2I2BA

Crystal structure of lmnadk1 from listeria monocytogenes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 69
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2bA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2bA01
1Y3IA 1Z0UA 3V7WA 2I2BA 2I2AA 5DHUA 5EJIA 3V80A 3V7UA 2Q5FA 2JGRA 2QV7A 5DHSA 5DHPA 1SUWA 3PFNA 3VZBA 4WERA 3V7YA 3T5PA 5DHRA 2I2DA 1Z0SA 2I29A 2I2FA 1Y3HA 1U0TA 5DHTA 2P1RA 3V8QA 4L02A 2QVLA 5EJHA 5EJFA 3AFOA 1YT5A 3V8RA 4DY6A 4HAOA 2AN1A 2BONA 1U0RA 2I1WA 3V8NA 3VZCA 3VZDA 1Z0ZA 5DHQA 3V8PA 4WRRA 3S40A 3V8MA 5EJGA 4V24A 2I2CA
chains in the Genus database with same CATH superfamily
1KK2A 2CE2X 2D06A 4TZTA 4A1FA 5IZ4A 2FW8A 4N3CA 1YMQA 1PLJA 1NU8A 4FT2A 1HE1C 3LVQE 1XTZA 2QG4A 4OQEA 3HO6A 2R66A 3A6FA 5HGJA 2PUEA 3FD8A 3BJEA 2FFQA 1NPYA 1MHTA 2GPBA 1CBUA 4C4XA 3HCBA 3FOZA 3HCOA 2AFIA 3LT5A 1HT1E 2W2NA 4I4TF 5HZMA 5K3EA 2NZJA 3ZVNA 3QM1A 5JJ5A 2GPSA 4JJAA 4C5CA 4IP0A 3OA2A 3KDPA 1V9SA 2HBRA 3GVCA 2WOOA 4V0NA 4C6HA 1WL8A 3NPAA 3QE9Y 3B3JA 4A7PA 4B6QA 5JLAA 2PG3A 3CLHA 1YB7A 3DDOA 3UOTA 1XRNA 1P18A 3NDJA 3V7FA 5LWHA 5GTDA 3KEFA 1TM2A 3PFBA 3B12A 1DOAA 4M46A 1Z7BA 2ZJBA 4RGYA 2C8KA 3NHKA 4KE8A 3WTCA 3ZGOA 3TDKA 4EUKA 3COPA 1YJMA 1OLUA 1ISMA 2IZ5A 1QG0A 5HS4A 1EFHA 2ZAYA 1QH1B 4BNDA 1TM3E 1DU4A 1EBUA 1JFSA 2ZQ5A 5SYMA 5JNRA 2DCMA 3DOUA 4FFRA 1UKEA 5K4GA 5EGNA 2NQTA 2VQDA 2KB3A 5TXGA 5EJHA 4WKNA 3WDKA 3QA9A 2BGIA 4MHSA 4FI3C 3ZCPA 4Z4HA 2QN8A 3UV0A 2G1JA 3LVFO 4L7QA 2GTPA 2Z2JA 4GICA 1CZRA 4KR6A 1M0TA 1R0LA 3GLIE 1M7HA 2Y1CA 3EQ6A 1QIEA 2IXTA 3FYUC 2FU5C 4PX9A 3ZE1B 2R6CA 5C1IA 3MS4A 4AUNA 3OP1A 5EXDA 2UVQA 2C7BA 4X1IB 5FNZA 4B8YA 5JH7B 3E03A 1E92A 2AHRA 3OC0A 4DEVA 2JG3A 4IH4A 1NV8A 3M9WA 3FB1A 1RRCA 5JDIC 4R31A 1X77A 3KEGA 3CEMA 3OZFA 2GRJA 2M6LA 1PDVA 1XRSB 1M2EA 1U8CB 4KIUA 3TEMA 4QHSA 2PUVA 3HB0A 2RHOA 2X1VA 3P2IA 4FJ1A 3I6YA 1RVDA 4J2OA 3EIHA 3PNOA 5IKXA 4NAHA 4HO1X 4NBWA 2WKQA 4KODA 5CK4A 1FPQA 4LXQA 4A27A 3VX4A 1PE0A 2K7FA 4IFIA 2XA9A 4YMIA 1U1DA 5D1NA 1JAZA 1Z83A 1YDFA 3F5QA 1F0KA 3JX9A 1UKAA 3H2YA 4HX2A 3SNKA 2XAAA 4C21A 2OFOA 1F0PA 1X1DA 1U2ZA 4DT1A 1HFJA 1I3KA 2JRCA 2OXEA 1TYEB 2AC4A 2VPIA 3A9WA 3FWZA 3L84A 4TUYB 5EE0A 3W34A 5B58C 4AN1A 5JROA 3JAMA 1A9XB 1N8SA 4TKVB 3SHVA 3USES 5CA1A 2ZAIA 1D4ZA 3EWIA 1L5LA 4FQ5A 4Y9RA 1XLVA 4BNVA 2HA4A 3LHFA 3S1AB 4RSRA 4BU1A 3UK6A 4DANA 1QG4A 2XVAA 4JEIA 3R74A 4ARCA 1FLDA 2QX7A 2X9GA 1S5PA 4IM7A 4YJ3B 1B8PA 1K2VN 1REQB 1IHYA 3CBQA 3HBFA 3IE0A 3M6UA 4R0NA 4WOPA 1OPXA 4YMWA 1F06A 1ORDA 1JPNA 2W98A 5DBEX 2C0PA 2YNMC 3EDOA 3ANLA 4MGZR 2PPVA 1NZDA 4D3YA 2YXDA 2OBMA 4OM8A 1CJSA 3GP8A 3V1MA 1P4GA 3A6JA 4QEKA 1SC4A 4WN9B 5DX0A 4FYMA 3C6XA 3V7WA 2QLMA 1BWRA 4C08A 4RPIA 1W2GA 2IYPA 3KFLA 3CUVA 4V2IA 3AF6A 4WPGA 2TMGA 2WY2D 4L4SA 4EHKA 2GPJA 1WXHA 2YASA 1KJWA 1O1YA 3KQWA 3HYNA 3P9XA 3A6LA 4GRAA 3I58A 5DH9A 1KH1A 4M1EA 5EZYA 2O5CA 2WFLB 1J49A 2XV1A 3H5AA 4HNVA 3U4QA 2WYVA 1XK6A 4U2BA 3UJPA 3E61A 3IH5A 4EMSA 5CH5A 1G1AA 1IOWA 1BW9B 1VL8A 3A7EA 4PCVA 4BN4A 3PWKA 2RD2A 2JLWA 4BNNA 2C2HA 2FPXA 3KZVA 1QXSA 2YHAA 3HSKA 3NXKA 4Z7NB 3K32A 2O0MA 3PT5A 1EWRA 4B7CA 5EJGA 1SBIA 3JR7A 3QGMA 5CNIA 1DQYA 4HQ0A 1DMSA 1NX9A 4P4NA 1Y1SA 1VGVA 1Z7WA 1W5AA 2GZRA 2P9YA 4LZAA 5IU6A 2O1WA 3EBLA 4JJFA 1J20A 3ODPA 1K9SA 1V8PA 1WDMA 2R3SA 2Z58A 3R7AA 4LWPA 4NCAA 3HX1A 5D6NA 2QM7A 3ZLUA 2XMZA 3DFFA 4KR7A 4YDRA 4MUGA 5ESRA 4OMDA 1PZMA 2E2WA 5ER6A 1P1BA 4E4TA 3VU0A 3OFKA 2YJ3A 2I62A 3V1YA 4X6XA 3F4BA 5DNAA 3ITKA 3R0VA 1NIJA 1KOGA 3SX4A 4PRKA 1OAOA 1ZCBA 2PMDA 3WQSB 3A1WA 2WIJA 4UCQA 5ENDA 4AYWA 2F3TA 4EF5A 1Z0AA 1S2IA 3ITNA 4Y2UA 4M6WA 1N5KA 1RXSA 1SUPA 4GYYA 4B44A 4EFMA 2PUBA 5EKTA 2H16A 5JG7A 2W42A 4F7WA 2CYCA 1KEUA 3UGQA 3S68A 2TSYB 3TIGA 1KY4A 3CJRA 5IAEA 1SOVA 1YE3A 1UBGA 4UBLA 4CDRA 1YQGA 3D2BA 5SYAA 3WQRA 1TADA 4L8FA 5CVJA 4Q7KA 1WUJS 5TQVA 3X1YA 1TO6A 2J8ZA 1M1YE 2FSPA 4M88A 5JBNA 5FPQA 5JSQA 1MKYA 2P5UA 4WACA 1QH8A 5IAAA 4KC0A 1UMDA 4BZWA 2ODQA 2NSHA 2EJBA 16PKA 4EI9A 1W96A 4Y1RB 3WBKA 1Y5NA 2BGKA 2AFVA 3ZH9B 1A96A 2WPNA 3VHLB 2BYTA 2Z2ZA 1JI0A 1JJVA 2ZT6A 1E79A 5LMNB 2R47A 3VO9A 5B4TA 4RPGA 3C5WP 1VYTA 1U9ZA 3VOSA 1AK2A 1XVIA 2Q6LA 1YFLA 4IIJF 5FCDA 3OETA 4JUIA 2EJVA 3NWPA 5KNDH 3Q7TA 3BXXA 1LSUA 2PX4A 5JMOA 1N2GA 3ZJ4A 4D56A 2EKDA 1M6HA 2ZRHA 3X0DA 4K1LA 4KQ1A 1A5BB 1SCUB 4MV4A 4IICA 4ND5A 4H1WA 4MKFA 3E5MA 4K9MA 1VG9B 4ZRDA 1U7ZA 1E6UA 2IDKA 5CYPA 1E9AA 5DGIA 2AT1A 2XHZA 3NTLA 5AK6A 1ODCA 3KB8A 4RV9A 4UUQA 4NECA 4INOA 5ALIA 4YV7A 1FUUA 2YJTD 4HEA6 4UVEA 1F3OA 2PMWB 3BJMA 1SEPA 1E9DA 1YS7A 3PUYA 4EA7A 2DFKB 1ISIA 1EB8A 5BSGA 1BEUB 1D1SA 1ZGAA 5DNCA 2ZCUA 3D3WA 1KP3A 2UVDA 2NU9A 2BM1A 2WM9B 2PTGA 3LYUA 4QTUB 2C9BA 3MAGA 2EZ4A 2VSQA 4JI6B 5GZ1A 1XMJA 2PH7A 4QGAA 5H9VA 4LI0A 2C83A 3EISA 1BN6A 1NMXA 3TO5A 3U4DA 1H2XA 4HYYA 3FYTA 1XD2A 5GAJA 4WLEA 1W75A 3FX2A 2XGSA 4IQGA 5DYWA 5C7LO 3PHIA 2C20A 3VSCA 5A3JA 1KJQA 3B1KA 2NU8B 3RCBA 3BS4A 1U11A 1UADA 3EF3A 3KBBA 4I4CA 2B4YA 3T4UA 3NXSA 2IYTA 3NFRA 1SUBA 4MUBA 1M9NA 1N32B 4IEFB 3OKPA 3ZIDA 1M74A 3NIBA 3OPVA 