA 3RHSA 4Z7JA 1XDSA 2J5KA 5K2MA 3TZQA 1BE8A 3FTCA 3ZDEA 3QG5A 3R5JA 3A6PC 3HN6A 3PL5A 3UO8B 4ICIA 1RWNA 1T8UA 2IYOA 4X66B 3L79A 4G85A 2XDWA 1SGWA 3GXOA 5CBPA 1JAZA 1C4OA 2HWUA 1A76A 2OWEA 2O3SA 2WTBA 3QENA 4FP9A 3MN1A 4M4SA 4P08A 4G1FA 5J23A 4TS1A 1TEVA 1ISFA 2RHCA 1W4CA 3M4JA 4PAQA 1NW4A 1ZNXA 1YCDA 2A84A 3DZKA 2ZUWA 2B4AA 1EUDA 5LXTF 1C50A 3GNQA 4GOLD 1FYXA 3DLBA 4OV6B 3PI6A 1NPTO 1UOOA 4BASA 3AJAA 4M8SA 2C07A 3AXTA 2BGRA 1RTKA 2XUOA 3PDWA 1MENA 5EXSA 5K0JA 4CUZA 4YP1A 4RNCA 4MRRA 4XOIA 3THXA 3FX2A 3DDOA 5DSTA 3HCWA 2BGLA 4JNCA 3MWDA 4BKUA 5JBIA 4LRYA 2PANA 1IBCA 4FMBB 2LWIA 1D4OA 4NR0A 5FWDA 4I9HA 2HBZA 1QF9A 4D0GA 4RUKA 3GD5A 1RPZA 3AM4A 3B12A 3KTFA 3KVRA 4IFIA 1Q0HA 2B5OA 1FBTA 2FK7A 4M9UA 4JLWA 1LDYA 2Q8PA 4RWEA 5DT2A 5JQGB 2ZRPA 1LPOA 1H4VB 2W5UA 1UC4B 1R10A 5FOUA 1KERA 2PGIA 4Y9TA 1SHTX 3ZGVA 1P18A 1VKNA 3V4OA 4RAQA 4JHLA 3UMCA 4EGQA 5HJ2A 3CPHA 2QPLA 4TMFA 2QRQA 1Q7BA 1OBOA 3K9LA 4ZI7A 4W9NC 2IYFA 1OF1A 3K3PA 3BULA 1D6NA 2Y05A 2DQ4A 4Z0TA 5DM1A 4ZCRA 2FN4A 2BMFA 1NZDA 2VK1A 2Z2IA 3TD9A 1MJFA 1GZ3A 1E2NA 5E6UB 3IHWA 3QA9A 1WUJS 1BZYA 1MTZA 4GIBA 1JNXX 1NXWA 1P1RA 2E87A 2PS3A 2QL9A 1K6XA 2BZGA 2WWGA 4HDMB 4PSUA 3WIDA 2AL7A 2C57A 2PXCA 4OHVA 3TQSA 3IYLW 1KI2A 3KUXA 4PTZA 1CUGA 1IM8A 3G2JA 5D3MB 1OB2A 2UUOA 1AUQA 4PSDA 4G0ZA 4CL8A 5JIBA 4IXDA 3UOWA 1ZNQO 1E1NA 2BEJA 2Q6OA 4QUEA 4CLOA 4DL9A 1FFWA 2Y0CA 5AOCA 5I47A 2F8SA 4ZMBA 4JD5A 1PEAA 2HK7A 1RXEA 4YQFA 9MHTA 2JNWA 5BSHA 3HYCA 1LTHR 5D51S 1YKFA 5HR5A 2GEFA 4ZYXA 1JZTA 2TECE 3Q7PA 3R6DA 2CHGA 3N7AA 3NQ41 1IIBA 3I72A 2UZ3A 2FK8A 3U3ZA 3VGJA 4X62B 1KRWA 3RYFA 4RTOA 2G67A 2YY7A 1B73A 1P77A 3SJ7A 4A8PA 1GPNA 4F2WA 1FSSA 1M74A 1ONOA 4REQB 3AY7A 1ZEMA 5CW1A 3UXYA 1EFCA 4I5EA 4DC0A 5B58T 1H1TA 4Q66C 1X14A 3JAWB 5H83A 4CTNA 3A6LA 1R4MB 1QNLA 2GF2A 2O7NA 3GZ4A 3KPWA 4QICA 4UUMA 1T8WA 4YN3A 3TLGA 2WD8A 2SKEA 4OEHA 4Y6PA 4X00A 3N2LA 4ZCQA 1NJ2A 1HE5A 1UOQA 3C5WP 5G3YA 2ZS9A 4IEEA 3FVWA 4LF9B 3M1AA 1V5FA 4W8GA 4BLVA 3C3KA 3HVRA 1YFJA 5IJ9B 4NU5A 4EW2A 1EUYA 3WK5A 2HGZA 1J06A 1NXSA 3LUCA 4JBHA 1NBIA 1JR3A 2QZ4A 4H77A 4L3OA 5B2ZA 2OUIA 1XTRA 3WGGA 1UK8A 1EHIA 2CW5A 3LQ4A 1WR8A 4ZTUB 3UBTA 3EG9B 1XHFA 1JQLB 3OE4A 4Y1EA 5AKYA 1PT7A 4B6SA 1ISRA 1X1EA 3KWJA 1JA9A 2C2HA 2DQYA 5DEOA 4XM1A 2Q41A 2I1LA 2YN4A 2YL2A 3L3BA 4HZIA 1RS0A 1TB4A 3MUEA 2NADA 4RIGA 2B4YA 4RVHA 1ZMXA 4YMIA 4TXMA 5HQ3B 4GKJB 3EUWA 2ASEA 2Z2KA 4X7PA 4JL8A 4WV3A 4D4LA 4Z4HA 3KWMA 2FFAA 4ZREA 5GV7A 3H0CA 4NVRA 3V7WA 2BDEA 1DAFA 1B43A 2JGDA 3L0YA 5TF4A 5TPZD 2X1HA 3U6BA 