2I2BA

Crystal structure of lmnadk1 from listeria monocytogenes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 69
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2bA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2bA01
2QV7A 2I2DA 3V8NA 3V8MA 5EJHA 3V8QA 5DHSA 3VZCA 4HAOA 2I29A 5EJGA 2I2BA 5DHRA 1SUWA 5EJFA 3S40A 1Z0UA 4WRRA 5DHPA 2JGRA 5DHQA 2I2FA 2BONA 4DY6A 2I2CA 3V80A 2Q5FA 1YT5A 3V7UA 5EJIA 2I1WA 1Z0SA 2AN1A 3T5PA 3PFNA 4WERA 4V24A 1U0RA 5DHUA 1U0TA 3V8PA 1Y3IA 3AFOA 2P1RA 1Y3HA 4L02A 1Z0ZA 3V8RA 3V7YA 3VZBA 3VZDA 5DHTA 2I2AA 2QVLA 3V7WA
chains in the Genus database with same CATH superfamily
1D1PA 5HFJA 1DDOA 2H57A 2JH8A 3PQ6A 3V8MA 4XX0A 3CXUA 4YFYA 4EZIA 4Y6GB 1C4KA 1SXPA 4LC9A 1GQRA 2ERYA 4RX1A 3OU7A 1P1FA 3C8MA 1Y89A 4KMOA 3DWFA 1OYVA 2PQMA 3D6NB 5BQ3A 3FKSD 3JQGB 2Q6IA 4PRKA 4BQNA 1J99A 4BJ1A 4F8YA 5JPDA 1T10A 4HB4A 3BORA 5DGDA 1WNTA 2VWHA 3H5TA 1OC4A 1US8B 1YK1A 3QM1A 4PHHA 1NVWQ 4WCFA 1Y3IA 4A2PA 4F11A 4JSRA 4CF4A 1J2UA 2JL1A 2VUUA 4UTZA 3E8SA 1J90A 2BEVB 2NQTA 4IIBA 5BSGA 2ZYWX 3FWPA 4A0FA 5JCPA 4ZCQA 3BA1A 3DZBA 5HA5A 2QVZX 1YQQA 1FFWA 2Z2IA 4AICA 2WAYA 1S4QA 3K30A 2IU0A 4D2IA 4XYEA 3F5SA 1YI0A 2JIRA 3IBFA 4NYJQ 3ZNNA 2HT1A 2WINI 3C3JA 1U98A 4UXIA 1GM5A 1BN7A 3QUTA 1O6ZA 3X1JA 2TECE 4CF7A 4QSMA 1Y3DE 3UMYA 1TJ4A 2MYPA 1DT3A 3UV0A 1UINA 2QQ0A 4BDSA 4ER0A 2CK3D 1DEHA 4U7FA 4LJSA 4QPJC 5E1BA 3SSAA 2QOEA 5H0IA 4F4IA 4L0QA 4ZAFA 5GVSA 2IELA 2GFHA 4UHHA 3V8BA 3TO5A 5JVDA 1YS6A 3MWKA 4IJWA 4WVFA 4Y2QA 3OZEA 3RYIA 3S44A 2TMYA 5K3AA 5DMHA 2MWMA 3QJ5A 3DKVA 4BO3A 4PCVA 5HGXA 3W5CA 3SDSA 3AHEA 4FLFA 3HXTA 2YWXA 4C01A 4CVNA 1VIDA 2HQOA 3KSUA 5JH7A 2X4DA 3ORFA 1PFKA 4EB3A 5A1TA 3ZDRA 5JS7A 2G3YA 3ROTA 3DCNA 2GZRA 3PENA 4NL4H 5JE8A 2P75A 4GQAA 1KL7A 1VI2A 4I7EA 1JH8A 2WJHA 1K5HA 3OHSX 1X2EA 1HFWA 2NPIA 3H9GA 4XQ9A 2UZ1A 5EJEA 1VE6A 2H48A 3EZGA 4RLSA 3PVSA 4ARSA 2QIOA 1YI1A 3H2SA 3QWFA 1EM6A 1JDNA 1EHCA 1ONBA 4MLDA 3LYUA 1BU8A 4JR1A 1H2XA 2V7UA 4OJYA 4AIIA 3L0OA 5D7NA 4DHWA 4BNXA 5CAEA 5ARCA 2JBAB 2VHEA 1FDTA 1ACLA 1GQQA 1X7ZB 1ZOOA 4YCDA 2COKA 4ZKEA 3IKJA 4DV1B 3AF5A 1P44A 4MCIA 4AP5A 5ILOA 5AVJA 2ZAOA 1E9BA 1T8WA 1N3IA 1KI6B 3EGDA 3NGLA 4HATA 1T34A 4MQMA 3ROXA 3WA7A 2CFCA 2DQSA 3FCEA 2B94A 3FVWA 2NPFA 2JAPA 2OGUA 3HCPA 2ZB7A 3QQPA 3DEKA 4QVIA 4FFLA 2DUJA 1WR8A 2XE8A 2Q9UA 2GD0A 2SCUB 3GT7A 1X77A 3X2EA 2P9EA 3CLRD 1XZLA 4OBEA 2E2WA 3U1VA 2GEVA 2YS7A 1H6BA 1VG8A 5BXYA 4CKWA 3FPJA 1ZM9A 1J33A 1EVEA 1IPFA 2I3DA 3C6KA 3DAOA 3OUTA 3HU5A 3BH6A 4UU0A 2HRZA 2ZFUA 1VFNA 4X7MA 2UYCA 1G1AA 2WWTA 5LNK6 2WU8A 3G7SA 3UKJA 2G25A 3IUBA 5BQXA 5L4LA 4FDMA 2QGZA 5CDFE 1CLEA 2Y66A 2EW2A 1JB9A 4HMPA 2AN3A 1AV6A 3OMXA 4GVLA 3CVOA 4QBHA 2O1XA 1O8CA 1SD5A 1LUAA 1UWCA 3E82A 4U1RA 2HBRA 4QYIB 5WRFA 4D44A 4AKIA 4TTIA 1OI3A 1QSGA 1WA5A 2IYVA 2RK6A 3FPAA 2PMEA 3V3KA 3PGLA 3VHXB 1DRWA 2F59A 2Y1XA 3SPXA 3KUDA 2CBXA 3JQ8A 4IHAA 4NJEB 3VH4A 4NV1A 3DT6A 3E58A 1IPEA 3FD8A 3PDWA 4BNKA 4JIVD 4QO7A 3UPTA 3N2GA 1WMFA 2IYAA 2WTXA 4LISA 4DABA 2XYQA 1XZQA 4RK6A 2UZ0A 3L9XA 4N76A 3CLKA 3PNOA 1E9FA 3V1UA 3NHYA 5F7XA 2OXTA 2KYRA 5I9BA 4UBKA 4FFSA 2VLBA 3ZLJA 2C4NA 4NS1A 3O4JA 1RPJA 3C7TA 4MYTA 3OQ6A 1Z3CA 4IOJA 2QUZA 4I4CA 4V0ME 1YGPA 1ONPA 1J0XO 1WMDA 2PKQO 4M3NA 1TRKA 4X44A 5DU2A 5SZHB 3VC3A 3KT8A 2WYOA 3GAZA 3RARA 3PL5A 2ZBQA 2EDAA 1LQTA 2F8MA 3D31A 4B2IA 5EQJB 2O57A 1QPBA 2C8JA 4OFXA 4TZ6A 4JI6B 4P84A 4R9NA 5MGNA 2O20A 2I2AA 2HU5A 2CCGA 2O3QA 3C48A 3FRIA 3I9NA 5EGSA 4KVAA 1H2EA 4PVCA 4DDTA 2Q3JA 1NF2A 2QYSA 4IVPA 1EH5A 4XDYA 5A4IS 5DNEA 2JAWA 3DO5A 4NARA 5H4HA 4IKPA 1E5XA 3AQ4A 2HRBA 1TFRA 4F93B 1CJVC 2A0KA 4TT8A 1DOZA 3LWBA 4R5MA 4TWAA 3P0IA 5DI9A 5DP1A 3S70A 4DDWA 2FFHA 3RH0A 5CA0F 3QFTA 3IS3A 1UCFA 2YV5A 1FUYB 1N6HA 1NMZA 4RFLA 4YRJA 4ZVRA 4ARZB 2ZE7A 3MBOA 4QOSA 1OWPA 1WXHA 1C1YA 2FZLA 3G0IA 2CHQA 4NU5A 5SY6A 2W00A 2HJVA 3WZ2A 3KVOA 3QX3A 1ODCA 2RMKA 4RJ2A 2FJ0A 4ZU6X 2QVLA 2AC7A 3H2ZA 1F3LA 4P5EA 5FFNA 1ZXXA 2XNKA 2DB3A 2AG5A 3HRHA 2ZZKA 1NATA 2C04A 2XT9B 3GMJA 3H1FA 5K45A 3NJRA 