3VOTA 2Q0SA 1GG9A 2CZGA 1KSGA 4CL2A 1PZGA 5DX1A 1NQAO 1ETUA 3KV1A 1D9ZA 3EGCA 3EVNA 3L07A 1GG5A 4U7JA 4L15A 2XBUA 4GBED 4I0WB 2BFEB 3QVOA 4HDKB 4KPUB 1EIWA 3M5CA 1DLIA 5A0TA 1X38A 4WCFC 2YQ5A 1VIVA 3QJ5A 3R8CA 4A0EA 4PCAA 4PNPA 5BW6B 1GUYA 3CVOA 4NX2A 4BGVA 1CVRA 1TZCA 4MI1A 1AO3A 1M7GA 1UK9A 4R7TA 1MGOA 2BF4A 3R9IA 1SKYB 3W1EA 1JDUA 4PBSA 1JLRA 2C96A 1G3IA 3I6UA 2D59A 1RWOA 3HA2A 3IIEA 4EPVA 1U8XX 4KLRA 1I1HA 3W5JA 3UJ7A 1U5BB 3OECA 1WOYA 3QIVA 4DILA 4BMYA 2XT9A 3AR3A 3K31A 1EFVA 1OYOA 2OCGA 1E2NA 1EKXA 1NE2A 3O0TA 2HL6A 4Q24A 4X5OA 1EFRA 5GP1A 4PSCA 4HH4A 1UOOA 2WSMA 4LV5B 1JB9A 2WD7A 3FNGA 4HLDA 1K3FA 2AZMA 3QNUA 2W6NA 4CL8A 1DOHA 1YC5A 1Q1GA 4LY3A 4W9NA 5G1OA 4UU0A 1O5IA 2M9MA 3WGGA 4DXDA 4V03A 4DIKA 4QQFA 2PRZA 5DHPA 3HPRA 3IILA 4OO3A 3R9XB 1JLSA 1JAHA 3MWEA 3U1BA 3OPYA 2I7XA 4BXOA 1U65A 3BMQB 4ZDKA 1OGJA 1PVOA 4JCOA 4J90A 3WLIA 1J6UA 4KGXA 3PWTA 1IBKB 1J99A 4JI0B 3KR9A 2JAWA 3GVIA 3B3AA 5DCUA 1NXXA 1PJQA 1UC8A 1D09A 1DDGA 2PLAA 3D6FA 4FX2A 4IIEA 3FCSB 1TX4B 4YHBA 2VK1A 4XQ9A 1PW5A 2RAPA 2JAPA 3QELB 4PRZA 5I7UA 1SUFA 2DPLA 3FWNA 1I32A 3GRZA 3RS5A 1GN9A 3DM9B 5CA0F 3LECA 5IZCC 3CWQA 4U4AA 3HR8A 1F2VA 1P39A 3QLUC 3GH1A 3DFIA 2HA2A 3KJHA 1LDYA 1LZKA 4IEEA 5FL3A 5T4FA 1W5SA 2Q8QA 4NZOA 1XZAA 4DM3A 2QUIA 2FCRA 3RGGA 3SXJA 3Q10A 2NYVA 4Y9TA 4Y6GB 2QRGA 3ZWYA 3EG5A 5BSWA 4P86A 1HT0A 3LDHA 3RQSA 4CUKA 5KVCA 3TGPA 3BM5A 2XNHA 4HRVA 1HI9A 2LR0A 3IQXA 3LHIA 1QLHA 1A1SA 1BOOA 3EXIB 2DFTA 1UBFA 1GQYA 1DOZA 1KDOA 3KYIB 1RAAA 4RHFA 1JI3A 1D6MA 3HUFA 4YO7A 4EKGA 2HLNA 3GJSA 1L4BA 1DDOA 4E51A 5HWSA 2XNSA 5HIKA 1CY7A 2JZNA 3NP9A 4WMLA 2ZIZA 4X62B 3LC2O 4CKWB 4BPRA 2YFKA 3DQPA 3R7FA 2NWQA 3PP8A 2C84A 2D8AA 1V8OA 3EVZA 3L5OA 4LJ9A 3BMCA 4YMLA 1MAAA 4S04A 3KPUA 3U9LA 1K2MA 3FUTA 5CLJA 1T2FA 3GVPA 4QGGA 4HXYA 3GJTA 4BNTA 4FNMA 1G9SA 3EG9A 1OFHA 4CQMA 2P2ZA 1KOFA 2DC1A 4Z9XA 1LDNA 3OU6A 2E21A 5KI6A 2P5YA 5AVRA 3ESRA 4BQSA 2ZTLA 1CP3A 1D2HA 4Q3BA 3KUXA 4Z9FA 4ETMA 1L5YA 4QO8A 4TQAA 3IEMA 3PGA1 1U7DA 2ON6A 4I4TB 5TPZD 4PYMA 1DC5A 1WB6A 4E2ZA 4RKYA 1IBLB 2AFRA 1BFKA 2FB9A 2XYPA 3RUEA 4EAQA 1ZJ5A 1NXQA 2P77A 3DFMA 3VVCA 2PGNA 1A2KC 1UJBA 4FC6A 4L0DA 4PO1A 2VEDA 2ZRMA 4GD3Q 3BPSA 1ETHA 2X19A 2CK3D 3QNMA 3ZXYA 3LY7A 2OFPA 4FCWA 3W2TA 3K8QA 4YJKA 4OQMA 4I1OA 1K3UB 4AZ3A 2QR2A 3PNMA 2BTEA 3MOSA 2RKBA 1ZISA 3UNXA 2H08A 4OK6A 1DIAA 2B99A 1RWNA 1W0CA 2Z6VA 3O8QB 2Z9BA 1A2BA 1KH3A 2KBEA 1OZ0A 2JI9A 3QOWA 4LHXA 4A8HA 4DLZA 2SKCA 5KBYA 2XBLA 3LT4A 3BXHA 1II8A 4A8TA 1H9BA 1KZ6A 5TQ0B 3RK1A 1K75A 3ADKA 4QU9A 1PZXA 4XSGA 1P91A 3FE2A 4AP6A 4BUJA 1U0TA 3F74A 1PJ3A 4KNYA 3KZMA 4OMCA 5DHAA 5A4JA 3T8YA 2YNMD 3FTDA 3OY2A 4ND8B 3VV2A 3C85A 5KX5F 3C45A 4TTSA 2DQKA 1THMA 4NOKA 5FV7A 4CT4B 1VJRA 3ROGA 3MBKA 2CT8A 3H97A 3Q2OA 3FUXA 1T2AA 1AKEA 1VGQA 3BSFA 1BQEA 2YYYA 4GYKA 4OXRA 4EBFA 5BW8A 4EYKA 3OJXA 1HY3A 2E4XA 2O0LA 2OXCA 1X3SA 3DDCA 1I7NA 1P9LA 4J3JA 4OK5A 3JYHA 4YCDA 1R4NB 3TW0A 1RQ7A 5B7GA 3Q9SA 2FFRA 3GF4A 2QZJA 3HN2A 3VR6H 1NXWA 4EF4A 8ADHA 2EJTA 1JBKA 3EGIA 3OZCA 1SBHA 3MXTA 4FSDA 4ACAA 2VIIA 2IYQA 1ZJJA 1U3FA 2Q4OA 3D4LA 1MQAA 3NOVA 3UW1A 4CM7A 5FPKA 3TLGB 3FUUA 1J24A 1F3LA 5ELMA 3F6BX 5BWCA 1NLMA 1QONA 2ZS9A 4L07A 1CDOA 4LE2A 3T9DA 2ZBDA 5DYGA 2C7PA 3FFXA 4PYJA 1EP2B 2GKGA 3HCCA 4NKRA 1E1QA 4NVRA 2WTNA 2X8LA 4DA7A 1EVJA 3BKWA 1NKSA 1UQUA 4RFLA 4F3CA 1BDIA 3AX6A 5DW0A 3TQIA 1OH6A 3ADCA 1BMDA 1RZUA 2ZANA 5IWAB 3B7GA 4KNWA 2WWHA 3II6X 1YZGA 5EXEA 4MEBA 2C9MA 4YUWA 5HIAA 1GITA 1P1KA 2IGTA 4D42A 1L7OA 3SHTA 4C05A 3D0OA 4OFZA 4QQNA 2ZI4A 4QTZA 1K7EB 2RH5A 3EE6A 4P98A 4QHTA 3GLHA 3NBQA 1MVLA 1NP6A 2OM2A 3HWRA 2ZB3A 3IMGA 4DY4A 3CT4A 4BB9A 3SC2A 3GEDA 1W36C 2G9UA 3HQ4O 2PJRA 1OZFA 4LW8A 1W9MA 3D9QX 5EP4A 3L8CA 2JLCA 2O52A 1INLA 2D4AA 4ODIA 5AXBA 1A9SA 4P3XA 1RBZA 3DMTC 3CZCA 3DZ8A 3VYVA 1VG1A 4FFPA 4ZZ3A 4LDNA 2A9PA 5IDYA 1MO5A 3T5CA 4Q4AA 4M4SA 2KBFA 1W5TA 2OFFA 4TKZA 5L51A 2QL7A 3TZLA 4XQGA 4XCXA 2H2DA 1N6RA 3D7RA 1I0LA 2G9VA 4INAA 1QIIA 3GDOA 4RKFA 2HHJA 4FS3A 2YWXA 4OU5A 4Q01A 5C51B 1TVKB 3OE7A 1U7FA 1XJ5A 3OH8A 4P0TA 1R12A 1JH8A 2OZLB 3G6KA 2O14A 2Y6UA 3NBKA 4D8VA 1D2RA 2CYAA 3IEXA 2YW9A 3HZRA 3SQDA 4DMLA 1BSVA 1KR5A 1ZJYA 2VA8A 5BPHA 2XCOA 1BVYF 2WP8J 4KYUA 1CDDA 3LHSA 1X80A 3FXAA 5DXAA 1VCNA 4P7FA 4U2GA 2RDMA 3MS7A 3HHPA 3SPXA 1QIFA 3ZDFA 4PN3A 3JCZA 1BKYA 3UJAA 2HLPA 3W5IA 1C3XA 2DG2A 4WY2A 1PWHA 1BCRA 1ZOOA 3DLCA 1PJRA 3OZEA 4L85A 1Z5NA 2OUKA 5AM2A 1UEIA 2WJPA 2D1YA 3OZTA 3IT3A 1OWOA 4WWHA 1Y7PA 3EXHA 1L5QA 2D62A 2QMOA 3EC1A 4L76A 1MV5A 2FF7A 3HDJA 3OIVA 4MDYA 4N47A 4ABYA 4B34A 4H35A 3ASYA 1A8IA 2AI3A 2HWKA 5HKBA 1OX6A 1ZNXA 4ZT3A 1RFLA 1VKJA 4TYYA 5CBPB 1Q1EA 2YWEA 4D41A 2GAOA 3KLPX 5A4MS 1FVFA 4QT4A 1YJXA 2J46A 3KM0A 3NHRA 1AKTA 5A9SB 4HGQA 5I7AA 1U2EA 4P6VF 1TMOA 1EP9A 1HA3A 2C1EA 2DBRA 2IY7A 4Y2SA 4YMSA 1JAIA 3MJ4A 2EGGA 2HCRA 2Q5OA 2VPQA 4UCWA 4C14A 3ER8A 4I46A 3P0EA 5AP9A 3LPAA 3D5TA 1WABA 3RT1A 3G2MA 4NFSA 4A16A 3CLKA 1U0OC 4KB5A 2G8NA 5IYZA 3NANA 2NXNA 3CR8A 3DZIA 5EYPA 2G9QA 5BP7A 4MAAA 3A7DA 3Q11A 3DW1X 1QSGA 