4O1IA 1QB8A 3E9YA 3AEQB 1LBEA 4EX7A 3SLGA 1W87A 3SP1A 3KVNA 1C8BA 3PWTA 3LW7A 3P2JA 1ODFA 2X7HA 2JCSA 2H5EA 1A96A 1I9GA 3WGQA 2FB9A 5EE5B 3WZLA 1W9HA 1A9ZA 2CVQA 2JJYA 4FIZA 3E70C 1NMYA 3LD9A 4FOLA 1I4EB 4UDNA 3PTZA 2HJRA 3SXJA 2JLZA 3UJPA 1LWOA 1ZQ9A 2YJGA 2ZSAA 2H08A 3P8ZA 3T1OA 3UFXB 1ZI6A 4GKKB 2Y1XA 4L0MA 1B7GO 4RPKA 5IDXA 2PMBA 3VVLA 1E3SA 1ZGBA 1GCOA 4L0QA 5TQJA 1Y9EA 1XTUA 1ES9A 4OD0A 4LSGA 4NXNB 3A1SA 5B1YA 4LOJA 5F2OA 5K3SA 1BKYA 3LT2A 1OYOA 1PUIA 4B4DA 4D0SA 3UUWA 2FR8C 2WWIA 5K5EA 4H7KA 4P7GA 3L5KA 4UOZA 2OCXA 1JFSA 4JIVD 3H17A 4LGYA 1FIUA 3GBVA 1GU7A 4U02A 2FPXA 3H1TA 3IS3A 3HXTA 1SXJE 4PG7A 4TMZA 3QKSB 2JI7A 2IZ1A 5JATA 3A7EA 2ISCA 1LQ2A 2NUPA 1VGRA 1OFTA 3CFYA 1PQUA 4K88A 4LPKA 5A5DA 3M5PA 3DT6A 3WMXA 3ZJVA 1AN9A 3ENVA 3FDXA 1HETA 3ZWBA 3KKLA 3L7LA 4PPGA 1J8MF 1Q5PA 1KMCA 4LJ7A 2QTRA 3ZHQA 3DJFA 2JARA 1R5JA 3KDAA 1JKJB 3NUGA 1NMZA 2C9BA 2FE4A 1QOPB 1OAAA 3A9WA 3I6MA 4MAMA 4DLTA 1IONA 4XWAA 2RK3A 4II2A 3FM8A 5ER9A 3RUHA 4PFSA 3AJRA 4JJ6A 3SZGA 5AP9A 4OB6A 1XSEA 3ESRA 1BX3A 4L74A 3TTXA 4MIYA 2HLNA 4QG3A 4BQNA 2HDWA 1CDEA 3JR3A 4DPLA 3VNQA 4FE3A 3L1UA 1NBOA 5H02A 4ZC1A 4KO1S 4BNDB 1GZ7A 2XGMA 3D6AA 3IDZA 9ATCA 5FUYA 3ISTA 4C21A 2YRWA 4P54A 1HTTA 4U8HA 4JYMA 5JCJD 1VG0B 1DQZA 2H4HA 2KQUA 2OOSA 3H2ZA 3QMWA 1L1FA 1WY5A 3U3JA 3B1KA 2JRCA 1P39A 3OX4A 4WLNA 3RRNA 5K1ZA 4HLUA 1QX4A 4IF4A 3D5EA 3C45A 4IO1A 3WYDA 1U3GA 1NQUA 4MRNA 1D3AA 2NU6B 2ZJFA 4IWXA 1I6MA 4PZYA 5JW6A 3TQTA 4ZVUA 4XFKA 3RYHA 4PSVA 4G3XA 1Q6ZA 3VO9A 4DNQA 5BORA 2QLMA 3SVTA 1MOSA 3R6LA 1QR2A 2BYTA 4Z4FA 2D4AA 1LQTA 2QN7A 1MT3A 4M0UA 2BJHA 3SEFA 4DMFA 3IV7A 1GKIA 2YVKA 4D42A 1RTTA 2QDKA 1FE8A 5BUZA 4PHCA 1TXGA 3MMZA 4MROA 4UBIA 2LKCA 4L75A 1GZVA 1R7RA 1TKRA 3IUEA 3IAXA 4LECA 5DN9A 2Q5LA 4LHSA 2J33A 2QP9X 5TMPA 1CUXA 4LJRA 4BECA 1ZD4A 1RFLA 1M9NA 4W9RA 2HDOA 1ZHHA 3AQIA 2HYDA 2OXIA 2WYOA 4HWOA 1F51E 2KE5A 4JJKA 1F6WA 2RSLA 521PA 5K0EA 4J3FA 1R5OA 4BVKA 2RAPA 5L3SB 3TQHA 4DIDA 2W83A 2X76A 3GUYA 3L41A 3QYFA 5ILOA 2JRLA 2X4LA 1Z56C 1N0VC 3IUMA 4QVKA 4DCJA 2NSLA 1GN8A 4R6XA 5K03A 4H6XA 4KPEC 4HRYA 4ZAVA 1BFUA 3BFPA 1SU7A 1BMFA 3NGXA 2VUTA 3FCXA 1NR5A 2EVWX 4A4YA 4O2RA 4YRTA 4KQ2A 2IRWA 3GJ8A 2JAPA 4RZXA 5EXTA 1RKXA 4ZVOA 2OLEA 1QCCA 3HBLA 5DXFA 3C1TA 4HDKB 1I4LD 1KKLA 1EGHA 4R2KA 3WA6A 2Z5GA 5C8YB 4H7DA 5IF3A 3KKOA 1RQ7A 1DOHA 4M0FA 2ZSBA 5JZOA 3JD0A 2C61A 1JMVA 5LU9A 2AR9A 4LXXA 1P4JA 3TMYA 3FM9A 1E1YA 3LVQE 4UNIA 2ETXA 3X2FA 2NYVA 2DWOA 3VA4A 2ZGVA 5HKKD 3GHYA 3FROA 3R9XA 3P9CA 3ELUA 3PUHA 2RHLA 2O8VA 3EA5A 