2CUKA 2PZBA 2MHCA 1OU4A 4FS3A 4OUKX 1JQDA 2BEJA 2HD4A 4TKVB 3IAM6 2AVDA 4OYHA 2FOXA 2GEDA 5REQB 4ERXA 4OHOA 1Z83A 5AXDA 1W76A 4KDCA 5A2QA 4H7IA 1XQXA 3GVCA 3GGDA 4HYTA 1VKOA 5TIIA 1W0JD 1Y4UA 1XLUA 2JLSA 5AIAA 4QT4A 3RUAA 1XZHA 1Q22A 1PWZA 3ISJA 1T4BA 3OF3A 4M8NE 4ETWA 1FS6A 2CJYA 2B36A 3P9ZA 5FA6A 3ECSA 4KN8A 4F2GA 3A9TA 4PYQA 3ZBPA 4JWTA 4JZKA 2QTLA 4RQBA 4OQEA 5SZIA 1C7JA 3HA3A 5FUVA 3DDZX 2V6JA 4ZJYA 4CIVA 4QDUA 2IHNA 4K8OA 1T9ZA 3KIPA 3HJAA 4TWIA 3COVA 1H6DA 4KFUA 1B16A 1XZNA 2R79A 3NC1C 4NG4A 3OT5A 1A7KA 1P5FA 1R8QA 2Q3DA 3DMGA 1FUUA 4RA9A 3WMRA 821PA 4NC9A 4MVWA 1EGMB 1GPAA 2WJJA 3G2PA 1R2QA 4PSAA 5HIIA 2VQ6A 3LWZA 4DV4B 2ID8A 4G1UC 2QPOA 3PRJA 4XVUA 1WX1A 2HSZA 2P9HA 3INYA 5ITZB 5AKLA 3ELBA 1C8LA 1DNPA 1NLZA 5DYNA 2OKGA 1X1QA 1U4SA 4C4PA 2ZR0A 4DSAA 3A1CA 2AWNA 1XF1A 2JFXA 1A4UA 1GTMA 3L5KA 3M3HA 2HJHA 2QVXX 3MFYA 3NIDB 4RWEA 3RUHA 1E6KA 3IE0A 4B0OA 1KP2A 5HYVA 5LDHA 1PR6A 4KQ1A 3QX7A 1DJMA 2IC5A 4QEDA 4A10A 5CIQA 5KC8A 1MB4A 1S8NA 3MIIA 3OETA 4TROA 1CVIA 5HF5A 2PN1A 2W8BA 3FTEA 3OIWA 4CEIA 2GTIA 3DAYA 1PT9A 1AZSC 4GMGA 4BQQA 3CKKA 2C3OA 5BSVA 2YNMA 2XMQA 5DN6A 1UBCA 3CY6A 3DVLA 5COBA 4ZAGA 3QMVA 4MTLA 3RIEA 1N36B 4REQA 4KSCA 2XVZA 5J1TB 4IHJB 1SU8A 3N28A 4B48A 4Z4EA 2B82A 4EEXA 3LWNA 4DV7B 5KBYA 4TOIA 4AJOA 1F7UA 1EVYA 2IHKA 3CRZA 4G2NA 5AKIA 5JXIA 3T1HB 2JJYA 1PJ3A 2BF4A 2FZ5A 1VRVA 3FSRA 2JC3A 4FW9A 1UWKA 3E5HA 2ZCJA 5AK0A 4Y6LA 3E1SA 5AW2A 1WHTA 2NVWA 3AUFA 4K6HA 4JFRA 2H4YA 1A72A 1VTKA 4PX3A 4B84A 1IBRA 2H16A 4MRMA 5E9QA 2WIFA 1EJBA 1U8FO 2BT4A 3LKBA 4PLTA 3RQSA 4GPBA 2JGRA 3QXHA 1UJ2A 5ANRB 4QUDA 2PDAA 3R5TA 5F2EA 3T3PB 3OF2A 2VBIA 3WOVA 4BP8A 4ZFNA 1AB5A 2WF5A 5T4HA 3IUEA 3B9PA 2QYTA 3ILYA 4RF2A 1D5CA 4XD7A 2Y3IA 5E0OA 1Q74A 4JYZA 4A2WA 3GYBA 3ZWAA 1I1OA 4OQZA 4UVEA 1K97A 2DFKB 4ZDWA 5ECDA 1IBMB 1BDJA 1RC0A 1M2OB 3AERB 4HEA1 4MJ3A 3EOAI 3G1TA 3EA4A 3OZVA 1YB7A 2Q49A 3D4NA 1JU3A 3FCCA 1QH9A 4JI3B 3BJIC 5AJHA 4DWWA 1JQ5A 3G88A 1E6MA 1AN9A 2R2GA 4WDQA 5KYWB 1CZLA 5AP9A 3TUZC 3MBIA 1ADCA 3NOVA 1SXJA 5JU6A 3IALA 3UOWA 3DEIA 1I36A 2P4SA 2A94A 2X9QA 1GT91 2HJWA 1Y3BE 3ENNA 5EMJA 4OIMA 4AJJA 3HXLA 3DVSX 2JEZA 3K0EA 2YJ4A 2LIVA 3MQ4A 3VNBA 5CVUA 1GGMA 2CHGA 4BASA 4EQ6B 1JPJA 1G18A 1ZS9A 1HDRA 1MRZA 1AHIA 3TJZA 2Q5HA 1OOEA 4HUQA 2EJVA 3LKZA 3NWPA 4KQXA 3WMWA 4LMPA 2PEZA 1XPOA 1SIBE 4BMSA 1LQUA 2W2XA 5DT9A 4MJXA 1NGSA 3GEMA 1NVGA 5ISMA 3ESZA 3ZV6A 4AMVA 2Q28A 1Z08A 1RMQA 5HG0A 3GUZA 3KQMA 1UDXA 2Q0HA 5E2IA 4MVJI 4X00A 3HL4A 1DG1G 4AJLA 4DM3A 3ZWPA 5JJBA 2YY6A 4WZBA 4K9PA 1RJFA 4QUEA 3UXEA 1YKSA 3BFXA 1KOJA 2YWDA 1QWTA 4JU8A 3SM9A 3H17A 3ANTA 4ND7A 1HTWA 2WJAA 3MWEB 3E61A 3W2TA 3M4YA 4IGFA 4MV4A 3OOJA 4URWR 3VR6A 1E3MA 2ZUEA 1TM2A 3BIXA 1EGVB 4P4SB 2VYCA 4TTVA 2EX1A 1K8QA 4OGFA 1VHLA 1M0SA 4I55F 1MDFA 1Q1QA 4FVTA 1U9ZA 2ILTA 4MW9A 4EEZA 6NULA 3EGWA 3J7AC 2M32A 1PWYE 4J0FA 3KPJA 1SVOA 1XVUA 2M9MA 3CLUC 3DTYA 4X60A 4IDCA 5EIWA 1JYSA 4MUGA 3LSYA 1YS7A 2O3TA 2QORA 2ZITA 4HNQA 4HN9A 3NP7A 1UJ5A 1KEVA 1GZUA 1W4RA 5D3QA 5C1PA 3T3GA 4DDMA 1A7UA 2WM2A 1NT4A 4PPYA 1MPTA 3MXOA 4JP3A 4PFSA 4TN5A 5JZBA 1CQJA 5A62A 4AJNA 3FNEA 5FUXA 1M6VB 4MH0R 5E8JA 1QYXA 4N40A 4LYFA 3JRNA 5FYDA 4B3CA 5ALIA 4A8JB 5I5GA 3A9SA 2HGZA 3FCSB 3KXDA 2A7QA 1KIAA 4EHNA 3GPIA 3H87A 2DFDA 3N39C 4ZOLA 1ZGGA 2I65A 1PR1A 3JARA 4DIUA 1IN6A 3A25A 2J3IA 3QNUA 3RUFA 2IS2A 3FM8A 4GFDA 3SYLA 4X65B 1U6IA 2BZ1A 4YP7A 1WPXA 1Z5UA 3FIJA 1R0KA 4DEXA 4G1FA 1DJQA 1CETA 4K9KA 3M4ZA 3WRWA 4YC7A 4DLZA 3H7IA 4JBHA 3BXHA 4PWYA 4UM7A 3C7KA 3RVDA 4AK9A 3KZKA 5JD4A 3RWBA 1XWIA 3LRXA 2BTOA 3L7LA 3HVUA 3JALB 2FPGA 4X20A 3ZTTA 4OSPA 1Q15A 2WSSA 5E1DA 2HN9A 1FA9A 2VH1A 5EIBD 3K6SA 5DM2A 4L15A 3RU3A 3I2GA 1HT3A 3VMFA 4XFJA 4JEUA 5AI4A 4NRDA 5LQDA 4ZO7A 1I4LD 3UMCA 2FKNA 3BMOB 3R0JA 3CVJA 3KLBA 1KXZA 1YB6A 3TTUA 5A1JA 4ABTA 1WB4A 1XCGB 2JFFA 3OE7A 1UBSB 4LDNA 2JAOA 3VTFA 4F21A 1SHLA 3A31A 4U00A 3PDCA 4ZARA 4MS4B 4MS1A 3HGQA 3ERCA 3FRJA 2Q7DA 5HQ3A 2XRYA 3OZFA 2XY4A 1RJGA 2X7JA 3OKFA 1T2NA 4HDRB 4IM7A 1XRMA 4BB6A 4L07A 4RKRA 1T9DA 