3B6EA 3D0KA 3K5WA 2TMKA 5FUVA 2CLFB 4IWYA 5I8ZA 2GASA 3CH4B 1R9JA 2PZEA 3H5WA 4IIJB 4MRVA 5LQKA 1H93A 1FU4A 2XDWA 3BGWA 3FZEA 1YV9A 2XI4A 4KN9S 3GCGA 1ADBA 3PR2B 2FZKA 5HW0A 1NVKA 4DCUA 1I3MA 4XCQA 3BGDA 3CW8X 1XCBA 2OZKA 4YGYA 1EXWA 1PJCA 4YJFA 4JODA 5BN4B 2I1VB 1SA0B 4JA2A 5IKMA 5EJ9A 1CZOA 3AT1A 4M21A 2WM3A 3MXOA 1DKUA 3IHWA 3ES9A 4QZVA 4TT3D 1KYWA 4J4HA 4Q5IA 4QECA 3QMMA 4M38A 4XD2A 4ZXFA 4EVQA 5ABPA 5EFOA 2ZUVA 3A9TA 3P9ZA 2IYWA 2ZUCA 2DFPA 1WDTA 3FHJA 1U2GA 3NRCA 4GLFA 2OO7A 4LX0A 3RU2A 3ADBA 1B6RA 3TD9A 5B3LA 1MV8A 2MMGA 3BEDA 4O2AA 1LI7A 1S2GA 2HQ1A 4Y98A 3VDMA 3TL2A 1C9KA 3OX4A 2KWIA 4HG2A 2HNBA 1KHXA 4B3BA 4MGYR 1D0SA 1EPUA 3OE1A 2C4VA 1WY7A 3BXZA 4O1MA 5FHQA 3TJRA 3WWZA 5IT5A 4DR4B 4CTJA 2OGZA 3F2IA 3ONNA 2GO7A 1S9DA 4FB4A 4KAFA 4G5SA 1C7EA 2AK2A 3PICA 2EVWX 4EW1A 1NP7A 2JNWA 2NXJA 4YDSA 3VAYA 2H92A 3N7TA 4IWNA 3GCWA 4PVCA 3V8VA 2V0NA 2QVXX 3OQMA 1VL2A 4POAA 1NJFA 3FVVA 1DS6A 4D9KA 1A4RA 2CMKA 4YP5A 3TOVA 1Z12A 4CHGA 3UJ8A 3UFXA 5H9WA 2M98A 4OP3A 3EVDA 1V16A 2JFOA 1QP4A 2O1EA 5CB0A 2LP4Y 2BUAA 2QQ5A 1BOFA 1RRFA 4IHAA 2N3ZA 4LWQA 1GG8A 2NTNA 1BGWA 2WF6A 2Z83A 3JWGA 4TMVA 3QU9A 5EQJB 3WZLA 4S1PA 2O4UX 2V3CC 2Z4TA 5IDVA 3N28A 4JA0A 5L7TA 1TF2A 4QYXA 5J5CA 3I52A 4PZ9A 1LH0A 4QOHA 1Z4JA 2IDJA 4LNUB 1EB9A 1KDZA 3U37A 4DPLA 4EFLA 5FFFA 2XE6A 5YASA 1E9CA 4NQZA 4DCCA 4MUAA 3T5PA 3QX3A 1US8A 3LF2A 1W2WB 1MB3A 4KSBA 4RVFA 3G7NA 5FOVA 4H17A 4JWTA 2PUCA 2HZ7A 1SBCA 3NNSA 5I9MA 1GTSA 1EK0A 1YR2A 2OMEA 2CXUA 2DP4E 2IX9A 2LIVA 5CLQA 3CC8A 5EA2A 1U8ZA 4HADA 1Q3KA 4XB2A 2NVUB 3I4LA 1R8YA 1ESEA 3A05A 2HR1A 1SK8A 3L18A 2JH8A 3QITA 5HSGA 4NYJR 4ETWA 1H6BA 3C6BA 3HXLA 4H16A 3O83A 2H3EA 1E1DA 3DONA 3O94A 7ADHA 4F4UA 3V7UA 4GOLD 5BMOA 4HZIA 1U28C 4WNIA 3B3QA 4DSNA 2YCBA 5LN1A 1CB0A 1K9VF 4Z7QB 2WJGA 1GFZA 5LYJA 2R65A 2PU5A 3H3FA 2HK7A 2V58A 2JFHA 2ZE6A 2DAPA 3E3LA 4OREX 3T1HB 4JP5A 4LI3X 3RTDA 5K05A 4GPTA 4CODB 1JBQA 4OKNA 3LF1A 4S1OA 5LQNA 3DSHA 4TKUA 4C3VA 3D1JA 4WHMA 4MR9A 5DYTA 3MG9A 4F3NA 3EQ8A 2QEQA 3JAWA 1KQFA 3AIKA 2I0FA 2PUJA 5FYQA 1AUQA 3EIQA 3BIJA 3ZWQA 4B3RB 3P9PA 4D4GA 1GQ2A 2PRYA 1FYWA 3BVPA 4UHJA 3TSAA 3BC1A 2XSZA 4ZHQF 1ODSA 2VYND 1EMDA 3PDWA 4FP9A 4D1YA 3N7AA 1Z8DA 3IP7A 1W87A 3IMFA 2IUFA 4Q0MA 2FRDC 2YX1A 3EK2A 4XJTA 1CEYA 2PLWA 4XDGA 3H4VA 4QOSA 4WOKA 3I9FA 3JYPA 4KWEA 5T8KC 2OXFA 4DADA 3R5TA 2R87A 4FOSA 2AFHB 1F5NA 3WKBA 4H15A 5A5GA 4HWSA 4G3XA 2K2QB 2OAP1 4C0SA 2XZLA 1RAEA 4Z4GA 4DJJA 2QNBA 1MOZA 3EVTA 2C95A 2OCPA 1KXJA 2GCOA 3IRUA 4NJMB 4H7PA 1FRQA 2ZWPA 3E58A 3KJFA 4ZAYA 4OFBA 3R8XA 4DMRA 5BRJA 4RX1A 5CFNA 1K8RA 2QM8A 4R2KA 2Y0BA 3LZCA 3OURA 2NACA 3UK2A 2V3WA 3PI7A 4WKGA 1U99A 4WRRA 2IYXA 3OFNA 1C2YA 2ZVQX 1EX9A 1O6GA 1P5HA 3DAPA 3K1YA 1ZH8A 1TKAA 4QDJA 4O08A 2P3QA 1YHZA 1XKXA 3R09A 3BSSA 1ZK3A 2QE7D 2H1LA 2B92A 4K3UA 2O2XA 4ZI2A 1YVPA 2AOTB 1RRGA 2XA2A 2ZGVA 3R7WA 2MSKA 1E2EA 3VC2A 3DE3X 3M83A 4U5XA 3WDLA 3KT6A 1CERA 1VE3A 3VH2A 4YRKA 3UW3A 5BQFA 5JNTA 4GIBA 4MMZB 1XDUA 2YFHA 3DZCA 4PBRA 5AKGA 4B2YA 4ROTA 4ZDIA 3SZ3A 1KMMA 2WA1A 3A32A 2E4ZA 3G5MA 1BS1A 3L0IB 1OT5A 4X1YB 4B3XA 4DSAA 2QQFA 5KPDA 2BMVA 2R8ZA 1XV5A 2GA9A 4OSOA 1MN6A 3PUHA 3SX0A 5JEDA 2ZXUA 3QXSA 1B00A 3EOAI 5L53A 5JCJA 5K0SA 3NHYA 4HQ6A 2EW8A 7REQB 1VIYA 3IXQA 3TGLA 1XT6A 1UDCA 2GI4A 3FYHA 4GDMA 3WIEA 3VRHA 3AUJB 1XPUA 4NL4H 2I34A 3HKCB 1SC6A 5DP2A 5BQXA 3G0IA 2P90A 4BV8A 2QN1A 2VP9A 1XA4A 3IC5A 3U1VA 2CSUA 2ZYDA 1SKYE 4YXFA 2I7DA 2CXNA 2HF9A 1I51A 1RJEA 3K9BA 1L1EA 1DRWA 3CSSA 4HZUB 1EZZA 3M5DA 4BNIA 2Q45A 1GYPA 1VA4A 1XD9A 2NU7A 2PMCA 1JPJA 3DV9A 1J8MF 1BHJA 4Q03A 2REXB 3ZBTA 2CYBA 4I2NA 4TM7A 2AOUA 4RY2A 4JUDX 3UHFA 2C03A 4BAUA 3RIGA 2J9RA 5I01A 4YDHB 2QDKA 3GLVA 1H2YA 4L5JA 3UAWA 1Z4KA 1WF6A 1Z6TA 3MRVA 3P0IA 3H13A 4EFDA 3DZKA 3I04A 1SHLA 2MSCB 1Y9AA 5LZ4A 1E3TA 2AFIB 1NUTA 3DL7A 4OHCA 5L3VA 1NZFA 2AHOA 3B6IA 4YBRA 1E5LA 3WMXA 4B47A 4HXEB 2EHJA 4RZ3A 4IDQA 1G66A 1PFWA 1JKMA 2BGRA 3LPDA 3QXHA 5HJ2A 1R6VA 2O3RA 1NW9B 3QHQA 3S44A 4CG0A 3VYSB 3IVMA 2IGBA 3PPYA 2CY0A 3R3HA 1ZVMA 4M3NA 5F78A 5CDFA 4O25A 1R7RA 1VJCA 3IAS6 5KX5B 4H59A 1IQ0A 1T36A 1FEZA 3ZPXA 4J1TC 4D98A 4X1KA 1KZ7B 2J6IA 3KV3O 4E11A 2C5SA 1UCFA 2AMVA 3LG2A 3QEOA 4AWXA 2GK6A 1GYRA 4BGIA 3L05A 1QDLB 1H65A 2Y71A 1SCBA 3DOJA 2BTOA 1Q12A 2Q2OA 2XB4A 1FB5A 4BNDB 2XCUA 4B6SA 4RQUA 4L8GA 2XY4A 3KWFA 2FH5B 1CY2A 4YALA 2A0XA 2ZSHA 2PO7A 1C9MA 2PT9A 1FP4A 1P0IA 1EDZA 1N5JA 2AR7A 3OQ1A 4Y6RA 1ZJ6A 4ZMBA 2Z04A 3QJGA 1IBMB 5ICGA 3HBLA 4KJZA 3ZGZA 4DIMA 2W2LA 5WRFA 3D7LA 1G8MA 2LDXA 2Q21A 3M9LA 2AXPA 4LY9A 1LWNA 4DLVA 4FGWA 2H7YA 1N6HA 2DVMA 3AFIA 2G1KA 3LT2A 1JIVA 3QFTA 1JTVA 4DF3A 2OO3A 4RVOA 1C7RA 3D4PA 5AK5A 1KI4A 2E89A 4I99A 4IJQA 3LKDA 4YRPA 3OSZA 3RF7A 3ZG6A 1R4ZA 2FOIA 4IFBA 4OYHA 5JNLA 1G2IA 4Q1FA 5K51A 1H5QA 1FK8A 1YZFA 1PG0A 1AKVA 4GPIB 4MQ5A 4P3KA 2QUZA 4S1TA 5FWXA 4EHBA 4YPOA 1AKUA 1C41A 2CUKA 2QJWA 5TF4A 4ZRNA 1XZIA 3B1YA 3KX2A 4R2XA 3HGMA 3L0SA 4GBGA 3L7CA 7AT1A 2GMWA 1QAOA 1PFGA 2IVFA 1E1LA 1V71A 2W2VA 3G13A 4RTRA 5FBLB 4QBFA 5C5CA 3OQIB 4MWGA 5AW1A 