1ZH2A 4LYJA 2ZRKA 3WLMA 3ZE7A 2RGNA 3D0QA 3PC3A 1HFWA 4Q0MA 3ASVA 4EMSA 3ZNNA 3G8AA 3AJEA 5B53A 4QO8A 4D0RA 3SLRA 2CZCA 2WU8A 4TV9F 1U0GA 4BB5A 2QROA 4IOKA 1JU4A 3RQSA 4BRUA 1A9TA 5IABA 1UBEA 5I6DA 4F5YA 1AN0A 1B0ZA 4TWAA 1W36B 1O6BA 3IPYA 3EZLA 3H65A 1DBWA 3HKDB 4N6OA 4UUBA 3R9IA 2LW7A 2WJ6A 4RENA 1SEVA 1Z7YA 3OWHA 4B45A 3ESQA 4QYTA 2EWMA 2Q62A 4F4UA 2Q4RA 4IVRA 3RNLA 2WPNA 3EUEA 1BCRA 2Q21A 2HXSA 4GNRA 5DYNA 4DIEA 5IANA 4ZCSA 3SBDA 2VHWA 3E1SA 5JD6A 1OROA 4PC7A 4Z3OA 1VP9A 2GXUA 1DEOA 3C1UA 3RBAA 4E5SA 2QT1A 2IP2A 2CDRA 4W1SA 2XCOA 1FL9A 2OA0A 3RLIA 5F2NA 2W8BA 3GLGB 4EEXA 4EI7A 2DTXA 3EZFA 5DJ5A 1W5TA 3FLEA 1OPRA 2L19A 1X2EA 4G4IA 4W99A 4CT5A 3FE2A 1MABA 1PBNA 3K2EA 4CLRA 4DNFA 1NNUA 5IXJA 3GCZA 1U1DA 4NPHA 1AXRA 2BCGY 2I7TA 3FGPA 3ZWDA 4WIAA 1BN6A 1V41E 4QATA 5FOSA 1HF3A 4MUXA 1F8FA 4MWZA 2PMDA 1ADGA 2DKOA 1G6OA 3UH0A 4KNYA 1Z2PX 4I19A 5IVKA 1M6VB 2HA7A 2UUCB 4HS9A 1WW3A 1G66A 1SIWA 2ZBUA 3C3EA 4DBLE 5KOJB 4ADSG 2Z56A 3M89A 5E9JA 5L3QB 1IBKB 2PKXA 1YZKA 2P6MA 1QOZA 3CCBA 2CE7A 1KY3A 5KCMA 3BH0A 5JT1A 5KYYA 1LH0A 2GH1A 2H8KA 3ZHZA 1KI9A 4ZYTA 2Q50A 5KJ1A 4CMBA 3AFIA 3DZ8A 1YDEA 3BRSA 3E2MA 2Z5LA 4RPHA 2OVBA 5B5SA 1YU6A 1D4AA 1YHNA 3C97A 3WRVA 2AZDA 1XAIA 1NF9A 4RELA 1XF9A 2P77A 3AHCA 3USES 4B79A 5BR8B 1TAQA 2ZIAA 2J9GA 3N75A 1BCSB 4PICA 4CV3A 1RIIA 3IGFA 3EXG2 4YALA 3NHRA 3HJFA 1YZUA 2ST1A 4MAFA 3JQ7A 5FTNA 5H4HA 4W1QA 4C0XA 4DV6B 1C9KA 1QS0B 3I9MA 4E21A 4D0LB 4N41A 4X1YA 3RAEC 1HK7A 2CHVA 2F64A 2Y68A 5L8VA 3W2HA 1VCIA 3HYTA 5K0NA 3ZI0A 2Z2XA 4X1OA 2FGJA 3W7AA 3EEFA 4AP5A 1Y8RB 2RJ3A 3QPVA 2ZRLA 3GRKA 4RXTA 2RG7A 4HTFA 2IHKA 2RHTA 2RK6A 3F9CA 3QUCA 4KWEA 1A4IA 5DCLA 3WK8A 3A9VA 4ONEA 4CMIA 4B76A 4DNXA 5KWJA 4B8WA 4I6GA 1ZJ4A 4MR9A 2ZREA 2BP7B 3ILSA 4O2BA 1NI4A 5J59A 1WXEA 2X3YA 2WHPB 4TLDA 1G5RA 1EG2A 4FW9A 4K1LA 5K51A 2GTPA 3H5NA 3ADBA 3GX1A 1TF5A 4JZKA 2I6GA 2OYCA 3ZVMA 2HEIA 4L2IB 3RVRA 2RCNA 5EZSA 2FQXA 3RTCA 4C4YA 5DYWA 1OZHA 3KS9A 4E09A 1GCUA 5B6IA 3PD7A 1P5JA 3EWSA 3TVDA 4BIMA 1FLVA 3H9JA 2EF1A 3MMSA 1JA0A 1Y4DE 1ZIYA 1U8CB 1QPGA 1S8FA 3OZVA 8ABPA 2A9PA 3KEGA 1GAEO 3CW2A 4PYOA 1R18A 3WNCA 2IDKA 3AR4A 5B3KA 3ZDYB 1ECCA 1IVSA 3QV2A 2DPYA 2B3DA 1QRAA 3LT0A 5AVXA 3Q9SA 4WPGA 3TW8B 4Q3CA 2QNRA 3UICA 3PUKA 2V98A 3W6PA 2OV6A 1ZH0A 2D5AA 1V45E 3WP0A 3I6IA 5EEGA 1V1MB 4P31A 4IQ0A 5IAEA 5FORA 1QQAA 3QBVA 2P6UA 2IZ5A 3LVFO 2F43B 3MTJA 4R0VA 4HSGA 3AY3A 4I50B 4EA9A 3N3AC 3UB3A 4ENVA 1VLMA 1EM8B 4KQHA 2HPVA 4XR4A 2I78A 5LMUB 4RIHA 3GP3A 4WY8A 3CQ9A 3KYIB 1ULZA 3UUGA 2FF7A 