3K8ZA 1E2PA 1M8GA 2X0EA 1N0IA 4BV8A 3FPSA 2BFOA 2YV4A 4BLPA 5H5JA 1DHRA 2C4VA 4CQLB 3G8DA 5C7YA 4TMVA 1KSGA 3SEQA 1L7MA 3HR7A 1JMYA 1CV2A 1EYZA 1M7BA 1Z3IX 3EXAA 3I9V1 5LD2C 1QGYA 3LZ6A 4R3UC 5JFTA 5C8ZA 1V3TA 2BL4A 3A4MA 1SUAA 5G1NA 1YCDA 1YJAA 3H5NA 4II2A 2QTCA 4ZEXA 3A4LA 1M8KA 1LLFA 1OV4A 2BDUA 3B48A 3GD5A 2XZTA 4C4YA 5EXSA 2BGGA 4RUKA 1Y1LA 1FK8A 4G4IA 3TKAA 4EWLA 4TMTA 3HWSA 2OY0A 4P86A 5A9RA 2P7IA 1IZYA 4EDFA 3PXGA 5E9JA 5B4VA 2VT3A 2OOSA 3KZMA 4DGQA 2Q99A 5DO9A 4DQXA 2CLSA 3V8NA 4QNRA 1SUCA 1ZGBA 3OZAA 1VSQA 1H6CA 4B83A 1PG2A 1XNQB 3KKNA 4HJXA 4OLAA 3JQRA 2WFAA 3DFFA 3A1FA 3KTAA 2KBFA 4JGBA 4YASA 3X1KA 1K3JA 2PTGA 4EVRA 2BKUA 1C30A 1XQYA 1N1EA 3L02A 1PWEA 1Y7TA 2HX1A 2QX4A 1YZGA 1ZLXA 2ZT8A 2NYVA 5AUQA 2D6FA 3W5AA 1PTJC 2DZDA 2BRUA 1SGWA 2A1TS 2H92A 4RYDA 2FSIA 3LL7A 1QNFA 5JCJD 2I6TA 1TA9A 5BSHA 2A3RA 4FGSA 4KVGA 1EFDN 4GP9A 4GPZA 1YZLA 1RJ9A 2REOA 3UK7A 1H94A 4P6VF 1BS1A 1XKXA 1H0RA 4QFDA 3T7RA 4DCGA 3I34X 4BNNA 1EFRD 2I4LA 1FYEA 3EXIB 1E59A 1BEUB 2C00A 2ZUCA 3P0RA 4O5OA 4P4GA 1CULC 5K03A 5BVGB 6ADHA 4HHEA 1B6TA 2KJQA 1Z6GA 1F5SA 4L0CA 1NW7A 4L4SA 3JQEA 4BLQA 2G5PA 4GX0A 1D2MA 2FN9A 1RYEA 3JYPA 3HXKA 1AKTA 2NUAA 2O50A 5FI0B 4DMUB 1IHYA 4KGDA 1GFIA 3ESDA 4XOUA 3ZGNA 1O5OA 3IMKA 5H80A 4QBTA 3EDRA 1GXSA 2NX2A 3VR4A 1B0AA 2DC1A 3P0HA 3A3NA 1YC5A 1YOBA 2P2YA 4X54A 5B1YA 4BFLA 3OECA 2QLTA 2ZSUA 3KHTA 3SE0A 3WNCA 5D5HA 1OPXA 1Q1AA 2XCRB 5EMHA 2Z6QA 4YWJA 4YXWA 1H5NA 1HLGA 3ETCA 4AP6A 4DJEC 3M33A 2G0AA 2CVQA 2H0QA 4MPRA 4PZYA 1ZL2A 2I29A 3K09A 4IH9A 1RPNA 4ZI7A 1CB7A 2QI9F 3ZH9B 1GEEA 3TTYA 2VJCA 1HDOA 2FSUA 1CJSA 2ADMA 4G0OA 2NLOA 5CW1A 3MTJA 5IS2A 1RKQA 4JLDA 3BT7A 5TX7A 1BQ4A 3GRVA 3R5FA 4IV0A 3TX6A 3CUWA 1F8UA 4AS3A 4H1HA 2EW8A 3NHZA 3DAFA 2BMDA 3PFGA 4RTPA 3UO8B 1CS0A 4L0DA 4B3IA 4EECA 3EDOA 1NKVA 2BTQB 2D2IA 2DBQA 4L5JA 4C14A 4CR7A 2AN5A 3NONA 3CRVA 1MRNA 3DDWA 3O8OA 2HMTA 1ZFNA 4P3OA 5GINE 1GRRA 3P7MA 4CE6A 1D6SA 1ESDA 1JHUA 1P3DA 1ORVA 1A5ZA 1JG3A 2DBYA 1U1IA 3CM0A 4WOBA 2AJLI 3AEUA 3N76A 1PDWA 5MGBA 1OBOA 4HEHA 3OJOA 5CGZA 4FE7A 5DHPA 4NULA 2VJAA 3PQEA 4B6QA 1K4MA 3AYXB 1XD2A 2Y1OA 2ZI4A 1QG6A 2WF7A 3HI6A 4H18A 4JUCA 3VYVA 5B58C 1GU0A 8ADHA 5H16A 4TVOA 3EEOA 3ZZTA 1XXHB 1GPH1 1YACA 2ASVA 2O6LA 1QFJA 1DXYA 3K9BA 4UE6A 5SV2A 1V9SA 4RFSB 5DOVA 3G59A 4NCJA 2H17A 3X1XA 5DM60 1Z63A 1E8DA 1PT5A 3RRXA 2FUEA 4TYNA 2J9GA 1MMFB 3HS3A 4FMPA 1QO9A 2OLEA 4IV8A 4XSGA 1KHUA 3KV1A 3UV6A 5IARA 3DHEA 3PIRA 4BYGA 4RK0A 1L7OA 2J0SA 4XX0B 1N9GA 4Q6WA 4E1BA 2D1YA 4Q7LA 3NALA 3WIUA 2ORVA 3PUYA 3TYXA 4S2EA 1UZUA 1HR0B 2C9MA 4RYLA 3V7UA 3KJZA 3BHMA 5LBUA 4N9WA 5JDIC 2JK1A 1Z5WA 5BSFA 1ZL0A 5HMLA 4DLYA 3AVPA 4WCFB 1T1SA 2AR9A 2I3AA 5JZMA 3X1YA 4D9EA 2ISCA 1DG3A 1O87A 3JD0A 3KEQA 2ZWAA 1A9YA 3ZDZB 1QG4A 1WD7A 1AUVA 3D6JA 4LDPA 3VU3A 2J5QA 1L7QA 3WC4A 1G55A 1M2GA 1TU4A 3E22A 3PQFA 4HI0E 4Y6SA 4B71A 1SKQA 3C3XA 3RJ5A 4Z49A 3GT4A 4BNMA 2X13A 4D8UA 3RTDA 2A8YA 4R9SA 1UIMA 1IULA 2FPMA 2WV7A 3SQMA 5EESA 3TRDA 1MJNA 1SC4A 1OYWA 3CPSA 4C0QC 1DKOA 4DCTA 3ME5A 3NHWA 1QIKA 1XTRA 2JI7A 5CPFA 3FNHA 1N6KA 4JENA 1VB3A 5JELA 2C3MA 2PXHA 6PFKA 2V9PA 2EX4A 3DULA 1L4YA 1YVUA 4RE5A 1XRLA 1M8PA 5JVDB 3R6LA 3PEVA 3GNTA 5CH5A 3RYIB 4W5TA 1NUUA 1MB0A 1ULAA 3KVNA 4IEEA 2BJHA 4GM4A 4UVDA 1JHQA 1UEJA 4IDQA 4NKRA 4FB5A 1J8YF 2HBZA 4FFBA 3TRIA 3TVTA 1UZMA 3NIFB 4JBWA 4OATA 3EFEA 3NUGA 4BJ3A 2VI5A 4YJGA 1EK1A 3DS8A 3GJ8A 4YIHA 2ZRPA 1MPXA 1RYMA 4EY4A 1J8MF 3QP9A 1SFRA 3L2OB 4LVUA 5HKBA 3KOWA 1EDOA 1TD1A 1P2VA 2INGX 4QGSA 2IH2A 3D3KA 4YP1A 1VE5A 3LY8A 3F74A 5H59A 1A7JA 1AG9A 1M2WA 3N6VA 2WHRA 4FYYA 5HF8A 2UZ1B 3AUAA 3NJ8A 4LF7B 4HADA 1OWLA 1S89A 2PBZA 3OQJA 1ODTC 1F38A 3D1JA 5AXCA 5JNLA 5A9SA 1NPTO 2JAQA 2WF9A 3MFQA 3HA7A 4FI3F 5K8UA 4IJKA 4EJSA 5K8CA 5AHXA 4I3GA 3KT9A 5CAEB 3EVGA 1G291 3BXFA 4PIMA 3T35A 4YJDA 2WTBA 5CITA 9ABPA 4CCAA 1WP4A 4XB6B 2H2GA 3ZJUA 2GHQA 4O02B 2PSSA 1M1YA 3EGDB 3GK3A 2IDMA 4UNSA 1X8JA 2A59A 3FJOA 1YUNA 2J3EA 1PFWA 1YDMA 2G7MC 2H00A 5EQTA 4D80A 3FBGA 3QE2A 4RSRA 1JQJC 1JILA 1W96A 