4CMIA 2MHCA 4NCJA 2I4IA 5AKYA 3LNCA 3VM6A 4DT1B 1UBUS 2XCSB 1OGYA 4TYQA 4TX1A 3ER9A 4TMXA 3V3KA 2HNAA 1U3WA 4FVTA 2BEKA 3KALA 3TNYA 4NZYA 5CA1B 4CL0A 4FC7A 2LTAA 3HU5A 4BGEA 4L51A 1ORIA 4FX5A 1LPSA 2RHCA 3RIYA 2ZXFA 1UAAA 2BGJA 4GRIA 1EUZA 3UOGA 1CEQA 3HKDA 2Q5LA 2C0QA 4TXHA 1DAIA 4RD6A 3DF7A 3H1EA 4W5RA 3PL5A 1FA9A 4OQ4A 4QNMA 3WFZA 4UTXA 2XNJA 1ISPA 1Y1TA 2CKDA 4KMSA 4V02A 1HR0B 1ZGBA 2EG5A 3SYNA 1TJ4A 3F7TA 5F64A 3PR1A 3L1UA 4M9QA 2CLCX 4TM8A 4CF3A 1C81A 1Y37A 1Q2XA 2VVTA 3EXEA 4FHFA 4LY0A 4BGUA 1DDIA 3GGJA 5IBRA 1G2QA 5A71A 5JC8A 5JWOA 1XQ1A 1WU7A 3WLLA 4AUEA 1L5KA 4OJKA 2EL7A 2J3QA 3QPVA 3MTAA 3UB2A 1V9CA 4MQ4A 1UMCB 1Z4LA 4IVRA 1F17A 4K9KA 3V48A 1VI2A 4MS1B 5MF6A 4YP0A 4EOGA 4KLCA 1X1TA 2FWNA 2G6BA 3AHCA 3LLCA 3SYKA 2PZKA 2JI8A 1KMIY 4CKCA 4I4IA 1C3EA 3B6KA 2OP0A 4JITA 5DTRA 5EI5A 3DOFA 5DBOA 4D7AA 3FLEA 3QBTA 5HRAA 5SZHB 3V4ZA 4BBZA 1V41E 2PUAA 4YJ2A 3KVVA 3HI6A 2OXRA 2ZAMA 2B4QA 1FP1D 1QORA 2PSJA 3D0QA 3JQ9C 3LVBA 4HEJA 1RLOA 2DHCA 3ERCA 1T6XA 1HTWA 3DCNA 3FCAA 4MO9A 3LLUA 3S2IA 4D3SA 1KRWA 4HEA1 3EGDA 2VNJA 4FGSA 3QOFA 2JH9A 1UWVA 1PFYA 1A9TA 5EPOA 3UK0A 3U60B 4KFTA 2C07A 3ZDCA 3HZHA 3TIIA 1XEFA 2QZPA 4DRXA 2GD2A 2H52A 1ZU5A 3G17A 1NF2A 3BOSA 4X84A 4BVHA 4QD3A 2QM3A 3RH0A 3WFJA 3IAFA 1C0LA 3EDRA 1F51E 4MITA 4E1VA 1EHCA 4IWXA 5REQA 2PX2A 1ZCFA 5E1MA 2TECE 2RGNA 3C3CA 5D3KA 3WK8A 1MRZA 4MS3A 4PIMA 3VR4H 1RI4A 2IU4A 3IV9A 4MLDA 1YRBA 2F64A 4F3YA 1RWMA 2I8CA 1GG2A 3VAAA 4M6WB 2NUAA 2HU7A 3RTBA 1JE1A 3HA5A 2PU7A 4I9NA 1ZEJA 1RDFA 3MMXA 5FO0A 2OB1A 2YJGA 3E27A 1LXCA 4IVNA 3RVKA 2YWDA 4YRGA 4J94A 5KIAA 1Q0QA 2ZRLA 3EH2A 4JBWA 1M6NA 3O92A 5JE8A 3OIUA 4YECA 3S8YA 4ZCPA 3AF4A 4AG3A 2XMDA 3MJCA 1AY0A 4YTEA 3QVGA 5AK3A 1W5BA 4BNHA 3CLTD 1QH8B 5EZ5A 2YZGA 2GM3A 4D57A 1VJGA 2WI8A 1XROA 1QNFA 2IEYA 1B8NA 4EZBA 1JECA 4NK4A 1Q3HA 1TKRA 1HK7A 5HTOA 1HSZA 3FTNA 4EYEA 1Z2PX 3SZMA 1IOZA 4PPNA 3PFWO 5DNVA 2JQLA 3I2FA 3RFUA 2C04A 3AZQA 4MKGA 1X0VA 1S7CA 2LDBA 3F5SA 3HVHA 5KDOA 3AHHA 3UIEA 1FMJA 3TCXB 3U61B 1F8XA 3SX2A 4UD6A 1VKHA 1KIFA 2H57A 3EGWA 4JXKA 3SIWA 5LLTA 3FPCA 1G5TA 3CX6A 4JX9A 2XMCA 3D6HA 4RVCA 1SY7A 2JZOA 1JNXX 1W48A 4UBIA 1DMRA 2FX2A 2QSUA 5JJLA 5JNSA 1NR1A 2W2XA 3TLBA 1HDYA 2JVKA 4HXFB 3QH4A 2GCIA 2HB6A 4JUAA 3S28A 1P5JA 4FZ5A 1D3AA 3LZ6A 2GARA 2EX0A 5BSTA 5ADHA 3JRNA 2HO5A 2X4IA 3AUSA 5FQNA 1Y6FA 3C15C 3T0IA 1UBKS 3AUFA 3PENA 5B1EA 2MWMA 2ENWA 1XVTA 3DGFC 3MK31 1VMIA 2C8VA 1V3TA 5GV8A 2NVWA 4U8GA 4FS8A 1N5RA 3JPYA 4HNQA 1NXOA 1O9HA 4MI9A 4IX9A 1W4CA 4DUPA 4EYOA 2JLRA 4N65A 2A0KA 3O4VA 3BGVA 2YMMA 1MUUA 4PGHA 1L9XA 1ECCA 2NU9B 5F76A 5LP1A 3I61A 1YS1X 2ECOA 2WAXA 1AUOA 1DX6A 2D0PB 2E1RA 1PS0A 4Y0AA 3ZQ4A 1E5VA 1VBNA 1KGDA 1XZMA 4P8RA 4W9RA 5HOEA 4AM8A 1E1YA 3U3JA 1XD2B 2J87A 5KWJA 4X64B 2ZEJA 1A5ZA 3W5UA 1VA5A 1XVLA 5LB2A 4IIDA 3LRXA 3RADC 4D2IA 3AF5A 5A04A 4JLBA 2GJAA 4MUNA 2BZSA 3E3NA 2R8BA 1GUBA 4ALMA 3RFTA 1A04A 5GONF 2CXOA 2DUJA 3HSSA 2AFFA 1TM7E 2FRXA 3RG8A 2P6MA 4Y1EA 5JARA 1N77A 4IJ6A 5HCNA 2JIQA 5LNK6 4RA6B 2Q3LA 4QDUA 1ZD1A 4HS4A 1V4NA 1Q0RA 1RCTE 1G5QA 3QLJA 3W3AA 5BUZA 1YBVA 3VR3A 4ZJYA 3UPUA 4LF8B 4CTNA 5KJ1A 1R18A 1S96A 2OV3A 4BIIA 4JOSA 5KVQA 1U0HC 5IFKA 4XDYA 4HLUA 4BC1A 1OC2A 2OV6A 3Q3IA 2MSEB 3VR0A 1VPDA 4KAXA 2BTQA 5DOZA 1YR6A 3SBXA 1CY1A 2VKTA 2D8MA 4J0HA 5CFRA 4CWAA 4OF4A 1J0XO 1UBHS 1X1CA 1L5SA 3DQQA 4PG7A 2UDPA 5JS2A 1JN0A 1G64A 1GHTA 1GNLA 4U7TB 2ZDHA 3RPEA 4IZOA 5A05A 1CE8A 3NVMB 1ADFA 4BNXA 1KORA 4TXMA 1BNCA 3FNHA 2ZSFA 4GE0A 5LYYA 2C5FA 4GVLA 3W4KA 3JQ6A 4A0FA 3C16C 2VSXA 3K20A 4KO2S 2XT9B 1EFVB 1CQJA 5BVGA 3E4CA 3RSQA 1P2BA 2Y4OA 1HKHA 1T9DA 1NI3A 4C4SA 1GTVA 1ZIOA 4X93A 4TZ0A 1X9GA 2WD7B 2WKPA 2P69A 5D86A 4TV9A 1PJZA 1Y7HA 4MPJA 2RGEA 4YACA 4DIEA 5GV7A 4C76A 2XLBA 5HQTA 1J33A 1NBMA 3GEHA 2RH8A 2OE2A 4LBVA 4YAEA 3PKZA 1X7XA 2PVSA 2YH2A 5JPDA 3MWEB 2BT4A 4EY8A 5HUHA 4NENB 3H6HA 3FUVA 4BXOB 1BYUA 1A4UA 2R8EA 2BGNA 3BXGA 4DAOA 4N5IX 3VHRA 1SUAA 2FQXA 1JLMA 2W48A 3B82A 4KUEA 4M0CA 4BDTA 1UDAA 4M36A 4TMYA 2J5BA 3TCKA 4B3SB 2GERA 1HDGO 4J0IA 4QTTB 4CG1A 5IN4A 1OC4A 4GX0A 2FN3A 1TU4A 2M2IA 3QSGA 1LPOA 5L9AA 5CJJA 3ZJ5A 1DBWA 2JPEA 4FFWA 1Q7CA 4G1MB 4MMXB 3EFEA 3S0JA 4E12A 5CFZA 1T1RA 2PE5A 2X42A 1TM1E 1SVLA 3EOZA 1DWPA 2E85A 4MVJG 4XB6B 1O6CA 2J08A 1NAIA 3C5EA 1F0NA 2I2CA 5E1BA 1ZFNA 1Y4ZA 3BDVA 2I4OA 1N0HA 4ZQCB 4TS9A 5BW5A 4Q82A 3RVPA 1AF7A 3E9CA 1NUHA 4Y3UA 5I7RA 2O59A 3JQ8A 1WO8A 2BC9A 3BXOA 4JOBA 3A1VA 1IN6A 2BH2A 2PL9A 2PXXA 1XDWA 3TOZA 4F2HA 2KE5A 2KPOA 3HBAA 1ODIA 4HT3B 1C9DB 2JFUA 4I6JA 4KYVA 5BY2A 1LEHA 1Q16A 4JBNA 5K0LA 4ITUA 1RS0A 1I6LA 4FGZA 3QI7A 1GPUA 3BE4A 4YROA 5FL7A 1LKZA 2EDAA 2NTEA 3BMCB 2WPDD 1FS4A 3D4IA 4M1WA 2MSLA 2VJPA 2YV2A 1JTFA 3EHEA 4QG3A 5DNEA 1VMAA 5KNDD 2CDRA 4QUAA 3QXJA 2FR1A 1V5EA 5A7GA 5A9RA 3R24A 3QP9A 4KW7A 4HP8A 1QFJA 4TMTA 4QFDA 2HK6A 4RMIA 2BBSA 4U9UA 2EHDA 3QU5A 2WTBA 3ONEA 1YQDA 4DZTA 4MVJP 3AI1A 3DBLB 2WM8A 4MICA 2IPXA 3V55A 1H0SA 4HSEA 2VF8A 3RASA 4DV6B 2YN4A 2J6HA 3RVBA 1VL1A 4C0AC 3ZJVA 4FNAA 3D02A 1T3ZA 1DRUA 4IKOA 5L3ZA 