1IMOA 1MHPA 3GIDA 1DPGA 1N8TA 3SIRA 1PSDA 3UB4A 4UNRA 5AVTA 3JVUA 1YVUA 3A32A 1PNQA 4V3CA 4EG0A 2W6PA 2CV2A 1L4YA 3ODPA 4ESEA 1NULA 1ETHA 2AT1A 4J6FA 4YHBA 5CA1F 2D54A 2NG1A 2WPDA 2R4UA 3A9SA 5ITZB 4DV4B 3WXBA 4TM8A 2D74A 4MRMB 4RYDA 4V0ME 4YONB 4YRAA 4DLZA 2WABA 2GA9A 5BQ3A 4WSOA 5A1JA 3MCUA 4XUDA 4G09A 1CQPA 2YVUA 4QXPA 1ESNA 1R50A 1IZ8A 1G8YA 1T6BY 3EGOA 4LXHA 4H3VA 3V1UA 3MLBA 4RTJA 4WXPA 1COZA 4Z3KA 1ZCFA 2VYCA 2X5JO 1I51A 2XWJI 3EBOA 5A4DA 3UT5B 3NHKA 3B7GA 5CRIA 3T5PA 1MH9A 3H1FA 1SJ9A 2GZSA 3HR7A 3B6EA 2FWPA 3BWMA 3OMWA 1U9CA 1XTJA 1YHYA 1AKTA 1HY3A 4CE6A 5GJWC 4ZQEA 3C3DA 3HDYA 1OOEA 2CSWA 1GRNA 1DFIA 1Y34E 3AGPA 1HV8A 1HLFA 2CXPA 2CUKA 2J4FA 1A2OA 4G5GA 5HK8A 4NFYA 2HW8A 1W88A 4HWGA 5ADWA 4JT4A 3JQAA 2G7MC 3F3MA 2BMWA 2HMVA 4QRHA 2AKAB 1U0OC 4UFOA 3HDGA 4PLHA 1OLXA 3ODGA 2G08A 4ABYA 1CS4C 3CBGA 1J09A 4CPDA 5KBYA 4WNIA 3QYAA 4RJ2A 5FI0B 4N03A 4GPTA 2D59A 2ZUDA 4D57A 1H3FA 3TRFA 4YK7A 2GK7A 2MTBA 1R64A 3L1KA 3N0TA 4Q9NA 4X95A 1K7EB 5J5VA 3W8RA 1NJ8A 3WL4A 1AKNA 4W5NA 4YGXB 2YHUA 4IMJB 4DARA 3PB3A 3LAWA 3QU9A 1ZO8A 1FQWA 3K8ZA 2PSDA 3HK2A 1C29B 1PR6A 4EJMA 2WPDD 2D5LA 4JB3A 4DMHA 4BE7B 1B14A 2YN2A 3SX2A 4DR2B 4AG3A 1Y4ZA 4MDEA 2ID8A 3ECAA 3D43A 4Z99A 4Z3DA 5DISB 4E2WA 2ZAIA 4OLFA 5F7JA 1RRVA 3QY9A 2UYGA 1LBSA 2W00A 2I4NA 1X94A 2H0AA 2HWKA 3GNTA 1IU9A 5E6RB 2PLNA 4IHQA 2K2QB 2FMKA 2XB6A 3CEAA 4RF2A 1P29A 1IK6A 1C2TA 1FJXA 4DUPA 3MQ2A 2O6LA 2F62A 3B7PA 3QIVA 4G2NA 1T1JA 4DY6A 2OYRA 1GPBA 4ODIA 5FD8A 4GM4A 3U4AA 2ZI5A 1G42A 1Z6XA 4EECA 4BO7A 4NOJA 5EJEA 1C3JA 1E32A 3QI7A 1R0XA 4D6PA 2QZZA 3LHKA 2B1RA 3W7VA 1ZXLA 2WUFA 2PH1A 3ND9A 4WGFA 1M0EA 2WT9A 1QLJA 4ALMA 2BVNA 3QWHA 1OI2A 3SQLA 2DPMA 4TXNA 2X8JB 4ZPXA 3FNGA 3WZMA 3L8EA 5EERA 4KXXA 2I6XA 3HA7A 3GDFA 1L0BA 3IX7A 3QJGA 2QTFA 3L8HA 2HF2A 2HMUA 1Y3DE 1IN7A 2OCYC 2FP4A 2OG1A 2VJCA 2H5JA 2BR4A 4J76A 4X3OA 4AZSA 4BC0A 4UM9D 3OQNA 4QODA 2PZJA 3OIVA 3N2KB 4GBGA 5I7FA 3GPBA 3I30X 4JX8A 5C8XA 3R7LA 1KP2A 4E94A 2FFHA 5AW3A 2IEIA 4XTRA 4EQ6B 1OE0A 4IW3B 2IP4A 2PZLA 3BERA 4UXJA 5HIKA 3RJZA 2XMQA 1PJRA 4QA9A 1NN3A 4RDIA 5JI2E 3MGCA 4I66A 4OLHA 3EWAA 2ZYIA 2ZRJA 3W5BA 4M87A 4M99A 4QT0A 3JQRA 3CUTA 1N4DA 5F1OA 5JANA 1LNZA 1O94D 3ND5A 1E60A 1T3LA 4OHRA 3X1DA 3BXZA 2CK3A 5IC4A 3CB2A 4AJ4A 4HAIA 2J5RA 2PR7A 3ABQB 3T3DA 2GK4A 4MMZB 2XE4A 2Z9BA 2FPSA 3KJEA 1C1YA 1R5NA 3ZG6A 1E62A 2BDTA 1WP4A 4LTNA 3ZK9A 3RJMA 4A82A 1E20A 1UBUS 2L42A 4B71A 3JATB 2IY9A 2JFHA 3FIUA 4FEEA 5B3JA 5BVHB 3EPRA 1L9KA 1ZD1A 1L5VA 1GZSA 3WXMA 1M2NA 3FVTA 3PPXA 1SXJD 