1UHTA 4E2XA 2JA1A 2PCLA 3AG6A 2BKVA 4IZ6A 4RHFA 4UZSA 3SJBA 2ZJ4A 1YRHA 1SU6A 4P7GA 3WY9A 7AT1A 3HP4A 5EJAA 1P3Y1 2ZZMA 2VP4A 1MEOA 2PL9A 3IQWA 3KKMA 3MTBA 3P27A 3PGJA 2ZTUA 5ERYA 5BORA 5CB4A 3W06A 1N8NA 1PR9A 1TC1A 3UOTA 1CVLA 2XR1A 3O82A 1YZFA 1U9IA 4IUDS 1RQXA 5CURA 4FDUA 5K0EA 5KHOC 2W43A 3KB1A 3NW9A 1DC3A 2AFFA 3QI2A 5FTWA 1R3DA 4O1MA 2CXNA 2AUTA 3UNMA 2J3LA 3QTBA 4P3NA 2OO5C 2REXB 5F78A 3PJDA 1WEHA 4UHFA 3Q8WA 5A7HA 2PRIA 2RHTA 3LK6A 2R65A 2FV8A 2MR5A 2PL3A 4GWKA 2EFHB 3H7AA 3GP3A 3HWWA 5FHQA 4B3HA 3JAMA 1BSVA 2QN8A 2IHVA 1ISGA 3C6BA 3CSDA 3ESRA 2XSZA 3JQ8B 4IO0A 4J2TA 4LRSB 5C1BA 1EHIA 1CR6A 1A98A 1VPEA 2GZDA 3N2GB 1IU9A 4I50A 4Z99A 2XRMA 3STYA 3KXKA 2AC2A 2DOKA 1PK8A 4FFNA 3NI2A 3PFWO 4Y2JA 1MX9A 3RHFA 1AU9A 2O19A 2QAGA 1K08A 2RGNA 1U8YA 4UUNA 1RIFA 3BE6A 4MK4A 4D9NA 2D5CA 2PGIA 1WD5A 5AM2A 1RQNA 5C18A 2ZB4A 1M7GA 2ZUTA 1ZD5A 1IY9A 3NJ4A 1H3FA 4EL5A 4BEVA 3GFSA 1DKMA 1LCIA 3MLAA 4F46A 2OFPA 4X1YA 2P69A 4R8SA 5ESXA 3TE7A 1H5QA 2Q07A 3RIXA 3BXGA 2A14A 1P5RA 3PNVA 1EFHA 3KSBC 3BCHA 1F2DA 3Q5EA 4IJMA 2RI0A 2FGJA 1H85A 1Y8ZA 1I9CA 2C59A 5HJ2A 1GV0A 4AX4A 1RLOA 2WM3A 3VVLA 4G85A 1Q84A 3ZOKA 3LDFA 1PK9A 3OICA 2QRQA 2RAUA 1VP3A 3M49A 1OBVA 3R0ZA 2DUMA 5LYJA 1V48A 5A7FA 4CL0A 4BNUA 1C7ZA 4DLTA 1R5NA 1L2TA 3TLKA 2HCJB 3IMEA 1K3FA 5C34B 3BZUA 2C31A 3IAFA 2P4EA 3UF0A 4Z4FA 4AW9A 1IYZA 2VDNB 5L3ZA 4ZJPA 4LV8B 3L6EA 4M1ZA 2Q5OA 5D7BA 1ADBA 3IUYA 3L93A 2FFAA 4KX5A 4AQ7A 1GGEA 1WDKA 3ICPA 1WV3A 1Q1GA 3KXIA 2ZT7A 1V41E 3CISA 1YVEI 5FA8A 5FWNA 2JI4A 3ZBTA 1T6YA 4KQ2A 1WSAA 2FX2A 4REMA 1H2BA 1J70A 2V59A 5KWIA 2GPNA 1E2JA 3NYIA 2IZ5A 4EY7A 4G36A 5B64A 1Q0TA 4CM9D 5JW6A 4BUZA 5IT5A 1RM0A 5IYZF 2P6NA 1E58A 3H86A 2GESA 2VP0A 1YJBA 2WILA 2P9YA 4JX9A 1G5QA 2QR5A 5ELXA 4FFOA 4OGLA 3T12A 2QHXA 221PA 2O7NA 1GGFA 2QYOA 4Z4HA 1NOJA 3X1MA 4IS3A 4U7GA 2XZLA 2MSEB 2B7CA 1EFVA 1HE5A 2MMGA 2BISA 4EO9A 3R9KA 3K1YA 5JCOA 1ADGA 2C7BA 3S6JA 4KCGA 1GRQA 2A9VA 3FYDA 3UMGA 1MKYA 4R40A 2P2NA 1YGSA 3W3AA 1JLHA 2WE8A 1JW9B 2P2CA 4KI7A 5CT8A 5DKFA 5JJKA 4QRIA 5H9VA 5D3ZA 1BFKA 1GSIA 3LYLA 4EW1A 4N7JA 3EWNA 4P22A 3WGYA 1Y1TA 5BQFA 3UGTA 3MTQA 4RA9B 2J85A 4YHHB 2WLSA 3D8HA 3PV0A 1C2YA 4IWYA 3RFCA 4CIXA 5B3LA 4J0DA 5TQJA 1TJ3A 3LP8A 3WR5A 1DQNA 3T9DA 3GIWA 4V0MA 1AURA 2ODQA 4U4AA 3BC1A 5DM1A 4HPXB 1ZA2A 5CHEA 1BJTA 1DHTA 5H7XA 2PUFA 1Y6RA 5FPYA 1B14A 2DF8A 4CEJA 3FUTA 3E9CA 3RS2A 1BJKA 9LDTA 1XGKA 1L4EA 4PYIA 4P4UA 8LDHA 1B8PA 1RI1A 3U9SA 5JUWA 3FNGA 5CD9A 2W8BB 5DB4A 4YCLA 1ORHA 1ZH8A 2QTVA 2NWQA 4LZNA 4R1LA 3RVKA 3S2FA 3QKTA 3GUYA 4O2BF 4GVXA 2FVXA 4PGMA 2I7XA 4RM3A 4O2RA 4REQB 4ESHA 2W6JA 4YIKA 3SFZA 2ENWA 1QHXA 3LBIA 3TTWA 1LI7A 1IBLB 5M04A 2FU5C 3R5XA 4UXJA 4WQMA 4CM3A 5ALHA 3PT5A 4KB5A 3Q3GE 4YCNA 1NMQA 4O0LA 1SR8A 3HDYA 3P9PA 3QPCA 4OH7A 4YLYA 3FM9A 5B30A 1GRCA 2PSHA 3LDGA 3P8ZA 3ZIAA 4WBXC 2E89A 4KNVA 1FSGA 1D4AA 2PXAA 3FYUA 4NS4A 2RG7A 5CXSA 2NTYC 1XD9A 3IP1A 1M3SA 1JX6A 1WHTB 3GIDA 4J4HA 3K9NA 4YJHA 6YASA 2ATEA 4MRMB 4NDZA 4XDZA 2Q5FA 1U8UA 1W581 3U7IA 2AA3A 1U1DA 5HK9A 4EJ6A 1RABA 2QKYA 2ODNA 2IKQA 4GLOA 2FSSA 1UBGA 4LYGA 4JP1A 1C2TA 3E3AA 1W48A 1YJXA 3O26A 1G8HA 3I09A 2GN6A 2Q2OA 4EA8A 2B30A 3BAZA 4UREA 4UOEA 5JALA 2HMYB 3OUNA 3CNQS 4N5LA 5CMLA 3DE0X 2YRFA 1H5UA 4QFCA 4P7KA 4KG7A 1XG5A 2UZAA 4DA0A 5LP6F 1PEDA 5T8KC 3RT7A 4I99A 4AT1A 1PYGA 2EGHA 3JX9A 4K1XA 2RHCA 1PW5A 3RW9A 4GO1A 3IURA 2NSJA 3B13B 2WQ7A 2GPYA 5I4BA 1UC5B 1SXJB 2C29D 2PH5A 1QU3A 1FXWF 3P52A 1MA0A 1RHKA 2FZ4A 4MA0A 4F12A 3BSWA 3PC8A 1PGJA 4DADA 2J32A 4MA4A 1G7RA 4M0MA 4MW2A 4DPLA 4ZVQA 3VHLB 3FKSA 1KVRA 3CEMA 4B6FA 4X8OA 4YP6A 1WXQA 4E3ZA 4HUQB 1L4GA 4KWIA 3DBHA 5JMTA 3RRFA 4MGEA 3UOGA 4E08A 3RDPA 1LWNA 3G82C 1ENYA 1XEWX 4IQ0A 1JJVA 1W5AA 1ZSNA 3FXAA 2LD4A 5B58T 5F1PA 2CLFB 4PZZA 3RAFC 2Y27A 3T1OA 4BB5A 4IIDA 2YZNA 3D4IA 3F5QA 3K1TA 1I2CA 3S2YA 4NZOA 4F1WA 1LY1A 2J59A 4FHCA 3GGPA 1NVKA 4DKXA 1OZHA 4LHZA 2CK3A 4OKNA 4J0QA 2B69A 3CUVA 1ZW1A 3CUUA 3HJGA 2Q9BA 1TMOA 5H3LA 1AHHA 4AB1A 2R7KA 4G2SA 2QRMA 3VNAA 4QASA 2CZCA 3W90A 4EYQA 