1Q77A 2GKSA 3B9PA 1Z38A 1E3LA 1T2NA 1G6Q1 5ECWA 1GL7A 1NRXA 2J07A 3HCFA 4WKOA 3RC1A 1WXXA 3OPMA 3MJFA 1HV8A 2VN8A 1H1TA 4P4GA 3QXCA 3EN0A 4IKPA 3RBAA 4C4PA 3K72B 1OJLA 4LNAA 2H63A 3OESA 1OQAA 2AI1A 4X7MA 5JDIA 2VDJA 1A1VA 2AFHE 2OZPA 1YR7A 4XIFA 3KZNA 3AVWA 2C42A 2MJLA 1II8B 1S3FA 3AY3A 1WCXA 3B1JA 3SJCA 5A3QA 3AM5A 3FJ1A 3C8MA 2Q9BA 1K4KA 2VQ3A 1FU8A 1KY3A 1YJQA 3G2OA 3KYJB 3O3NB 3P9QA 2HRDA 2R7AA 3NDIA 4EMBA 2JKVA 5HF5A 2F6RA 4KPEC 1OBOA 3NWJA 4RL4A 4TS4A 3RYFA 2OCIA 2R86A 1P1RA 4A4YA 2DTEA 1GTMA 2J4FA 3PD0A 4M87A 4UMDA 3AQ4A 1XTRA 2NTVA 1K8YB 5KTSA 3MGKA 3H86A 4WSOA 3CVYA 4H4CA 3U4GA 2F1HA 3ET5A 5I4CA 1OX4A 1A7AA 3RT9A 4ZDWA 2DR3A 1XZGA 2ORIA 2YJ5A 1TVEA 1E4OA 3OCUA 4QGHA 4ESEA 1VLJA 2J85A 2W3OA 1RXVA 3PT9A 2ZYSA 5BYJA 4ZARA 1R0CA 4J4TA 2CLEB 3EZLA 4L4XA 1UC9A 4KO3S 1XL0A 3ZV5A 4AZVA 2RC5A 3O3OB 4K6MA 4G8BA 2BFFB 3DOHA 5JJIA 5J4LA 2LD4A 2Z2XA 2G4LA 4WUTA 1Q74A 3JD1A 4WFQA 4X61A 1OXTA 5DTQA 1CUHA 4GI5A 4XFJA 3C0KA 1YQWA 3T4PA 1FYDA 1JV2B 1DEXA 1XCPA 3C6QA 1DXHA 2MT9A 3C43A 1EFCA 4B5LA 2VJYA 1N2BA 1WZEA 1FVHA 1QX3A 1D8TA 3FNBA 4HBGA 1YR9A 2W83A 3UG7A 2R4TA 4EHHA 5I3ZA 4J0EA 1M0SA 4GVPA 1HT2E 4L0CA 4MKZA 1XTBA 3U40A 3REQA 4MP6A 5LJIA 2GDZA 4EECA 1Z8FA 1HG0A 2DFLA 2P9HA 3L6EA 3T7SA 1RYNA 2XMSA 4FEAA 1DC7A 4YRAA 1PT5A 3TL6A 1SXPA 4KI7A 1Q0UA 2WWTA 3HB5X 2A4MA 4ZZIA 3GFVA 4IJUA 1U1GA 1AGPA 2D1FA 2OBXA 4N3NA 1MHPA 3GLHB 3I5AA 4QXRA 1NOJA 1M6YA 2B7BA 4OH7A 5JALA 3QX7A 4NV3A 2XEDA 5C1DA 3WRYA 3GUHA 1UIMA 3AV0B 3SC2B 2AYYA 4H9GA 1OY1A 1T8WA 3WGTA 2WDZA 3OQPA 3KETA 4QYSA 3CNQS 3H5NA 2AFIE 2W6OA 2Y1WA 4CG3A 4F4FA 1QIJA 1AQLA 1YMVA 2AEFA 2I7VA 3QUCA 3F96A 4DUGA 1DQZA 4LV8B 1JHUA 2QVBA 3LKBA 4Z8YA 4Q4AB 5SY6A 3TI7A 2FUNB 5T64A 1EGVB 1I5EA 3C3XA 4EPRA 3OM0A 3CPSA 3K30A 4KWIA 3SFVA 3ZXSA 1UDBA 2XW6A 1KQGA 3MTBA 1V1JA 3TPFA 4D45A 1KEZA 2BSXA 3U31A 3VKGA 3L7JA 4JI1B 3ZE6A 1DELA 1E77A 5THKA 5JS7A 4KR3A 1Z0UA 3RYHA 4IRXA 1CUEA 2W2QA 2NVOA 2YJNA 4N0PA 2GN9A 1VLMA 1EEXB 3NOXA 5K6RA 4A73A 1GADO 2HQOA 3IOCA 5CVTA 1EQAA 1MRNA 4D4LA 1TL7C 5AVSA 1MIOB 3CNBA 3GH3A 2QMEA 4XQEA 1X80B 3N6XA 4EPTA 1ZR2A 4ARSA 4YRDA 1JVSA 3OHPA 1PT8A 2BOVA 2H00A 3CM0A 3CIOA 3RK4A 1QO9A 2Q41A 4IZHA 4LJ5A 4DZRA 4Z4QA 2F59A 3MWKA 1L7VC 5DNDA 5J1TB 3NIWA 3FTEA 1BCRB 3INGA 2IW1A 8ATCA 2IC5A 1VCMA 1OZGA 4DYHA 5ILGA 5SV2A 1O77A 1AH2A 3LY9A 4F93B 4DR7B 4LEIA 4BFWA 3Q9LA 3JQAD 4I5DA 1GTRA 2P4QA 3EXHB 3SQNA 1IEQA 5EIEA 2BCGY 4U2FA 4K9LA 1DQSA 2B36A 3VPFA 2C88A 4BNKA 2OHGA 3EPHA 5K0BA 2Q1SA 1MDFA 5IG2A 1R6TA 1OWMA 2HPHA 1SH7A 3R7BA 1JFTA 1IBCA 1X1EA 4PZZA 3KQKA 2D5BA 2Q07A 3ETEA 3UB4A 1YB1A 5J47A 1U2RA 4O5AA 4R0VA 4MEAA 2ISCA 4HDNA 1YDGA 3DMGA 2VJCA 1GXCA 1IK6A 1MFPA 1NKVA 2J3DA 3B51X 4PANA 1IUNA 4TLLB 3VR2A 3PX2A 2BKAA 4B87A 1M8JA 2O5VA 3E8SA 5AM1A 4Y6LA 5EYPB 5EIOA 1PJAA 5IC4A 3HTXA 2ZYIA 1WULS 1PNQA 4V1CI 5D7BA 4D6PA 5EJ6A 4OKIA 4BQPA 4OI0A 1VDZA 1ZGGA 3K35A 1C7JA 1EFLA 3NBZC 3CJQA 3GLRA 2E7ZA 3QKTA 4JFAA 4D9VA 3W7BA 4CMBA 5F35A 3AFOA 4B4UA 4YJFB 3RTAA 1DQPA 1HOXA 1T5HX 1I6KA 1U3VA 4P2BA 4AIIA 4B4KA 4CI0B 5A0VA 2I3ZA 2QZZA 3QLVA 1N1EA 2QTVA 4LVOA 3T4XA 1K8QA 3MCAA 1K6EA 3GBVA 3SJZA 1E3MA 1PNTA 1MX3A 4OB8A 4Y6PA 4AMYA 2Y77A 1DLJA 2CKMA 5KJEA 2AL7A 4RMGA 4BN5A 2RHDA 3I42A 2SNIE 4GBJA 1SXHA 2XGJA 3TJZA 4EEXA 4RGBA 5AOBA 1J4KA 4O2AB 3V7YA 3ZWDA 2YHSA 5AKJA 1Z5WA 1HUQA 3MTIA 2EV9A 5A4KA 1FX1A 1UR5A 2DZDA 1GAQA 2GN6A 4I19A 4HDAA 4R9RA 4LZPA 3ZV3A 3PEYA 2B37A 5DSZA 1ADCA 4C7XA 3MRXA 2BWJA 3CQ9A 3HU2A 4TSFA 2D3TA 1YK0A 5F98A 1C50A 4Z0HO 3ABIA 4LJ4A 3SDBA 2Z08A 1NE7A 2HREA 3VR6D 2FFBA 3BWYA 4Q1VA 3A4IA 4DLPA 2ZJ3A 2KMLA 5E50A 1NLUA 2BEWA 4Z9AA 2A9FA 4FFBA 3HABA 5DRTA 2IYSA 5EAIA 2OO5C 3RVNA 2PUGA 1JIKA 3JD3A 1PS9A 4G4IA 2Z8YA 4I6EA 4BNMA 1YOBA 3PHBE 1LVUA 1BE8A 3AJAA 3BXEA 2PR2A 1P3DA 3RG2A 1SELA 2HDWA 4JKOA 1G20B 1XNJA 1ZSVA 2Y1EA 4B4DA 3RHSA 1XRRA 4H7FA 3WZ2A 1PJ8A 1V16B 3RKSA 3DVAB 4EPYA 3DE1X 4LOJA 4BE7B 2G4VA 2ZRFA 3FBGA 3FW1A 4DA9A 4E5MA 3PCTA 4ILKA 4Q93A 1N4AA 4KV9A 4X8LA 1VE1A 1K5GA 2A7XA 5C5IA 3UA3A 5IWCA 3UATA 4YJHA 2WU3A 5BR7A 4N3BA 2JDIA 1TTPB 2A5DA 1H85A 2CL6X 2V3VA 1BVUA 1LBQA 3PPIA 4KQHA 4DIBA 1C3LA 1FW6A 3VVBA 3CN9A 1KMNA 2BMAA 1Z2AA 3T52A 1CP2A 4L3VA 3ZNPA 1TAGA 1E3JA 1NC1A 2XT6A 1JDBB 1RZRD 2ASVA 4D0LB 1YL6A 5EWMB 4F6CA 4UBOA 3LX8A 2EXXA 4RSMA 1IY0A 3DAFA 1YDMA 3KYCA 1OBHA 2B1QA 3IHTA 4PO8A 2NX2A 4PYOA 1BXZA 2K2WA 3AF2A 3CV3A 4CMCA 4LZJA 1E7WA 4CKXA 3UV3A 3LGSA 3P27A 2QIPA 1PS8A 2KB4A 1Y80A 3HDQA 5C8ZA 1DAOA 1L4YA 4D4JA 1AJEA 3HACA 4RDCA 3CUUA 3K1AA 3MD0A 3GT3A 2B5WA 3VR5H 5LYJB 2QRPA 3LFUA 4NBTA 4Q21A 1SQ6A 3ZDEA 4C0WA 3A31A 1WUHS 3UNNA 2Q3CA 3PE6A 2HKIA 5IZCA 2OSVA 4WZZA 3CUTA 4XH9B 3QLUA 1BMQA 4TKUB 2NZUG 2BFPA 1JDVA 2I55A 1ECGA 1HYQA 3IP8A 3JAWB 3PUZA 3U13A 2HPVA 2HTFA 3WIOA 5DV9A 5LIRA 3CR3C 3IP9A 4LECA 4MX8A 2XLCA 1I8TA 4E32A 1WZUA 2IL1A 2J3MA 3M6IA 1JA0A 4RQBA 4ENWA 5K6AC 5DM70 2XWSA 3X1WA 1E1KA 3QYPA 4E70A 1S01A 2V1XA 3FRJA 3KPJA 3VPSA 3VX3A 4DCTA 4ZI7A 1KS2A 1Z3IX 4UATA 1E62A 1XCOA 5JZ9A 1TAUA 4RF2A 1HRKA 1Z0ZA 4QRHA 1VRCA 