1H5NA 2O0HA 3RB8A 2O1EA 1IY1A 1E2MA 4MW7A 1XKTA 3C16C 1I2DA 3M5DA 5ECYA 3PEUA 3PPWA 4G2SA 4J1TC 3WDMA 1U1EA 1L7VC 1ZL0A 2QN3A 1GYQA 2C4KA 1A9OA 2VF4X 3HJAA 4K6KA 4X90A 3WS7A 5B2FA 2AJCA 1FDSA 2OO7A 4QCJA 5CFOA 5AK5A 2WEKA 2ID9A 4B0OA 5C1OA 3DFKA 2ZPUA 4PFJA 4JYPA 1C7FA 3NDPA 1DMSA 3TAXA 1Y33E 1J4KA 3MTAA 1DXYA 4GMDA 1OIVA 1UJ5A 3IUQA 1VJ1A 2JJMA 3IP9A 5FWNA 4DDWA 3BMNA 5DN6D 4TSRA 4OHYA 1MIHA 1FY2A 1EVJA 2WP0A 2X1VA 1G60A 2Z95A 3A3NA 4Y0VA 2OFPA 2WAAA 4R3UC 3F2VA 3DE6X 5T5QA 2YXEA 3LPLA 4IZOA 1IXKA 1MX3A 4P33A 4C5AA 3DC7A 4GP6A 5C18A 3GCWA 1OKKD 1L5NA 2AJTA 1KHUA 2B2CA 2QX6A 3D0RA 4DF3A 3TGPA 2YOHA 1YU9A 4DIOA 3RG8A 5C8YF 1FCJA 3IBTA 2O8DB 2FF5A 1K8RA 2L69A 4YP0A 4H4DA 1QTNA 4C6TB 2G71A 4OQXA 5DWVA 4URFA 1M72A 3BWXA 2FCAA 3A6JA 4RPJA 4HJRA 4KVAA 1J07A 3B20A 5H81A 2OLKA 3NHAA 1Z0UA 4WKNA 2C5EA 2ENWA 1E5DA 1W5FA 2WVHA 3CGGA 1M2WA 5DLDA 1L4LA 4L07A 3OF2A 4FSDA 4RK5A 5JAPA 3SSNA 3H8JA 3FCSB 3GJ7A 4FMCB 3FHTA 3I05A 3SMVA 1Q0SA 1TYBE 4MGHA 1SQSA 3QXGA 4M0CA 3IVAA 1W7AA 4CF4A 5KTMA 1LKZA 4IS3A 4ZZ2A 3H1PA 2EWVA 2OO5A 3OT1A 2HR1A 4R2WA 5IHPA 2K7ZA 5FUVA 2N1MA 3B52X 2ZSDA 2X58A 4LC0A 1K4KA 1NVDA 1XMSA 4K1XA 3LPAA 1KYTA 1FXUA 3FPEA 3P4YA 3CNOA 3JQ8A 1QGAA 2GQ0A 3LP6A 3STHA 2O7RA 4XPIB 3A6KA 1M5TA 2OHIA 4LDJA 3PGXA 5EJ2A 4ZI7F 5J43A 1GUBA 1TJNA 2PLAA 1O89A 1S2NA 2AOUB 1N6PA 1Z4JA 4FTWA 4I4TB 2J31A 3Q5DA 2XT6A 4FINA 4FK8A 3NBXX 4WN9A 3UJ3X 3DBHA 3T7SA 1AUPA 2BUAA 5ADUS 4MTLA 2FSIA 1USVA 1F8UA 4PSKA 5AUNB 4QU5A 2OBNA 4HFNA 5CAEA 3RVNA 1VECA 4QDJA 4LKRA 3PEWA 4TQ9A 2W43A 2RE8A 2C1ZA 1Z29A 1U0LA 5FBQB 3MILA 3TPFA 3PX3A 2J32A 1EVEA 4LRXA 4F4JA 4IQ8A 3L4KA 2A3RA 5ARBA 2HIAA 5JMOA 5LP6C 1NOJA 3EUAA 1IUPA 1Y7LA 1R66A 3CE6A 2C98A 3M6AA 2ZVJA 4MW2A 3LHSA 4HMQA 4TKUA 1ZNYA 1AS0A 3FMVA 5LM3A 3NONA 2GN8A 1J1ZA 1MQSA 3DOEA 2VJOA 4MR9B 4Q1CA 5DXJA 3PHIA 4YP7A 1LDEA 1NU8A 1PS8A 2J1LA 2R8PA 2ZFUA 4WUVA 5LA6F 3TKYA 1YUBA 4ZQFA 3NG1A 5JO0A 3OLWA 3QJYA 3FG9A 2Q3MA 3BIWA 1ZZGA 2Q5IA 3GGOA 3N70A 4RY0A 5BW5A 1IXZA 1RPAA 5DGIA 4WOJA 3QX3A 1EFDN 2TRSB 4NP6A 2B1JA 1E6CA 3ENZA 2P9YA 1PNOA 4LDRA 3T1QA 3JWJA 2JLUA 1DRVA 3A36A 3N86A 2ZWAA 3UYKA 4K6CA 4FJ0A 4REOA 2GEKA 2W0MA 2I99A 2Q3FA 4EELA 2HYIC 1VKHA 2ZT6A 5K9ZA 1UT5A 1HO3A 3HO1A 5DSZA 5IKXA 5DH9A 3NYRA 3EMKA 4ZXPA 1HQCA 1Z28A 5ALUA 1YA8A 1R9MA 1GCIA 2NSYA 3NM5A 4FYXA 1E94E 2GS9A 2IXFA 2NVOA 2OFWA 4CZ2A 4LQ4A 5KKNB 3HNPA 4TV8B 3OAAD 3UAGA 2CMHA 1IHUA 3Q15C 1SQ5A 3H5WA 4ZA2A 1R0ZA 721PA 2FVYA 5ISMA 1BMDA 4X94A 2YWRA 4K81B 4II7A 3GA7A 3HM2A 1GG8A 3AI2A 4C6TA 