4YAEA 5CA1A 1L7AA 1AO0A 2H8GA 3R40A 4IDGA 3UTCA 2JCVA 3JQDA 5LYYA 1U0GA 3V8EA 3P0JA 4QSHA 3K7EA 3U0BA 1RBYA 1BU5A 2R6DA 4C6SA 5C4MA 3Q4GA 3V1TC 3JAKA 1BCRA 4G24A 4WCDA 1FNMA 1D6MA 3CN9A 3ZCVA 4JLWA 5IC4A 2B20A 4BN0A 2JJ1D 2V6BA 1WLNA 3LUAA 3OAAD 1A04A 3KVRA 1VMEA 2CLCX 1PT6A 3P2MA 5IXJA 2X77A 1ZHHA 4CLXA 3O4IA 5A6VA 1R8SA 4DBVO 3G5UA 5JYBA 4DJAA 1PBTA 1CQJB 2O2YA 1NW9B 3C3PA 4F5YA 1UXGA 5KNDH 3D5EA 1R0ZA 3H18A 1IOWA 2Y71A 3CS3A 1PVOA 1EUYA 1YVRA 1U94A 3AZPA 3R0QA 1A9QA 2F17A 2OZLA 4QPNA 4BFVA 5EIEA 3SG0A 2GTPA 3KU1A 4XXHA 3W78A 4ZOLB 3E23A 1SUIA 3EGVA 3JARB 2C4KA 4TV8A 4DA9A 3NH9A 3UYLA 4LJRA 4RMHA 3A1TA 4QARA 5BNIA 4HN4B 3VUEA 1XDZA 3QKRA 3T7KA 1UOOA 4NBKA 3TLYA 3P9IA 2I76A 3MAJA 4FGJA 1OY1A 4IRUB 1Y0BA 1XVAA 3IX7A 3DEYX 3ZCXA 5I7VA 1ZGJA 3E15A 5D85A 1CJMA 3DKIA 1GNRA 1YOVA 2OVFA 4II7A 4RTOA 1YB2A 3AJDA 3QY9A 1NULA 2FPGB 2P9QA 2PD6A 3ITNA 1C41A 4TXLA 4WLVA 4TKZA 4UFNA 3AU9A 1KWKA 2XBLA 3K6SB 3WSTA 5FJJA 2AXPA 3GARA 3T3MB 2XV1A 1K27A 1NSTA 3UFXA 4R1OA 4JIMA 4E33A 1NDHA 1JE1A 2H9YA 2HSJA 4R41A 4Z9FA 4AMGA 4UHBA 2PL5A 4BAGA 2VJDA 3T4PA 1T6BY 3LGAA 3IR7A 3THXB 3OTGA 4YJ3F 4I5IA 1JDZA 2YXLA 4ZYVA 1EGAA 2AW3A 2CY0A 4B3SB 3VA4A 3EW7A 3B85A 4GSKA 1CFJA 4TQUS 4MS1B 4FONA 4DG5A 5K8VA 1IQRA 3CLVA 2DPLA 4PAGA 2Z8YA 5LA6A 1Q92A 3V48A 4AVYA 4ZHQB 5BV1A 1V11A 3EA0A 4QG7A 4LJ6A 2JD0A 4GBMA 4QUGA 3TM4A 4GOXA 4BKMA 3WYAA 1K8RA 1NWCA 2XNJA 2O0JA 3GP5A 3JVEA 4HWGA 4BE4A 4BMZA 4F60A 5AJZA 1A88A 3GLSA 3IELA 2C5FA 2VZEA 4NIMA 2I1QA 3L18A 1QGAA 4ESVA 2HF2A 3HLYA 3LVQE 4OU4A 3Q3JB 2GT1A 4DA7A 3N8DA 5L9AA 1Z4IA 4A8JC 2FQ1A 1TTPB 1BC5A 4MINA 4V0SA 2GCOA 1KS2A 1E60A 1KF0A 2WSLA 4WASA 5FBQB 1I3MA 5CLJA 4HSEA 3JD1A 1R0WA 4FZJA 3F3KA 3O4FA 3UPUA 5TGZA 4DPMA 1W93A 3FUCA 1EJ0A 1R8YA 3KSMA 1QFYA 4K9DA 3M6WA 2JEOA 4BQEA 3FR8A 4DLBA 4R1QA 2XVYA 3SHTA 2NIPA 1DUVG 3UJNA 1MABB 2P78A 4CG1A 3B8HA 8OHMA 1DAGA 2H29A 3FFTA 2YIJA 1ST2A 2GF9A 3NDPA 5K8LA 1P0IA 1Z5VA 1E2HA 1Q44A 4RZHA 1G2OA 1I2MA 3WTCA 4C5BA 2R86A 4M2LA 5GGXA 1DG9A 1GO2A 1XAIA 5JD3A 5IWCA 3KTAB 5GOZA 2MCFA 1C30B 1DLJA 1TO6A 1UFRA 5FOWA 2YMQA 1P1IA 1NLFA 3JD3A 4H7FA 4LYYA 4BN4A 1E2DA 5FUMA 3PLAE 3RC7A 4KFSA 1ORIA 3W04A 3AF4A 5IFLA 1TKAA 4FMDF 2BUAA 1VP9A 2VKQA 1RJ9B 1U65A 3F2IA 5ARBA 1UT6A 1N34B 1U8AA 2D13A 1KC3A 1XXLA 4XYGA 3MILA 3KD3A 1DC8A 1MO4A 4EUNA 3UZUA 4DG8A 5K01A 3AUJB 3ZDDA 4A7PA 4LXHA 4XZ3A 1V8ZA 1TCVA 4B4DA 4G97A 3TRFA 2Q2QA 2NUAB 1LRLA 1LVGA 3IOYA 2V6GA 4CM5A 4TVSA 3R76A 3TL2A 1S1CA 2D4HA 4GW3A 1M34A 1O95C 4JI7B 2V74B 4FOLA 1GXSB 4FYIA 5FPTA 1CUHA 5D3MA 1W87A 5AKYA 3CZRA 1W0JA 4J9VA 4YBZA 3T1TA 2ONCA 1GQSA 2ZB3A 4LXIA 4NE9A 1NYQA 3VZCA 2XGJA 3T4XA 1PJLA 2R7LA 2HDHA 1SKAA 1DBIA 1QV6A 1O89A 4B34A 3U3RA 4XR9A 2FSGA 2FXVA 1G98A 2WWIA 1UWVA 1KKMA 5EJFA 3E7DA 1JL3A 4G8JA 4G84A 4RF4A 3CX6A 1T0IA 4BLWA 1CJUC 5JAIA 2ZS7A 3FAZA 4ZI7B 1F4LA 2B0CA 2RHWA 4XW2A 5COAA 4F7DA 1T5IA 3H1EA 5KQPA 1XA3A 5DCWA 4KUEA 3ZKWA 3BD9A 1L6RA 3JASA 4CL8A 4NZ9A 1FP7A 1ENZA 4HF7A 3KQLA 1TUBA 2ZGVA 2WB4A 1NBMD 2ZI9A 4AKGA 2KB3A 2ZJ6A 4WKOA 4D4KA 4DV3B 4W8OA 1OX6A 4OMUA 1ZNQO 3ZCSA 1NE2A 3P9SA 8ABPA 1ZGCA 3LCCA 3DFUA 4A91A 1CS0B 1I2DA 2BH9A 3RREA 3EVBA 3OZUA 4NQRA 4UTOA 4G5QA 3BJEA 4UDOA 5H02A 3OQ1A 1L5LA 3N87A 5C53B 1ODLA 2GWRA 3O8OB 4F97A 1KQPA 1NPDA 2A0UA 3ANLA 3CIFA 3G0CA 4E5YA 4F5EA 3L40A 1T2UA 4RPLA 4F2HA 2CHUA 5JS8A 4YJKA 1ZXBA 4JQCA 3GA0A 3HSSA 1PJ8A 3WLRA 3IA2A 4MQUA 3AEUB 2H1VA 4QIHA 1HNWB 2Y68A 1QCDA 3O8BA 4N82A 1P6XA 4DSUA 2HEIA 2YJ3A 1T3GA 3IKLA 5AOAA 1XD2B 3KFVA 3X43A 2GFQA 2PZMA 4CLRA 5M7EA 4CM4A 4RH0A 4ND5A 3TR5A 1Y7IA 4K3VA 3HQ4O 4XIYA 2P6OA 1W19A 3HBLA 5KNCH 3LH5A 4EGAA 1POXA 2GVZC 4A9AA 4MO2A 4PX9A 5C46F 1XRNA 1JA9A 2MIIA 3SM3A 5TQ0A 2CBGA 5I48A 5CVCA 1KJNA 2FWJA 4JU9A 5EYPA 1NI5A 4ARIA 4LI0A 1HG1A 2JFVA 2RARA 5FOVA 3L6BA 3VOAA 1N9GB 5I9TA 4GYKA 4XEUA 1Z8NA 3W2GA 4X64B 4E5VA 5EZSA 5KYVA 3OLVA 1RWQA 4LWQA 1YC2A 3FNQA 4UDXX 3C7CB 5K3DA 4DWJA 2H1OA 4G9GA 3F5DA 4TWZA 3IIEA 2VRBA 3T99A 1J1IA 1PJQA 1Z2NX 4NYMQ 1N25A 2PRJA 5KTTA 4JT2A 4N6OA 3VPBA 