2OP1A 2PSHA 2QTMA 4NE9A 2OAQ1 3P52A 5LQSA 5AVVA 4Q37A 4RBNA 1S8AA 2EOAA 3EARA 3KKKA 1DMZA 3C1TA 4O8ZA 4BO6A 3N1UA 1IY1A 1KZ9A 2Y0PA 3E9QA 3HCDA 3IAS1 4HH1A 5AW9A 3RTEA 4F5YA 5IVPA 4I50A 1DBVO 4G09A 1HQCA 5FFNA 4AICA 3GFSA 5E3HA 1HE4A 3TXYA 3CUSA 3WBFA 1YVUA 2EX1A 2CUTA 2KQUA 4Y2VA 4WLUA 3TEFA 4D8UA 1OIWA 2FEZA 1H8ED 5HRUA 1PW7A 3E9RA 1QF6A 1JFLA 2QP9X 3O90A 3DVLA 3LMKA 1GZ4A 4JVMA 4AJ9A 5FUBA 4ILEA 2GJ4A 4CJXA 2ZSEA 2UZAA 3GLGA 1ILEA 3L04A 5HZKA 4B71A 1D9XA 3TTUA 2JLVA 2SBTA 5EIWA 3HZZA 5D5QA 4XVHA 4RJTA 1ZAYA 1SD5A 1OXMA 3HL0A 1U8TA 3H99A 4O29A 2VDOB 3C4QA 4QBGB 3HA3A 3I8SA 4JB0A 3CKKA 1D0VA 1V26A 3KVOA 5EJMA 3VGJA 2J0QA 3R6WA 2BZ1A 1M75A 4OHBA 2OV1A 2OQVA 1T4BA 2QRQA 2WYUA 4LZLA 4OGGA 3GPBA 4TQ9A 3WV5A 1ZK1A 3IALA 5MGBA 3QY0A 1J25A 1JL3A 2GZDA 2QX6A 4C2UA 1LW6E 2O1SA 2YW2A 1R4AA 3FRHA 2D5LA 4DG5A 3ICOA 1BQ4A 2YBDA 5DHUA 3T9BA 2UZ1A 3KTAB 2FPLA 4P36A 3OE5A 4Q9DA 2NTJA 1NJ6A 1GL9B 1KVQA 1SOMA 2V0CA 4AJPA 1NVWQ 1CQIA 2NU7B 3PJGA 2P62A 1U31A 4BC0A 2MIIA 3NTQA 3KTDA 2IHJA 2AOUB 2JEYA 2VDPB 4E09A 4UTVA 1Z0DA 8MHTA 4EX6A 3VA4A 1EX6A 3JTMA 3TBFA 3L4JA 4RXUA 4GXTA 3G2QA 2ZB2A 2DCUA 4UEWA 3OLZA 3D1LA 2VZ8A 3N7UA 1MC5A 1QVAA 3FYCA 4MUHA 3K0FA 5CPBA 1RI5A 3DYIA 2YV5A 2IFTA 4K9RA 5DJOA 2FP4A 3OM9A 4XFKA 4AZTA 4DSZA 1PHRA 3QF4A 2EYQA 5A06A 3HFSA 4YQZA 4M8LA 4B7UA 3NWBA 4MW2A 1Y9ZA 4KG7A 4WD3A 1QGZA 1J21A 1T2VA 3EWAA 4XYEA 4BVLA 1B2RA 1JXMA 4IGAA 2WYHA 2VZEA 1T36B 1U6JA 1FHQA 1II9A 3Q0EA 5EGSA 2IX3A 2G67A 4X1KB 1TEXA 2F1RA 5M2QA 3N2NA 2N9UA 1SNYA 2L69A 2WB4A 3IOEA 4G0OA 4AJLA 4B6PA 2P0YA 3HJNA 5NULA 2GXUA 5FTKA 2CDBA 4B6JA 1IPEA 4B09A 2X4DA 3PRKE 2E37A 2WKWA 3FPJA 3HYCA 2OCDA 3R40A 3H6KA 1S4MA 1EX7A 1OTYA 4LMBA 1Z82A 1YU9A 1Z9BA 1IUKA 1XZLA 2PSEA 3A9SA 3Q2IA 1V8ZA 1O95A 3TR6A 1S6YA 1CQWA 3CUKA 4XYBA 1YDEA 1J0AA 1E96A 5DN6D 1PJLA 2W70A 4TTQA 3GXOA 4QOIA 2PUFA 1CNFA 4XR4A 3H11A 2A86A 1N7IA 3IVRA 4FR5A 4Q39A 5IP5A 5BN1A 4UXJA 2HYDA 2QTFA 4I1SA 1C4WA 3E81A 3LXXA 4GPD1 3BWXA 4HLNA 1EFKA 3K53A 4JL5A 3IJPA 4EELA 5AUOB 1Y34E 3AJEA 3IUMA 2PGOA 2PYIA 5CXQA 1FDTA 1YQQA 2B0JA 3GOHA 1VI6A 2O7NA 3IXMA 3KRTA 3L7NA 2QRLA 4LZNA 1AKYA 4KUHA 5KYXB 1P1CA 3ELSA 2WHQA 4MGEA 4BB6A 3OZSA 4XEHA 1BX3A 3VKWA 3HLKA 1K08A 2P35A 1JKJA 4M9UA 2IJGX 1Y8RB 4HRXA 2DSNA 4DCSA 2ABWA 2V45A 4XB1A 3VKUA 1LI4A 2LZ0A 3WMEA 1QK4A 2IEZA 1Q20A 1RC0A 3DPUA 4J2HA 1PWEA 3M2PA 1KF0A 2UXCB 1PTJA 2P41A 4ZZ1A 3WXBA 3VI3B 1Z37A 3G9QA 4XLTA 2HBZA 1PO7A 1CF2O 3HEBA 3WB9A 1IE3A 3NBAA 5EXXA 1ZMBA 3HKDB 1T1JA 4ARBA 4UFPA 2WIAA 3D8NA 1MO4A 3K5HA 1XNGA 4E5KA 3EEOA 4INZA 3BK7A 1WP9A 3C3YA 4YCBA 2ZB8A 1EUQA 1WXWA 2GYUA 1HPLA 4EUNA 5I9BA 5KTMA 3PRYA 4AJNA 4PLPA 3GRUA 3MCWA 4KVZA 4R1OA 4WJKB 1CIJA 2L42A 3NEPX 4IR7A 4JBYA 4EHLA 4J2TA 4X8HA 4M0PA 2AK3A 1JFFB 1HLGA 1N2HA 1W0JA 3EEQA 2K4MA 3EJWA 3H04A 1YNOA 1M76A 2JCXA 2ORYA 3QEJA 4N7JA 4BKMA 4MTLA 4BNYA 2WAMA 3ZWCA 3ETCA 1T5OA 5HIIA 3WGUA 3F1KA 2PWYA 1CR2A 1ZPDA 4UE3S 1QE3A 3QV2A 3VGPA 2GH1A 5G4LA 1HFEL 1GOTA 4NATA 3JSAA 4G81A 2WWXA 3PHGA 4EX7A 2Q0HA 1AQUA 4I5FA 4IGEA 3UGKA 1YB2A 1IN4A 4BVBA 1LPNA 4LV6A 1K88A 4WXEA 1SVMA 4G0YA 2HCBA 1FYVA 3IAM6 4V0QA 4YJ2B 2IXBA 4YV2A 4YMGA 3A1TA 3HHEA 1I7SB 2VNHA 4PQGA 4S1VA 1WCIA 4V0LA 4Y7CA 2VWGA 3IKTA 3HCWA 2NP6A 3FLMA 1K86A 4KOAA 4MINA 4WK4B 2C2YA 2JGJA 2ZRCA 3MGAA 2BGMA 3EGDB 3QI2A 4LXHA 5KQRA 2NO4A 1ZUHA 4ANFA 2C9CA 3ZK7A 2VAXA 1O5OA 2RSLA 3NT5A 2G9RA 1J07A 4D80A 1DHRA 3GDGA 5I7FA 3KB6A 4IIBA 4NU6A 2C8LA 2FTKE 1BC5A 1RLUA 3OTOB 4TTAA 1VLZA 3BTVA 3HXPA 4LOKA 4KQ6A 3T94A 4DRXB 1XD8A 1BAPA 3NEYA 2H4XA 3Q72A 3OIDA 4X24A 2I99A 2AW5A 2G71A 1KHTA 3BHNA 1OWNA 4LPSA 3SNHA 5REQB 1F6WA 4I4NA 2H2IA 5GGXA 2WKRA 3RHZA 4D0SA 1RJGA 3P0JA 1U98A 3AMVA 5CGQB 3UTDA 4DV1B 3RBXA 3LC7O 1JHPA 1LU9A 3GV0A 2V03A 4G1FA 2UXBB 4X9XA 2BHNA 2Y93A 4BLWA 3OCYA 1U90A 4MW6A 1ISRA 3D8BA 2VT7A 1JEDA 4X90A 2FW1A 3IQFA 3M3PA 1MBZA 1LRJA 2H1WA 3TG8A 2PO5A 2P5SA 2WWVD 3ZGVA 4ZCTA 1UAYA 4WNCA 3GVHA 4BQOA 1QGUA 3S8MA 1ZOQA 5LNK1 4H27A 4BAGA 1NUSA 1T24A 1YI8A 1A5SB 1FNNA 2Q7XA 3LUAA 4TTRA 1D1TA 4NFHA 4QM6A 2YDYA 2WUEA 1L5VA 1TYDE 1JSXA 3GLHE 4FOTA 4YJGA 2JIZA 5ISMA 2ATEA 3STUA 2CNWA 2XOKD 1IPFA 1DZIA 2NZYA 5BRNA 5AUPB 3RIHA 2ZKIA 3JQ7A 1M2WA 3LW7A 4X7PA 5LLDA 4FDLA 1LY1A 1P2DA 4Y1FA 3GJRA 1U2DC 2PZ8A 1DCKA 3F78A 3KJIA 4K6KA 4ZO4A 4A26A 4C6RA 4RETA 2X0KA 3LS2A 3ZY4A 3RC2A 4ZHSA 4G4SP 1MQSA 4Q4JA 5KCZA 2FA9A 1LBHA 5C9ZA 2EW1A 2GWHA 4N3AA 3DKPA 2SHKA 4R5HA 5K3SA 1CUFA 3DPIA 1P77A 4OJYA 1OV6A 4UTZA 2Q9AA 3WLFA 1B6GA 4ARZA 4I6GA 4HYTA 3F8WA 1J0EA 3ETJA 4ZOLF 1BHQ1 2O7SA 2SKDA 5GY7A 3RVMA 2XVZA 3PQCA 1DUIA 2FPKA 3EULA 1JHYA 4I9FA 4PWZA 3S99A 3VXKA 2RGGA 3VO1A 3EA0A 4G23A 4HBZA 4JJGA 2SKEA 5EIHA 2QMUA 4D4MA 3GGOA 4EF6A 1TU0A 1W7AA 2DBQA 6REQB 1QC5A 2QRNA 2QD1A 2QQGA 4HNGA 1FQWA 2TRSB 4FFNA 1DQRA 1UQRA 4MW7A 1RYHA 5FBWB 3ZGXA 2J3EA 4J8PA 1AIPA 2FMFA 5EG5A 4LFCB 5AVYA 2WQZA 1MAUA 1M10A 3GRRA 3OAAD 3K9WA 4UFNA 4BNFA 5TB5A 1P19A 2V97A 1IXZA 4F38A 1W6RA 5KAPA 5L7YA 4LF7B 4CKEB 3FZQA 4BB5A 1D7OA 4KLAA 3WQHA 1L4KA 5DBIA 5CB6A 5F23A 