4GR4A 3MCZA 3UJ9A 2XMRA 3UF0A 3K9CA 1C7EA 1Z4PX 4OHWA 1WF3A 4E4TA 1QORA 2GPNA 4ILEA 1YCHA 3JWGA 1EXMA 2HCBA 1JHRA 3P0IA 2D0OB 2YS7A 4TXJA 3UA3A 5A4MS 1FDTA 2APJA 1LRJA 4MYUA 4PGFA 3AESB 1Q74A 5JSFA 5C35A 2O8FB 5D1HA 4JCCA 3KQOA 4CIDA 3GFQA 4KVZA 4EI8A 4ERXA 2IKQA 4RZQA 3MT8A 4R16A 4E2XA 4GMXA 5EZYB 3UZUA 4ZVMA 2W90A 4E1BA 1ZOPA 1XJCA 3FR8A 4XUEA 5A3VA 4JLOA 1TCAA 2CKMA 5U9CA 1CS0B 2E82A 3WB2A 4GXNA 2R00C 4Q9KA 1J39A 3PZRA 3VZQA 4NMHA 1YKGA 3HG7A 4DLPA 4DJ5X 2I8CA 4IXTA 5HKOA 4LFBB 4L8YA 3AG5A 1EA5A 2YASA 2YZKA 5ES4B 3U0VA 3D0OA 3P0HA 1L5HB 3I1FA 1NJGA 3LKDA 3S2ZA 3HKDA 4L7QA 3IPAA 5CDYA 4OGFA 4AF8A 4I1PA 1T0PA 3ANTA 4DANA 5SZJA 1FYFA 3KZNA 3KQVA 4AY2A 1H2BA 3B7WA 2VJQA 3R4CA 4F6LA 3BXXA 2WJWA 4ARIA 5EIXA 4BJHB 1FX0B 1YJ5C 4IH4A 4LY3A 4RQUA 1YR9A 2GYUA 4QYMA 3FBTA 2J6HA 1PR2A 4JDPA 5FR2A 4MEAA 3OPVA 1PGPA 2MR6A 4KDCA 2Q7DA 1E4VA 1U7HA 2OKCA 3S44A 3PHJA 3K6KA 4QZVA 2C0QA 1BA3A 1PJSA 3H3FA 3G5UA 5DE3A 3GYGA 1ZR2A 3HUUA 1E79D 1G98A 4J03A 3ZDZB 5I5EA 2H1HA 2CK3D 3RRZA 3AH8A 2A94A 3VR2A 3RS0A 3PDIB 2FSVC 2KS6A 3D6TB 1HSZA 3WLJA 1M76A 1CIPA 4MAAA 1RKQA 3U7QB 3DDSA 4BO3A 4LA4A 3B2NA 3BDAA 4G81A 1HOXA 1PTJC 4I1OA 4YMUA 3STYA 3JQ9A 1TUBA 3H97A 1EDDA 2Q6IA 3QTBA 1VKJA 4JLJA 4ZOLA 1CQWA 1XA0A 1ZVQA 1MO6A 1W1IA 3C7CB 3MWDB 1A8IA 3CJRA 3II6X 3KYDA 2BWJA 4MUFA 5EESA 5CB0A 3QEAZ 1EXDA 1XN4A 1QGUA 2JH8A 3RWOA 1ZMOA 2FP4B 2J3KA 5JZVA 5KS2A 2CXRA 3T35A 3IJEB 2OCLA 4FFBB 1WXFA 3FCAA 5DMHA 4P0QB 5EQJB 2UXBB 2AJ8A 3WK7A 2ZKLA 3BKWA 1II8A 3KFVA 4E5YA 2PXXA 2HK9A 2VDOB 3PYLA 4J0EA 4ZC8A 3ND8A 3UJ8A 4P7FA 5CVEA 1EVIA 2XWSA 2Q4OA 4US1R 3BXGA 3MS7A 5ITSA 4LCJA 3K1AB 4Q9LA 3W77A 2IPMA 1YS4A 4YRMA 1RBYA 2YCLA 1RPNA 4Y9UA 3GLGE 1EK2A 4HQFA 1FFEA 4S35A 1V8OA 4Z8XA 4QKQA 1WSAA 4G5XA 3ZKWA 2QBYA 1GL9B 3IQFA 4OMUA 2BFWA 3C6QA 4OQ4A 3U31A 4EG8A 5J47A 2VDVE 2ZRCA 3D4IA 3V46A 2ZJ8A 1F2TA 3K6RA 3WLQA 2AC2A 3I92A 1IZ7A 5BR4A 4BLQA 2P6NA 4R4JA 1DIOB 1W47A 3LTEA 4LRTB 1KDYA 3OEYA 3RYHB 1BN7A 3B2EA 2ZOSA 3ZDQA 2ZWVA 3BA1A 3B1XA 4JKIA 4QUHA 1YFKA 4JROA 4X8OA 3FUUA 1N2CE 5F4BA 4BN4A 5EPUA 4COOA 4PRLA 3PDUA 3PXDA 3UMZA 5CIQA 2JF0A 5E6SA 5GQSA 5EGSA 4AAYA 1RJEA 2V74B 1TYDE 3ML1A 1GAXA 4ALJA 1DAKA 4J4TA 4UARA 2I2FA 5C51B 4M1WA 4CCYB 1A9XB 1IHXA 2IZ0A 4FQ7A 4HWPA 2AOUA 4UXIA 4D9BA 1ESZA 2J67A 3DONA 3DW1X 4FLMA 4RETA 1K3QA 1J25A 1FFSA 3C8MA 4IJKA 1ANKA 1SCJA 1ZWKA 3CLTD 4PHTA 4HV4A 3D6MA 4PLPA 2VRCD 4ZDWA 4ZANA 1WXXA 1RJ9A 4MYDA 4UDYX 3G0BA 4RGYA 5CGZA 5TVKA 5JNSA 5KNBH 5AXCA 1Y81A 9ABPA 2VF7A 4K26A 1ZXBA 3SYMA 2BFEA 4BBZA 