2BBOA 4B9EA 2Z2YA 3VR5A 3QLJA 2R6JA 4MUIA 4A0GA 2PV0A 2VHUA 2OV4A 4GYJA 1T5DX 3RTAA 4OHUA 5HTKA 1O5TA 4S12A 1S01A 4BFXA 3LA8A 1XNRB 1RQLA 1DO2A 2ACKA 3CH5A 4RZIA 1CZRA 3KT0A 2VF7A 1BWQA 4E6PA 1V8FA 1JLLA 1LU9A 2GKGA 3CLUD 3E22B 4KLRA 1QQTA 5DTEA 3SS8A 2O8FA 2P41A 3DZFA 1C7EA 1X1RA 5A03A 2J45A 3K3PA 2HLHA 2UYYA 5AMXA 1P74A 3GUVA 2HIGA 3BK7A 2OKCA 1RCUA 1TDJA 3KEGA 5AFSA 2X5JO 3GN1A 5IXSA 4MWTA 2BGIA 1UJBA 2PSJA 3ZY5A 1RM4A 2D5IA 4N3AA 4OM8A 2C4HA 1V3QE 1RRKA 5AXAA 3QFRA 4EQZA 5GIPE 4Y8VA 3QW4B 4GKAA 3P4YA 2FLVA 1GG2A 1WZCA 2IYRA 2J3QA 1EIWA 1MENA 1YIDA 4V39A 1AMUA 3K2EA 3L7BA 2VKTA 3TSAA 3TUJC 3LQ2A 1PNVA 4DMGA 5KINB 4MVJH 1UOPA 4DUZB 1AK2A 1Z13A 1E1RD 1MGPA 3I1JA 1VE1A 1TC2A 3K0AA 3KCQA 3L06A 4RVNA 1M0EA 1OGJA 1P5JA 4ZQBA 1Y37A 3MJHA 4G07A 1HZJA 1K3NA 3P9NA 1ZGZA 4XCXA 4YJGB 4D0RA 3R8FA 5FL7A 1U2DA 2VOJA 2WTNA 2XH8A 3A4IA 4GOLD 4C7OA 2ZQ5A 3I37X 3LYHA 4M6WA 4D97A 5FDFA 1JP7A 1T4MA 3KJXA 4EKNB 1XP5A 3A05A 4MW6A 2AI3A 1NN3A 1RXCA 4JB0A 4ZQIA 2VJYA 3ADDA 1PTKA 2ADOA 1G4UR 4KH0A 4BXOA 3L7JA 2XUGA 1H2WA 4Q1CA 3OJLA 3HU3A 4KO8A 5FNVA 4ECEA 3TB6A 5A9SB 3QENA 4FLEA 5FOQA 4YJ2A 3TOVA 3K32A 2OFOA 4LVOA 3TB4A 3KHUA 4HS4A 4EJSB 1IOVA 2XNHA 4WCFC 1H4VB 1UMDA 3O8CA 2BZSA 2GASA 1GNVA 2A5FA 5BOVA 4ZRNA 4X6UA 1AKEA 1KDOA 1KWGA 2GVNA 3NHLA 5LB2A 4K0KB 2P7HA 1E96A 2ZTMA 4IWNA 1M1YB 1UT8A 2PU5A 3QA9A 1II8A 3WFJA 1KZ1A 4WLEA 2Z83A 4Q00A 2B37A 1MVNA 2ZB8A 4WY8A 3SR3A 2VOEA 3QFFA 4AF6A 4JP8A 5E6UA 4Q18A 2HMWA 2NUPA 4CN8A 3OTWA 4UAJA 3ZLTA 3KLMX 3IEUA 2JCSA 2JEYA 3FOFC 1DDGA 2FHPA 1R0SA 5CB4B 2GCPA 1JBEA 2CJXA 2XWSA 3RD5A 2QU8A 2QL6A 4JI0B 4QE3A 3GDFA 4RSGA 2ZULA 2FEWB 4W9RA 2WOOA 5HVNA 1DXHA 4RJJA 1J8VA 4B3MB 2FUCA 3VNSA 3J81A 4MUBA 4RK4A 2VNJA 5AW7A 2NUBA 1W36B 4K9LA 4ALNA 3VOTA 2OWEA 3GLQA 3O74A 3PKZA 5BSRA 1TECE 2VT6A 1S9DA 3ROMA 4BECA 5ESWA 5I8WA 2EL9A 3VZQA 2MTBA 5ED4A 2EW1A 1W8IA 3TUIC 2XA1A 5EERA 2D1RA 1PX0A 4LGVA 1YK0A 3B2QA 1KY4A 4Y18A 4GM0A 1K86A 1NNI1 1NUHA 2NTEA 2IZ1A 5JHGB 1IXSB 1MHTA 2F62A 1YR3A 2O3JA 1XTIA 4G0VA 4I50B 3PXAA 4FNMA 3LOPA 4Q4AA 4NBTA 4CG3A 5GJCA 1RJEA 5IX8A 5EUBA 4HDMA 2CN1A 1G20E 2AI2A 1EX1A 2WZQA 4CJXA 1DIBA 5JMWA 4M8SA 2QAGB 4X95A 5LZ9A 4W5WA 3RFUA 2J1LA 2YRWA 4L5CA 1SZPA 5D1NA 3OOSA 2GAOA 2KE5A 1CTQA 1D8AA 1FQJA 2C9ZA 3KKKA 4QDTA 5C32A 4XIJA 1H9AA 2ZSBA 3GBSA 1ZSVA 5AH0A 1KJ8A 4BY9E 2IH4A 1IVYA 1YCGA 1CERA 3UMVA 1CNFA 4X1YB 4DIMA 1J39A 2EKZA 4PE5B 5TV2A 4QC2A 3PNYA 4BBJA 5A3RA 4UBLA 2I4IA 4Q9KA 3PVZA 5TPWA 3DXFA 1YZQA 1QIEA 2G8NA 3OCYA 4UOQA 5B37A 3CCFA 2XUAA 4NOMA 1G3GA 1JR4A 2P77A 4GAEA 3WV4A 1SUDA 4F7WA 1NBME 4MRAA 4XE5A 1O6GA 4LDRA 2RHGB 5CBPA 1RT9A 5LYJB 4LWOA 3K8QA 1YFLA 3F6EX 2FLKA 1YS9A 3H5AA 1P5HA 4MUFA 4BWFB 4EA6A 4BKRA 2YV2A 1XALA 1PP4A 3CEAA 1LH0A 3HLKA 2AEJA 5JO9A 3VPYA 4DIKA 4MVCA 1R0CA 4DTIA 1A4IA 1VL8A 2TYSB 5KDOA 1Z62A 1WCIA 1WCV1 3CLSD 5EZQA 3EC1A 1Y9AA 2AH5A 4ALKA 3ED1A 1HLDA 5D2CA 4EY8A 1LD3A 4MW7A 2XGSA 3TQRA 2C54A 2Y0EA 3R24A 4HRVA 5CDYA 1DIOB 2YDYA 2XYVA 3WXBA 4W5NA 3FYTA 1DCTA 2IZOA 4PFJA 1UKCA 4Y3UA 3NUZA 1RU3A 4GGMX 4G0PA 2HDOA 4IILA 3ZC3A 2O4CA 3GELA 3FWNA 5E7MA 3SYRA 3I1FA 4FIDA 3U61B 3PTLA 5KX5A 1XHFA 2NZUG 3FTDA 4PSKA 3L4KA 5HM6A 3WHKA 421PA 2KBEA 4FR0A 4Z1OA 4RK7A 5JCJA 3WX0A 3D3EA 4HZIA 3ZNOA 5MN6A 4UFOA 1EFVB 3G2LA 3KNZA 4KXLA 4N3GA 1NXQA 3TBFA 3W8DA 1KC1A 1BGXT 4N5NA 2RHLA 3IOEA 1KR2A 3NVMB 4IOLA 4OAOA 4RKQA 4QGFA 3WBKA 1EFRA 1S8AA 4B81A 3H5WA 4F2WA 3HCBA 4LMBA 3LVBA 2ZS9A 3HL0A 1YJCA 3ICCA 1EK0A 3KXLA 5JS2A 4LEIA 1C0EA 1KYYA 2XT0A 3HYCA 4PYMA 4WFQA 2ZIFA 2J5BA 1L5SA 5K8TA 4KWCA 1CDDA 9ATCA 2PANA 2COUA 3D1VA 2BGWA 1A8SA 4KACA 4Q48A 2YXEA 2NXEA 4QL3A 3E9QA 1K63A 4R68A 1GGKA 1ADYA 4UJ3A 1P81A 4DIBA 1TLTA 3FH0A 1P7ZA 1Y33E 4MYSA 3VH2A 4E5NA 3WTBA 1KDPA 2IA5A 4F92B 1E1NA 1T1EA 1N2OA 1KY3A 1WSDA 4TWJA 4UEKA 4L9WA 4J0KA 2V7PA 4JP5A 1WM1A 1XHLA 2ZSEA 5B7GA 2XNSA 4GKVA 4GGPA 2QG9A 5I5EA 5C5CA 5KOJB 3H0EA 3FFWA 2B4YA 5KKAA 1U7PA 2R8BA 4EKIA 2AFIE 4CT5A 2NV2B 1HO3A 4M9XA 4DMKA 2O5CA 2QTVB 3WL8A 2CXSA 3K35A 1VDZA 4LJ8A 3UHJA 4P33A 