5JRZA 2P65A 1JU4A 4FZ3A 1PSDA 4OQYA 2C77A 3JWJA 5EXTA 4D6YA 3KSRA 3ZQKA 1J8VA 3ITDA 1H05A 4FD3A 1DIHA 4OQPA 4QTYA 4D25A 4EG0A 2RCNA 3ETHA 3TOXA 2DUUA 3BSYA 3EGXA 3PUKA 4D74A 1Y1RA 2ZR0A 4KQFA 1VZ3A 3SDZA 4TV8A 2FEMA 4IIFA 4O4JA 4I4LA 4UVGA 4RSHA 4QELA 5H59A 1AN0A 4HNUA 4C88A 3WLSA 4JGBA 4TLAA 4WK6A 2PX6A 3WDMA 1UFQA 1DKQA 2EZUA 5JQGA 4IDEA 2P2LA 1J2JA 2XWJI 2Q99A 4B6RA 1Z74A 3MMSA 2BM0A 4CL3A 2QMYA 3U4MA 2VT2A 1PDWA 5CMLA 2VQFB 2A9VA 2PKRA 3IDQA 1D7AA 3A1CA 5BWLA 4RTKA 4F96A 1A8UA 1N5IA 4Q3KA 2O3SA 3OJWA 2ENUA 2V5VA 4FDVA 3I9JA 3LNTA 2ACWA 1XRMA 4YA6A 2YTZA 3IVGA 4JP8A 1H2WA 2PIDA 4DVJA 1QFYA 1B3BA 3K1TA 3P45A 4NONA 1LUAA 2IP2A 2RHBA 5ARCA 1KDVA 1I14A 1FJGB 1Z2NX 3DM5A 1GR0A 1T3SA 1CE8B 1SURA 4M0DA 4UDYX 4OQDA 5FBHA 3OSUA 1EH5A 4GWKA 3M9XA 2O2CA 5KMGA 1B15A 3JQCA 1CWUA 4GI2A 1YK1A 2QKYA 1W8DA 4BATA 5BVGB 3PJRA 2XXAB 1DRVA 1V4BA 4M98A 4HFRA 3WKEA 5BWBA 1P7YA 3CMMA 5T67A 5KVVA 3GRKA 2PL3A 1Y6JA 3JALA 3ADDA 4TV9B 1FLVA 3EDMA 1L7RA 1QLWA 1G6GA 1ZQ9A 2TMYA 2VH5R 5G4KA 2MCFA 4DIFA 1L4NA 5H68A 2FPGA 4CLRA 2Z56A 5HTKA 3VPYA 3R0JA 4FXPA 5EJFA 4OHZA 3SKXA 1R3DA 4LYFA 1X7XB 2H4YA 4DBLE 4EY5A 5GIOE 2QBYA 3EUFA 3ZWMA 5C32A 5K3OA 1V1RA 3PEFA 4RPLA 2IPAB 4FD2A 2PD6A 4ZVTA 3PHLA 3H8WA 5IVDA 4O3FA 4JX8A 4FM9A 3VZDA 3SMQA 3TPZA 8GPBA 3A25A 4C89A 2X40A 1NN3A 2IYVA 1Z4IA 2ZQYA 1RZRA 4F9GA 4W63A 2JJ1A 3C3MA 4UAVA 5EXPA 1E2JA 1OH8A 2QAIA 3A3PA 4ZI7F 1QTIA 1D4OA 1X7ZA 2QU7A 2I9PA 1TRKA 3K96A 4NLLA 5JFGA 1FSFA 2B7CA 2WUGA 4CM8B 1DG1G 4HB2A 1RRMA 5BNIA 2HA5A 1OWLA 4BO4A 1K7YA 5AXAA 1ZUD1 4FDUA 1G20E 2ZYTX 1KAOA 3BQMB 1SHKA 5D5PA 2YOGA 1H8HD 1QIGA 2VPPA 3D5EA 4LQLA 2FE4A 2IPOA 4K6FA 3VR4D 2PBZA 4DYDA 3O4IA 4ON9A 1YU6A 4C22A 3N0WA 1UOPA 2O2IA 2VJNA 2LCFA 4UREA 1T1GA 2FPMA 3PITA 1S2DA 2YZ2A 5D85A 5F77A 3UJHA 2I1WA 3IVCA 1YRLA 1HC7A 4YMHA 1WZNA 4QO7A 3V97A 5G02A 4E3WA 2X0EA 2FZEA 3JQ8B 2XKKA 4EI2A 1E0AA 2ZIUB 2H48A 1J8DA 1KOJA 2C2ZA 1ORVA 3EGOA 5EVCA 3KNZA 5K1ZA 3WGOA 1LA2A 2DHDA 3ZCXA 2GEJA 1WDKA 1NR7A 3JW8A 1JW9B 3UC9A 2Z8XA 3KPVA 3THRA 4Z7OB 2Y05A 1DBQA 2QD3A 4AZWA 1QWSA 4FGKA 3IEPA 1EAYA 1G19A 1M1YA 4DCNA 1J56A 1WW3A 1NN0A 3FPGA 3MYRA 4LDPA 3IJEB 2RGUA 5EE5B 4E1BA 2Y76A 2EFCB 3NBMA 3RS8A 1QS0A 4MDEA 1O94C 3D6NB 4I36A 5IJ0A 1NBOA 4IIHA 2H5EA 4L8LA 4C5AA 3H7AA 2QM0A 4PYNA 3RSCA 1E60A 4D9BA 4RTQA 1GTG1 4M7RA 1CNEA 2AYZA 4S2UA 2QUJA 1CEXA 4EYQA 5J23A 3EXG1 1JDZA 2IYLD 1D6NA 1TCCA 2HA0A 1T91A 4M83A 1V7ZA 5EINA 2BDUA 3STXA 1AU9A 1MTOA 2GZMA 3GZNA 1Z26A 2R8XA 1K1EA 2YJ6A 4YK7A 5BVIA 1PZFA 4EVRA 1E4VA 5BQOA 4Y6OA 3U16A 1TUGA 1CRZA 1YACA 1A3CA 5JSKA 4R8KA 1M6VA 1KY5A 1T9ZA 2XUJA 2Z9CA 3CZ4A 3GYGA 4JR1A 5DWVA 3F1LA 2JF0A 1KSJA 4CI9A 5IJWA 1CUAA 1GZHB 3M70A 2R79A 2X77A 3KAQA 2NZVG 3QBEA 1S3GA 2ZROA 5IK2D 1K27A 3L8ZA 4PTYA 3VUFA 5IXJA 1Y8ZA 3HKBA 1A9RA 2L82A 1MO2A 1VCIA 2ZJAA 3TUJC 1FDWA 1QCDA 5ALVA 4AJIA 2HJWA 5CD1A 3KPYA 5L6LB 5CVUA 4P32A 5BV7A 2XGOA 5DISB 5JXHA 5HYVA 2WHEA 3ECAA 5T4BA 3TAXA 3WNDA 1P7ZA 5F2EA 1S02A 1P7CA 1ZCJA 3L6OO 3JZAA 5BN3A 4JH0A 4QA9A 2A59A 2Q28A 4KK3A 3V2UA 2QTWB 4LXTA 4KO8A 5EN4A 1KWGA 4KH1A 4Y2YA 3QKSB 3NI2A 2BN4A 4AK9A 5G2OA 2JD2A 2KJQA 3FI0A 4MYRA 4RJIA 1QCZA 2JIOA 3RU9A 1ULTA 3OM1A 1ZD2P 3T1VA 2QUHA 1X7GA 3O9MA 5J5VA 3AP2A 3V4SA 5A0FA 4PCUA 1PG2A 4K88A 1L8XA 2MSWA 3R0IA 2ACEA 4JIWD 5B1HA 4CU5A 4E7OA 4DS3A 1ZG3A 3ZH2A 5FWYB 2H51A 4UHDA 3DTVA 3WX0A 4RXTA 1IOLA 1EHYA 5K03A 2O8NA 1ZMTA 1DAFA 4DMGA 4OXNA 3SVZA 3G1WA 3EZ6A 3FMGA 1PR4A 2YICA 4WNAA 3UG6A 3JR3A 3YASA 2QX9A 3KU4A 4NI5A 2Z95A 1P33A 2Y2VA 3EIOA 3QKRA 4WASA 3X2FA 1AVTA 1RXCA 3L3BA 5DM1A 4I9UA 1JIIA 2JL1A 1QIHA 1R0BA 3LUJA 4RPHA 1WPXA 3L0OA 3AC0A 1P0CA 1RHKA 3WK7A 3LCRA 4R6WA 2AD1A 2AG8A 3IL2A 5E8JA 1FSPA 4IBOA 2PS3A 3RARA 5AJHA 4R4JA 4DQUA 1FFAA 1QE5A 2RHTA 5H7XA 2J9YB 2ZSBA 3UT5A 1KYXA 4TWRA 1OBFO 1OD6A 1G8KA 1PGJA 4LCBA 2PWAA 3TNJA 3BEOA 1M5TA 3Q9UA 4EK9A 3O4RA 3QY9A 1NHGA 2ZYRA 3OF2A 5E7MA 4I14A 3BB3A 2I1LA 1UK7A 2IIQA 5HF6A 4DQ0A 5CCBA 4PC1A 1J2UA 3EQ7A 4Z8XA 4DEXA 1QYXA 1TCVA 2P9GA 1Z08A 2X0RA 3ENVA 4IOJA 4MDFA 1HKUA 4BMSA 1QK3A 1OZAA 3AVOA 4IHJA 3UT0A 4F04A 1VPVA 3JQ9A 1HH4A 1LPAB 2MYTA 4Q00A 5BSUA 4JU8A 4RKWA 3SIPA 1E59A 1GSAA 1OAOC 4MWEA 4GLJA 3VHQA 4ECAA 1EWQA 1Y6QA 5THXA 4CM9A 4HTFB 3KJQA 3VPXA 1ZIDA 1IQUA 2FJUA 2P3SA 3H2JA 2FSVC 3H8VA 2LCIA 3KVRA 3LCVB 3QFSA 4LY6A 3I5UA 5AVTA 2QLLA 1QKIA 3DKIA 1M34B 2B78A 2P4EA 3D6AA 3KKOA 3O8OA 3RIXA 2IWRA 1N4DA 1QO0D 1YHYA 4J1NA 6ADHA 1LK7A 3AR6A 1QTNA 2O3QA 4EGCB 4EJSA 1X86B 2J6CA 3CF4G 1T26A 5ESWA 1DP4A 1H23A 2RK4A 3IIIA 3LA8A 2FSHA 3NAQA 4NBLA 4AIRA 5CDFE 1FL9A 4J0DA 2WUFA 4JOCA 1C0PA 5HJ5A 4J0KA 1TQDA 1NQOA 1SVKA 4C4RA 3AFNA 1G2PA 1I01A 1T9CA 2ZATA 4L27A 5FTNA 4ALLA 1PFKA 4RHTA 3TG2A 3U7RA 2HFJA 2FAXA 3M34A 1VSQA 1J9ZA 2JIBA 4FDTA 1XNQB 2Q2WA 1WB9A 2BY4A 2WWIA 3NHPA 3L02A 3RSSA 2WJ6A 2PUDA 3LUBA 3L8EA 3WRVA 2X14A 2ZUTA 4QKQA 1KI9A 3QUTA 3IAAA 1LLCA 1NVVR 3HL4A 3H2GA 4B32A 2X5OA 3I64A 3BHIA 2VOJA 5U1PA 5DCWA 5KNCA 2FGJA 2G70A 4HLCA 2R7KA 2ZVPX 1A82A 4DBVO 1H42A 3G9ZA 3NC1C 4P38A 6Q21A 2LBPA 3JYQA 