4CDNA 4WXEA 1Q83A 4O2AB 2GJSA 3HDHA 4B3XA 4PYRA 3VDQA 1MV5A 2WAMA 3GOHA 3F6BX 5C34B 3KR1A 1FX0A 3ORFA 1R6BX 3F7OA 1MVLA 1VZ2A 2HCRA 3EA0A 4JUBA 4RHXA 3UMJA 2HO4A 1ENZA 4ZT3A 2K87A 3G9XA 4LDPA 4WI1A 2HRZA 3ZBTA 2FZ5A 4KR7A 3NIBA 1IH8A 4QLOA 4M53A 3SWWA 3E2IA 1V6SA 3EVGA 4YDHB 4POAA 5G53C 2NVUA 3V2UA 4BP3A 3LTNC 4BXOB 3UMBA 1OMOA 2V0NA 5CB8A 2HJ9A 5DBFA 3ZVLA 2AE2A 2JHGA 4ZAGA 2B4QA 4BZPA 3VZCA 2ZATA 1B4DA 4E3ZA 1Y1KE 2HSEA 4BYGA 3IALA 1RXWA 4MGIR 1AKVA 1P81A 4A8JA 3R09A 4ZHQA 5TR9A 1JE0A 4DM3A 4DFDA 1BROA 2GFHA 2IDJA 5FHRA 1Z45A 3DFFA 1BHQ1 3P4UA 4JI2B 5AOAA 5BYKA 2FETA 5KTSA 13PKA 4YT2A 4Q4AB 4D8XA 1SKAA 3HDVA 3VDNB 2FDCA 1MDBA 1NFQA 4EHKA 5JALA 1E5QA 4PTLA 4C87A 1G55A 1RWMA 3KEMA 5DXAA 5FB3A 8MHTA 1WHSB 3FTQA 3JRWA 5EXEA 2NV2B 1NE2A 1BE1A 5TMBA 1GVHA 2JJ2A 4PRYA 4EYQA 4EO7A 4OHPA 4YJDA 2B92A 2QRKA 4Q1EA 4D41A 2C1XA 5TGTA 3OA0A 4ABTA 2KWIA 1TO1E 1EGMB 2ZETA 3AHEA 2Q6VA 1W2HA 4HSEA 4HVTA 3W05A 1G5TA 4EY4A 1KZ1A 2J59A 4N40A 2PO7A 2X5NA 2VQ6A 3CVWA 3F78A 5M2QA 3OP4A 3OHSX 2H5LA 3UJAA 3EOBI 1J2YA 2FHSA 1GA1A 5ULLA 1XK6A 2A0UA 4HGRA 5LSAA 5IU6A 4EVIA 4K2HA 1ZHFA 4LBYA 4BMYA 2PUFA 1WMEA 2YJNA 4L8VA 3TL6A 2ECKA 3A31A 4D8WA 1NJSA 1D09A 3QIAA 3LJKA 1SVKA 2RG1A 3NHYA 3F0TA 1LBIA 3NXKA 1L5RA 3D54D 3R3HA 4QHSA 4AK9A 3N59A 1QTIA 1O5IA 1EB8A 1GQYA 3VVCA 5JUWA 3S5JA 1Q22A 3NBMA 3P27A 5JZ9A 4DV3B 4EFDA 1K6MA 3S6JA 1ADYA 1G21E 2FG7C 2I55A 1K7SN 2FN3A 2ZTSA 4FQ8A 3ANMA 3MM4A 1EDZA 4ZGWA 4Q1BA 4BNIA 3KX2A 1XZDA 4HQLA 4J0QA 2QJWA 2CCKA 4YCCA 1EVYA 1AG9A 4JI4B 1UHTA 3T52A 5CX4A 2HLHA 4JOCA 2Q2WA 1NJFA 1X42A 3EGEA 3HPQA 2CKDA 4RCVA 4Z9XA 4CMIB 4OX9Y 3RS2A 5CB4A 4KGZA 4IGFA 3KXIA 3OIYA 5J58A 1FQOA 1ZHOA 4X24A 2NQTA 5A62A 2DU8A 4LDAA 4YJ2F 2N3ZA 3OEEA 4RZHA 4JP1A 4Q4JA 5FT9A 2GDJA 2ILTA 3GMTA 4LY0A 2G28A 4LMBA 2HUPA 3C85A 4IUYA 1J56A 1U2DC 4G89A 4C2BA 5EMJA 1UPTA 3Q3GE 4URVR 3F6YA 4FGSA 1G4HA 4FDUA 1V8PA 3BBPA 3LS2A 3THYB 1XG5A 1Y42X 3TOCA 1GNRA 1E66A 2ZRFA 1VE1A 2GAJA 4Q37A 3E82A 1IN1A 2QT9A 4J0FA 2XE8A 3KLMX 3EGWA 5KQPA 4UVIA 3WK6A 1R88A 4MPRA 2VYVD 5MGBA 1VCMA 2XNHA 4ZQGA 3LWNA 5JAIA 4IIJB 4DSNA 1ZR4A 1FMJA 1P5FA 2O14A 4C2AA 1FDIA 1EEHA 4MVYA 2BM9A 4H15A 5DHTA 1EVQA 4LJYA 3RLFA 3T9AA 4UD6A 4EFNA 4WJLA 3PWZA 3IKTA 1JMKC 3Q88A 3ZHYA 3BMCA 1ZC4A 2C2ZA 2GM3A 3AX6A 3DP9A 1Q0UA 1NY5A 4OVKA 4K9SA 4B09A 4FT2A 5ALZA 3SYLA 1X2BA 4OL9A 4Z5XA 3GLUA 5LU8A 3P0RA 4RPGA 2BFCA 2KM1A 3PXUA 1OXXK 4AJEA 3ZGOA 1KY4A 4CLRB 3EE6A 3HYRA 3H3XA 6NULA 5DNVA 4RTKA 2AYYA 1XZAA 3GQSA 2A9OA 5AHKA 4ZYUA 2GOYA 1O94C 1Y1QA 