1PL0A 3LT0A 1G21E 4KGVA 3B52X 1QX4A 4PLGA 5JNRA 4BAZA 3S1AA 5TF0A 1XA4A 4JEHA 4DLLA 1LVHA 3G9QA 3L1IA 3LHSA 4GR4A 3BEOA 3I05A 1II0A 3OE1A 3AI3A 3T52A 2P6RA 2I3BA 4KQ9A 3DNPA 4XLLA 5TF4A 3FYUB 1C14A 5IKPA 4L5BA 2IYUA 2MSLA 4TTJA 1GXCA 2OEPA 4YJHB 3R7SA 2P9FA 2XTMA 4AN0A 2R4QA 3VDRA 1BMTA 2VYVD 3KYCA 4U9HS 2HQBA 1BE6A 3E9RA 3F9RA 3LW7A 4K87A 2TSYB 4BMCA 1MR3F 2Z3WA 4RPJA 1USUA 2IEAA 1JDVA 1TAHA 4RENA 1GGNA 3DB2A 3GBPA 4U2KA 3U80A 4BBAA 5AVSA 4Y30A 1THZA 3F5MA 3N6XA 3U3ZA 5KNDD 1LJUA 2GK7A 1C3EA 2VA9A 5T3UA 5KPJA 4RNDB 4AUKA 2BMEA 4J8PA 1WB9A 3CCBA 4J16A 4CIDA 1QPZA 3W2HA 4ONEA 3LDHA 3CQ9A 4L5YA 3HY4A 4MI9A 4XCVA 2JATA 4ZVTA 2HV8A 2WTMA 3LFUA 3ZGLA 4QOHA 2BR3A 2IFTA 2Q5EA 3OTHA 4N39A 5J2UA 2EATA 3PQ7A 4UNRA 1L5MA 3ZDXB 3K53A 4FJ1A 4W4TA 3V2UA 3B9BA 3U81A 4A6DA 4R8KA 3PC6A 3ONFA 1CZUA 3WMGA 1NLYA 2HWXA 2JCGA 2OSBA 1RC8A 2ZI7A 2YNMC 3KJGA 2HH9A 1YHYA 1XMPA 4E12A 3IJ5A 4EABA 1T15A 3NT5A 4M9SA 5KTPA 4OQ4A 4BKPA 3GPCA 3R3JA 4WKCA 1RCFA 1XDSA 1XNGA 4GE0A 2WVAA 2D1TA 4KO4S 1PRYA 1V43A 1M2FA 1SBTA 3E84A 3R6GA 4NV3A 5F9MA 1X1AA 2YHIB 2IDJA 1CVRA 2G4CA 2RHHA 2FQXA 3BWDD 4WZ6A 4XFDA 4K86A 2O2XA 3DBHB 3LX5A 4QREA 2BGRA 4OSOA 1TGYA 3QU7A 1YUMA 4MV0A 2CUZA 1MIHA 4XLTA 5DEOA 3VYUB 1B2LA 1XDWA 1WO8A 4PGGA 2CB0A 3RRYA 1P2DA 2AC4A 2C3PA 2WT4A 3AV0B 4C0BA 3F0TA 1BRTA 3ZK7A 3W9YA 4DDKA 2HHAA 2GJ8A 3DV0A 2XGMA 1RM5A 1Q0SA 2Z8ZA 3FGOA 1FFSA 4JUBA 4PC2A 4B7CA 1CEYA 2NV0A 3M6AA 2OPBA 3A70A 2WSMA 3NHAA 4IICA 5AR1A 3W3ZB 4LWZA 1Q0LA 5ALUA 1N9ZA 3T0FA 4EA9A 4QJ5A 1GJRA 3OO0A 4FEAA 5CA1B 1XEAA 2XUFA 3KKEA 1NQVA 1EFCA 4LBZA 1ZIDA 3UXMA 3N05A 4LRUA 4DA4A 1LDEA 2FKAA 3HSKA 5TNXA 3JQQA 4D9KA 4ALIA 2Q3EA 1BCRB 1ML3A 3JAKB 4KREA 1USWA 2A86A 3JCZA 3EAFA 4LBYA 2R8OA 3G2JA 1S2IA 4PIPA 2B8EA 3RV3A 3WHIA 2CV1A 2DLNA 1ILEA 2AKAB 2PGNA 2Z1DA 2B25A 1Z4NA 2VO1A 3DQPA 2ECKA 5ALKA 1FFYA 4X5OA 1NQOA 5BV7A 1FFHA 1U0HC 4RANA 1SXJC 1V35A 4R0VA 4ZT2A 3GT3A 1DSSG 2Z2XA 4IPTA 3WP1B 1J07A 2O5EA 3NNNA 3NCTA 3D0RA 5F23A 2L42A 5I9SA 1NUTA 3KEMA 5BWCA 3A04A 5C7OO 1Y3AA 4IFEA 3BSYA 1G3IA 1TE2A 1NR7A 2HUNA 2OCXA 3MCAA 3TZLA 2OZLB 1MJHA 3I9KA 4ZEVA 2O7QA 1E5QA 2AJDA 5GTDA 2XYPA 3S8EA 3LQYA 4TV8B 2R4UA 4BFYA 2H54A 1DAPA 1NG9A 3WK9A 1EX6A 3QKRB 1YNOA 2BYTA 1NBEA 4KYTA 4R2IA 1Y9JA 3AWDA 3WYBA 3M0EA 4B2PA 1AGRA 2GHTA 3MW8A 3G02A 1GEGA 2HNKA 1VYTA 3BE8A 3OEWA 1VYUA 3WK8A 3TZBA 1G5TA 3C1AA 4G0QA 3QUSA 1RVV1 2O7SA 3E7WA 5C35A 5I7RA 1YOVB 5FQNA 4A36A 4IP0A 2HQ1A 1Y48E 1JLKA 2J4DA 3L6UA 3O1LA 3AHIA 1KA9H 3MPOA 4R54A 3UG7A 2ZIGA 3AW8A 4QDOA 1WF6A 4C30A 2OFWA 3LWDA 5TVGA 2PWZA 1DADA 3R7BA 1KDZA 3UFXB 4YDQA 2AR0A 3AVVA 3U5TA 4I14A 3BFPA 2J30A 5KJEA 4HPWA 3QVGA 3DLAA 4AZVA 1ECGA 2KX7A 2JARA 4EGXA 2XDYA 2FG6C 2V5VA 1KJYA 4DJFC 4DQUA 1OH8A 3IAEA 2VTKA 4RA6A 1WVGA 4TKMA 4L9SA 3EJ6A 4Y0VA 3CX3A 4X0EA 1WSWA 5LA6B 1E3JA 1PYDA 2PVCA 2C4MA 2IE8A 3ZXYA 3FVVA 1O3YA 1V11B 4CKXA 3U19A 3N70A 2I9KA 2LUOA 1WBJB 2CE2X 4KOAA 4YRBA 4R1UA 3L5OA 1IUNA 2J5RA 3PDUA 4JUAA 1GPUA 5G4KA 4E13A 2EF0A 1QDLB 5LC1A 1VCOA 1WJGA 1JJ7A 2L19A 1YBVA 3EXG2 4MAAA 2G5CA 1BQEA 3DO8A 1P17A 3G0GA 4MPJA 5LMCA 4Q3OA 4D9JA 4CV3A 1L7PA 5JNSA 4J0GA 5F52A 3GRPA 2C0CA 1LBIA 4Q4LA 1MZKA 2GCOB 4AXBA 2EQ5A 2DT8A 4MUNA 1N8KA 3AI2A 4O8CA 3KJHA 1ZD8A 3C6MA 4FXPA 4PX2A 1AQUA 4D74A 4EF6A 3BXXA 1E32A 1FLAA 1Z5OA 3EVZA 3O90A 1ND5A 3QBTA 1OTXA 1Z2OX 3GAFA 3NFRA 1M5RA 1FNSA 3DZDA 4H4EA 5EJ2A 3UJ8A 4CI9A 3MD0A 4HZUA 4WWHA 5EHNA 1JQKA 4YA6A 1WXIA 1OWNA 1KPGA 3IDOA 2RI1A 3S81A 1XTKA 1XV5A 2Q5QA 1JIKA 1L7VC 2FW9A 3B9RA 4LHXA 3ZDQA 3FUVA 1WF3A 3OKPA 1CRWG 4XYBA 3W5UA 2Z3VA 3TMAA 3UEOA 5FULA 1L1QA 4DUGD 2P6MA 4OHXA 1BA3A 4RZSA 4XAQA 1FRQA 2WU3A 5H3HA 2ATIA 4ADSG 5FOXA 3QYAA 4FE3A 1W5TA 4XUEA 5KNBD 4N8DA 1F06A 2ZIUB 3EX7C 4J1TA 1L4MA 3E6AA 3DSRA 4HLUA 4K6MA 3RFVA 4BMYA 4DNQA 3BPSA 2ZKLA 4FE4A 5KNCD 1MFZA 1PW7A 3THRA 2FHSA 4C7VA 1J8FA 3A6JA 4EYGA 1SG0A 3R3UA 2QT1A 1E2EA 4XD2A 4NJMA 4A92A 1GTVA 4EITA 1DV1A 1JPNA 5EMKA 3EXHA 1AKWA 5HM8A 2R85A 1NXOA 1ZM2A 3Q1KA 4UW9A 4FYPA 1RMTA 1NF9A 2I71A 4Z3KA 4BU0A 