4E7PA 2QN9A 2ZYGA 1K6MA 3IEUA 3AKDA 2YINC 1XF1A 2OBFA 1KHUA 4FLMA 4IDOA 2QA5A 1OVMA 4NOLA 3N0TA 3E2IA 4A4DA 5E0KB 4JUCA 4E88A 3KQPA 3IRVA 1SMKA 2Z8YM 1GRVA 2HXSA 5TPWA 5JCXA 4EGQA 2QP4A 4ER3A 4GLBA 3CEHA 4WT7A 4AU1A 4LYYA 2XZTA 1A8SA 1QWTA 1WA5A 3V6LA 4EYSA 5LDDC 2COEA 3C1UA 2AXNA 2Z2YA 5BWOA 1Z18A 4H1TA 5IF3A 2VDRB 2EF0A 4DC0A 3WICA 4DGQA 3D3QA 1KL7A 3MQFA 4EMTA 3FVRA 3H5TA 2JGAA 3ZBUA 2CBXA 2HX1A 1OI4A 2VHVA 1R8XA 2W2KA 4Q66C 4Y6SA 3TX2A 4S0XA 3VYUB 3NU1A 2I6XA 2PLNA 2WJHA 3C3EA 4D3ZA 2NNWB 2P8JA 1Q7TA 2ECKA 4PLTA 4A0RA 1PJSA 3CCBA 4IXNA 4M7OA 4HDNB 2JFQA 2YFQA 4L3WA 4NHOA 4A2PA 1UZAA 3HCRA 2FPRA 1CRWG 3G0BA 1XZQA 1IY2A 2FWAA 3USCS 3RBVA 4FR0A 4DR2B 2QTGA 4XQ0A 3K6KA 4IRUB 2C4MA 2C4WA 2QVGA 2ZBVA 1RT9A 1YJCA 2VFAA 3KL4A 1QQAA 2Z3WA 1U2SA 1UM8A 4O33A 1LQUA 3DL4A 1LK0A 1L8OA 4ZVUA 3L0PA 2P7IA 1PEDA 1F9EA 1F4LA 1GGVA 2CCGA 1WPRA 1ZN2A 2J9GA 2JFZA 2OL4A 1XZ8A 2VO1A 3FPHA 4HDSB 2AOXA 5DSTA 4IMRA 5HX7A 1E1NA 1XCMA 2QRJA 3EZ2A 4AF6A 4L95C 2QTVB 2XXJA 3PQEA 1L5HA 3HDHA 1MEEA 1WWKA 4MRNA 1SU7A 3I6BA 3TEJA 1KK1A 2FQQA 2EAUA 4KU4A 3SG0A 2XNDA 1WVMA 2I7TA 5KVAA 2F62A 1F0YA 1MJGA 3FNIA 5LZ9A 3DZDA 4CNQA 1LLQA 1YJ8A 2ZSJA 2TS1A 1NJ2A 3LUGA 4RELA 1U4NA 4NOJA 1E5QA 1BH2A 1H4TA 2ZUSA 1Z6XA 3LQFA 3N2LA 4FHEA 4ER6A 3I45A 2VUSA 1KO8A 3S2FA 3KQNA 1CV2A 3WB1A 3KKNA 3NONA 3VSEA 2DETA 1AGNA 1IPHA 5EUCA 1AXEA 2C54A 2PBLA 2VUIB 3KFXA 4ZOEA 5AK0A 2I3DA 4FXOA 4K7JA 5G0TA 1R37A 3GZTB 2AN9A 5HJEA 4DV7B 5ITSA 1RWWA 4OSEA 2GXSA 1OFIA 5FX2A 1YTUA 4ZVLA 4X8OA 2I65A 5L3SB 2I4LA 2O8DB 4JCCA 2XUOA 4FFBB 2AVDA 4D9NA 3A2LA 2WWRA 4EW2A 5LA6A 3TLMA 3CMCO 4AY4A 4YREA 3TNFA 2A9JA 1E8NA 1R6XA 4YV1A 1U7PA 2XZPA 5KAMA 3ODGA 3OPQA 1YCFA 2W8BB 3H5LA 3HWSA 4IL5A 3A9CA 1TVCA 3DULA 2P7HA 5DIFA 2XUDA 2VPXA 1KEWA 4UCFA 5HFAA 4QUIA 3X43A 3D1VA 4PRLA 3TZCA 3PJFA 1V5FA 3HE3A 4JENA 2MYNA 1ACMA 4D9EA 2LGJA 3UENA 3QPCA 4Y2HA 5EEGA 2PS1A 4JEUA 1TZMA 3I73A 4JVNA 3R5HA 4QVGA 2UUCB 2NO7A 4GPAA 1KS9A 1NTRA 1UBOS 1QHFA 3O1LA 5E8RA 4RLHA 4TXNA 3D3EA 1LBTA 5EPUA 3MJEA 3BIFA 1N5OX 1T0HB 2OT3B 4K86A 4LQDA 3A37A 5LOVF 2J67A 2A5FA 4BASA 1J2EA 3LQRA 3VNBA 3OZRA 2XWQA 5KS2A 3OICA 3DDNA 1C7IA 3RUPA 2JAQA 1BD3A 4R8SA 3RAFC 3KYCB 1L5FA 4JVOA 4QATA 2Y8EA 2HGSA 3DITA 5JQGF 1E9SA 4FHZA 2X2PA 3KFVA 3QFRA 4BN0A 2ZRJA 1TUBB 1Q0ZA 2YWFA 1LV8A 1KFCB 2CF6A 2Z1DA 4FW8A 3JQGA 2CW5A 2VAVA 4RVNA 4WBNA 3GRYA 1IEWA 4LYGA 3AW8A 3LDUA 4QQKA 3ZK8A 4CN9A 4C3OB 1JHOA 2BI7A 1A8PA 3IO3A 1RVV1 2ZQZA 4KZKA 5JSZA 4DABA 4NCHA 3P0HA 4YX9A 1CZKA 2XYQA 5DGCA 1VI5A 1JR4A 4FMPA 4UXHA 3V4LA 4ICIA 1Q7GA 1UH5A 1E2HA 2GPTA 4N7MA 4JL6A 1P17A 1GNTA 1YFZA 2WSIA 2PGXA 2ZJ5A 3FKJA 3H19A 1CIPA 4ZQEA 3KG2A 5DBGA 3T61A 3KOMA 4AS2A 5JD3A 2R6FA 3G0OA 4POOA 2BMJA 4Z9YA 4G0QA 1B93A 1IK4A 1G0NA 2ZETA 5ALRA 5HKAA 4D5EA 2XCRB 4CKYA 2GCPA 4PEVA 4BO9A 4PVDA 4TYPA 3DZJA 2VWQA 1GLGA 4HWPA 5E95A 1W5EA 3Q0IA 2BZ0A 3R6DA 4U9IS 3HFJA 4ZI7B 5B6JA 3R4VA 5E7JA 3RI3A 2RJOA 3OO0A 1ND5A 4ESVA 3FOBA 5C0OE 2PNFA 1K89A 2BCJQ 5JEJA 2FWMX 1GSIA 3X44A 3O7WA 4L9RA 1PGQA 3ZJTA 4BJ5A 1E2KA 4HDMA 2H8GA 1K3JA 2W8ZA 3N86A 2Y1KA 2KLBA 2ZUEA 3CJTA 2GD0A 2NADA 4UVIA 4I50B 4R1QA 3KCQA 1EFUA 4ZC1A 1LB1B 3T9CA 3GDWA 4AN0A 4MKXA 3GJ5A 4XVRA 5T4EA 3T06B 4P81A 1Q0TA 4QODA 2YC4C 3E1GA 1DKLA 3WK4A 3TTSA 2QL5A 3EZFA 1E18A 1VPEA 1RRVA 3MOGA 1FJ2A 2CLDX 2A9KA 5BURA 4GZMA 5B55A 4YXWD 1YONA 2FJPA 1VHQA 2PFGA 1GIAA 3NOOA 3ZW8A 2FMKA 2W6ZA 1Z62A 3H2ZA 1GD1O 1SRRA 3KOZA 4XLLA 2LV8A 3N2ZB 1ZH2A 4GI7A 3OMXA 4J07A 3DDZX 3GLGB 1X42A 4X6LA 3W3AH 3T5MA 5JEOA 4BNGA 2J59A 4R05A 4YRQA 2LKCA 1TLLA 5BW4A 1WLNA 4AMUA 3OIWA 4A03A 4F2DA 1DV1A 2VPZA 3A0RB 4B33A 5EJ7A 3OLCX 1TI7A 3R6LA 1IZ0A 2RFLA 3NR2A 5JWRA 1OIVA 4DE5A 1U80A 1IMOA 4DQDA 1H1DA 2HJGA 5KTKA 4NEGA 1TCAA 2YS6A 4JONA 1FUEA 3CY6A 1CG6A 2GN2A 4EL5A 1JSLA 4DYVA 1J4PA 5KKAA 5EZ6B 5H70A 4JYBA 5CP8A 4OMUA 1H2HA 3SSOA 3DAHA 2IH4A 1YUNA 3BWCA 2PKCA 3KR1A 4JP2A 3S1AA 1U3TA 1VSBA 1FFBA 1XKQA 3NORA 5ALWA 4F9EA 3B6JA 2UZ1B 5C5DA 4PYLA 3INNA 1ZM7A 2JB9A 4RTNA 4BEWA 4IGFA 4QT0A 4MUEA 5GVSA 4RJKA 3U39A 1Y0BA 2ZJ8A 3WWEA 4LJSA 3QYAA 1D6SA 1G7SA 2WDPA 4WN9A 2D1QA 4PPFA 3TVDA 5F5XA 1UWCA 4B5KA 1GGFA 3DOEA 3FGOA 2H7CA 1G8HA 3ASVA 1T6YA 4I8DA 4NDZA 5TDHA 3WSWA 3WWPA 3K0FB 4GNKA 4EKDA 4F5EA 1O4VA 2ZYWX 3X2SA 1ZOLA 1IHXA 2ZSIA 3RTGA 4ZVOA 2UAGA 2EFYA 4R54A 1ITZA 2J7PA 3KJZA 1EVQA 3QF4B 1RTTA 3EXG2 1LF0A 1U8YA 1R0SA 4HOYA 1WW8A 4XDZA 5DRYA 1KDYA 5KYYA 5DGDA 3QW2A 1SHZA 5SY4A 2N0SA 4AJHA 1FFEA 3HWX1 3W06A 5CFLA 3TTVA 1NY6A 4U0KA 2ACKA 3RQIA 1CZNA 1GXSA 4N4AA 5K0GA 3TR0A 1A69A 1WMFA 3SLKA 5C53B 1WTAA 4RTSA 3KKZA 1A88A 3O9ZA 4PICA 4Q9LA 1Z63A 1UWKA 1C0KA 1FZQA 3M1AA 4G25A 1RW4A 4TOIA 3EX7C 4ERXA 4I5GA 2G28A 3LCMA 2FEPA 5JZOA 2BDTA 3F5DA 1E0SA 2POQX 5CLHA 3ANSA 3PXDA 1K4MA 1NASA 3ZCVA 1FTSA 1I7DA 3LH5A 5KO2A 2Q2VA 4YAIA 4O2BF 3D3JA 3A4MA 1T4DA 1U3CA 1CZUA 3R7NA 1TTQB 4DLBA 3IAM1 3LDAA 4GOKA 4DNXA 1QG2A 5CBKA 2FHPA 3GAFA 4KUGA 1BRTA 1QZ3A 2XRZA 3CZRA 3S8EA 3T7JA 4HUTA 2A57A 3GBSA 1ZXBA 3H11B 1ZGJA 3ANMA 1SVWA 1XBTA 2CL7X 3IBCA 3G5AA