2BBSA 2IHBA 5FBLB 2PVPA 3TAHA 4HX2A 3TZ6A 4M46A 5EHGA 1GDTA 1I3KA 4IGIA 1QP4A 4LJAA 4MWTA 3Q7EA 1JDBC 2J8ZA 4M49A 4NI5A 1RJFA 2GPYA 2M6SA 4TYQA 3C5VA 4S24A 1J33A 1CE8A 1H85A 4JXJA 3RBZA 4BLOA 3IESA 5IULC 3AP3A 5JCZA 4IG4A 4N8EA 2ORYA 4ZFNA 4FDLA 1VE5A 3NIWA 1KI1A 1WLYA 3T7DA 4DA8A 1T9GR 4DILA 3HDTA 3NI2A 4I9FA 5CT8A 3UAOA 2EJCA 4EYKA 2O8DA 1QHNA 1YIDA 3QOWA 3QXSA 5GZ3A 2VHJA 3W3AA 4OSPA 1TQDA 1CQJA 3CISA 4TUYA 3FUWA 1Z4KA 4U5XA 4AN1A 3OOEA 1V7QA 4OJMX 3GK3A 4DLWA 1F0NA 4C08A 1C0IA 3E9MA 4I46A 4LRUA 4QARA 2A1IA 4XDYA 5CW2A 3NAZA 4TSFD 1L5FA 4ENRA 3LDFA 5EUCA 5L9AA 3GQVA 4KZKA 4AIRA 1NR1A 3B51X 3MOIA 4I81A 4ZYWA 1KZ4A 5H8WA 1Y5MA 3AUTA 3K0CC 4E31A 1FYVA 4KQWA 4RESA 4FGUA 2OSVA 2NXWA 4UTXA 1CDDA 4URYR 1DMRA 2CLLB 2Q1XA 1DT5A 1RPJA 3A2NA 4MR8A 1GGNA 3WOVA 4MWDA 1AB6A 5DT9A 3ZTWA 2V5AA 4M1SA 2QVBA 4H7FA 1R4NB 4KE9A 3WADA 4PG8A 1FFXB 5C5IA 1AV6A 1REQA 2YV1A 1GZ6A 3IDFA 3ON5A 3VXKA 5FDFA 2W6JD 3FNIA 2LGJA 4OKSA 2JIZA 1NKSA 5ECGC 4Z1MD 1U8TA 5I7AA 5ICEA 1TTTA 1NP6A 2COKA 1OWNA 1ENPA 1P9OA 2WNHA 2H92A 1K0FA 3DR3A 2XOXA 1UXKA 4J2TA 3ETHA 1UT6A 5AVOA 1GP2A 4QUBA 5KYWB 5EIEA 2FEOA 3HKCB 3LUAA 4H3KB 5GP1A 3ND7A 4R8RA 1GFSA 2JZOA 3LXMA 4WBNB 4G97A 3FW1A 5DX0A 4A1FA 3N2YA 1OYWA 2HA4A 4M8KA 4NCXA 1T29A 3QOYA 2IZZA 1ZZEA 4BMCA 2R96A 1YK1A 4KXUA 3G23A 7MDHA 3HO8A 5I9BA 1T3TA 1JTVA 2VBIA 4X93A 2ISSD 5F9MA 3CVXA 3AW9A 2QW8A 3BMQB 3I2KA 3CZRA 3F9RA 3CX3A 4GKBA 4W5JA 3C39A 3A2KA 2NLOA 3E23A 3MWGA 4OIFA 2AKYA 1ACMA 2XMBA 3PFIA 5IAOA 3AVUA 4OQEA 5IDYA 4BYMA 2EBWA 1Q50A 3QVXA 2R5NA 3ROZA 3PNKA 1CUDA 3N07A 3CMCO 2IYQA 5IBPA 4KBFA 1GEGA 1XXHA 1OYYA 3UAZA 3PYMA 3COPA 1VSTA 4KVGA 1VLZA 1KFJB 4WHMA 1M0WA 1B0PA 1RIFA 4PGMA 4M1TA 5EJ8A 4LQCA 4B3IA 2OGWA 4MVWA 5DRTA 2E4WA 3H2IA 2VNAA 5CFRA 1Q3TA 3QE2A 5KJ6A 2XQGA 2XLCA 4BVBA 1NAIA 3I28A 3A28A 4HDOB 1JAXA 4LI3X 4JLKA 3UWOA 4QM7A 2B34A 3SXPA 2JIPA 4M89A 3UG6A 4DRZA 3NV7A 5CNMA 2FV8A 4K28A 1P1FA 3HI4A 4RSMA 4Z4EA 1AH2A 2HLPA 3FKJA 2J7KA 2ICAA 2G09A 1OV6A 3GD7A 5AHRA 1XA3A 2WFMA 1A7KA 2PUAA 3GFSA 1PGOA 4FHZA 2VNKA 3Q5EA 4IQFA 1BRMA 2Q3HA 1CJUC 4V0NA 4BFYA 3U4DA 3CEPB 3C43A 1PF7E 5D7BA 1XZPA 5HUJA 5F2EA 4F2DA 1UBOS 3QXJA 5E1BA 3HKBB 2VG8A 2G9ZA 1PJZA 1CY2A 3O1IC 5CA1A 4N01A 1QMPA 2C7BA 3ZE2B 2D0PB 5C1BA 3U56A 4XIJA 5EP1A 1LDNA 5LLDA 1NIJA 4XIGS 2RKWA 1O97C 1W5AA 4W5WA 5T8KC 5JSZA 3R3JA 2C95A 1ZXXA 1I6WA 3SE0A 1V3TA 1XWFA 1E3WB 1JKMA 1SKYE 2OV1A 2PLRA 5EINA 2WTMA 4L57A 5CD9A 1J90A 4X64B 3Q3HA 1ZM2A 1GADO 5C8ZA 1HR0B 7MHTA 2GZDA 4MYCA 4TRJA 3HCDA 4MVCA 3MZ0A 1O8CA