1T3HA 3AIIA 1FDWA 2P6PA 1F51E 1LBEA 4M36A 1FS5A 1N8TA 5IKOA 4AD8A 1QBGA 3WL4A 5L51A 1EXMA 2VAVA 4L27A 4BNVA 2DUNA 1SVSA 3GRYA 3TINA 3X3HA 2IODA 4CM9A 4M46A 1MW8X 1RNLA 5THQA 1Z5GA 1M34B 1UBTS 3L0PA 3V4FA 1W6UA 3R3SA 5D3MB 4GDMA 3DE7X 4H7KA 3F73A 3FZYA 1H69A 2CXTA 1Q0PA 3EIOA 2DUWA 1UBRS 2IPLA 3F78A 2B2NA 2K5UA 4XM2A 5IUKC 2W2LD 3I1YA 1PFQA 3I6ZA 4CV1A 4M1WA 3AWIA 2O3RA 2PY6A 3F8SA 1LI4A 2Y99A 4WV3A 2QZPA 3TLJA 3AVYA 1Q1NA 1QP0A 1D04A 1Q0QA 2ZZNA 1U11A 1XEXA 5AM4A 3MGAA 2G71A 1GCOA 2HW8A 5SYAA 5CFNA 4O4IA 2E5WA 3VR2D 2PGJA 4J4TA 3CFYA 4X97A 4LRYA 4BFCA 3CVWA 2DPXA 5BQ5A 3ZKWB 3JASB 3L7NA 4ND6A 1TUBB 4IIJF 1GAQA 3SHQA 3GT0A 3C3MA 1YR2A 2P3OA 1RSZA 2W48A 4EO4A 2C97A 3CO5A 2R5NA 3BMXA 1P4RA 3DE2X 4CI0B 3GRAA 4P53A 2J0UA 3VISA 1K8XB 1DCMA 4D8TA 4EBBA 1ZJWA 3EGCA 3W5JA 1H3EA 1FJHA 2ZSIA 2EEZA 3WKAA 4QFMA 3LT4A 4TTRA 3IT0A 4LZOA 5E3JA 4WXPA 4BVGA 2QW1A 5DTRA 2IBTA 3V6LA 3T1NA 2QLNA 1IG3A 4BMXA 4JJEA 4V0OA 1KPIA 3VU8A 4DSZA 4L75A 1SO8A 1WMBA 1WDMA 4GQIA 2D1FA 5EI5A 5ADVA 4GPEA 4IDNA 2CEAA 1K06A 4HQRA 3TCNA 1BDBA 1ZKMA 4CLRB 1Q95A 4I36A 4PG8A 2A0TA 1H8HD 4PLCA 4RGYA 5HE8A 4ZZ1A 1JIVA 1ISJA 1LFDB 4MI6A 5KJ1A 5HFNA 4QUAA 4AY2A 2XB4A 3QBVA 1I4WA 1KETA 2IYTA 4ARAA 4FT4A 4C04A 4H6XA 4KLZA 3W5IA 5TQ0B 2B98A 4UNIA 5TE9A 4QEKA 3A9UA 3AY3A 3QLUC 2HM7A 1ISFA 2WD8A 3EPHA 4YAIA 3B7GA 5LZ8A 5I3ZA 4H7DA 3DJFA 2OGSA 2XUDA 5HJ5A 3CRQA 2C57A 4YCBA 4BMPB 2V0GA 3H65A 4LRXA 1V47A 5EVJA 4LF8B 3UENA 4OHWA 4KNWA 5BWLA 5CFQA 2EP5A 1UJ4A 4Q47A 2H5JA 3CF2A 5JTTA 1H9BA 1V3UA 4NEGA 2XMZA 3PLRA 4P4LA 2LKCA 5FO1A 5C4IA 1ZP6A 1U3FA 1AA9A 4FFVA 1FPQA 1GQOA 2FZGA 4GI1A 2QPAA 4RVOA 1TLLA 1UDCA 1IZZA 4C21A 3L7KA 4GZ3A 1KYWA 5JASA 3BTSA 1A5AB 3JD2A 2H8KA 2H65A 1JLLB 1H93A 2OHHA 3TAUA 1WZNA 4HDCA 1T2EA 3SX4A 2PWAA 2YFHA 1Y3HA 3YASA 3FHLA 4IDDA 4M37A 3MT9A 2LCFA 2VHXA 1F5NA 4DMMA 4DXAA 3AVXA 4POAA 4KUGA 1ISMA 5LXTF 2CHVA 5JQWA 3H6HA 4PHCA 1G38A 3TLAA 3CF4A 2PH3A 3T34A 4RXMA 5EJ8A 2HRQA 2OK7A 721PA 1SBIA 2A9FA 3DOUA 1EWRA 4WMLA 1A5BB 3GJSA 5EE1A 1RI5A 1QFZA 1GPLA 1GA6A 1R3UA 2IGBA 2XOKD 2DHRA 3K0AB 1XRRA 1NMEA 5LVAA 4GPIB 4LRWA 3UHOA 5DNAA 2ZE6A 3UMBA 3IJPA 3KM0A 3OQPA 5FBZA 3G79A 2WE7A 3GRKA 4J6FA 1VI5A 2OV8A 2VDUE 4C7OB 5K4HA 4WOKA 1KU6A 4M6WB 4JC4A 5TS2A 3BFKA 2FZCA 1GY8A 1R18A 4B44A 1RWWA 2ONZA 1X3LA 2QUKA 2PA0A 3HN2A 4UUMA 4ZOCA 3UN1A 2QP3A 4YR7A 3B5IA 3DHNA 1FRNA 3DP7A 2VHZA 5K0ZA 1E1CA 3L84A 4D57A 4PCLA 1L7EA 1XA0A 1F4PA 2PX6A 2ZBPA 3GO4A 4BXOB 3VPHA 1P75A 5FNVB 4F6LA 1PUIA 2B3DA 3R5JA 3GX1A 5DASA 4HLQB 1VJGA 2YZGA 1CZHA 3E48A 3GGSA 4YJ2B 1HQKA 2V5AA 2LKDA 2CHEA 3GJ5A 4PANA 3SYMA 4PZCA 1KEKA 4DR1B 1YA6A 1QTRA 1UMDB 3C5VA 4IIUA 4KGXA 4TRNA 3RKUA 3UUGA 3VAAA 1L4KA 4EHDA 2A1IA 4CL2A 1CUFA 4NNPA 5E7JA 4Z0NA 3Q3VA 3U1TA 3ROQA 3LPNA 4WLFA 2CNWD 4L8LA 3BDVA 5JBQA 2A5GA 3RSLA 2PSEA 4UEOA 3WNDA 1N6RA 3VA7A 4D6PA 2PPLA 1QH1A 1II8B 3ADKA 4ETNA 4Y1EA 1K7FB 4LF4B 2JJ1A 1NSYA 3HHPA 3WO1A 4PZAA 3V4SA 4QT0A 4Y2SA 3CONA 4P1ZA 5BMVF 1GVNB 1X1SA 5E6UB 4ARCA 2NUPB 2YVKA 3A3PA 5BV0A 3S2ZA 3ZHRA 2FEAA 3GLGE 3T54A 4CPDA 1IBSA 1C3OA 3PWSA 3P2KA 3X0DA 1YR8A 5FBVB 4LY0A 1D9ZA 1XLVA 5K2MA 1WKBA 2EOAA 2VWQA 2WUEA 1K6MA 2AKEA 4C4RA 1F0PA 1UMKA 2HSGA 2ZTHA 3JQAD 4NTZA 4O4HA 1VCIA 3HG7A 4JL5A 5CLIA 2W6IA 5LUAA 2ZR7A 3B53X 3NPAA 4FNAA 4PCAA 2PGAA 4Q15A 1A9ZA 1PFGA 1EX7A 2X1HA 3KKOA 4AFNA 4X6LA 5AUNB 5BN4A 1EU1A 1VPVA 4PS1A 4GDFA 4LC1A 3D8NA 5JCZA 1BMFD 1OWMA 4DQ0A 2XWBF 1QZ3A 3RHZA 3LD9A 3LUKA 2DJIA 4A1OA 5DSTA 3I01A 3UNXA 4AWBA 1L8AA 3QK7A 3IUPA 1JU9A 1TM4E 2X86A 2K4MA 1NAIA 1WLSA 2VPIA 3PC4A 4K6FA 1GTG1 1JGTA 3U37A 2AYZA 2W93A 4MQBA 1TIPA 4BO7A 1OPRA 1A82A 2CF6A 4R9RA 1TNDA 3TPFA 4R1MA 1RWNA 4Q4AB 3IUJA 2R5WA 1CUSA 3IUMA 4HDMB 1PGOA 2OXEA 3WK5A 3GVXA 4EJSC 1ULBA 1EUCB 4FD3A 4G9EA 1Y8AA 3U4DA 5ECWA 4I1YA 3WQRA 1I2AA 1IVNA 1DWUA 3VR1A 4DV5B 4F04A 4ZO8A 4LFBB 1QIFA 3EEIA 5JI3E 3I58A 2PIDA 3NVAA 4BGVA 1KE1A 3S68A 1IE3A 1TT5A 4GBJA 1SRQA 4GMDA 4EENA 1A8QA 1OSNA 1Z0DA 1M10A 4GSLA 2BI8A 4I1PA 4HGQA 4NX2A 1HDCA 4JQZA 1IH8A 3JPYA 3PC2A 2F3TA 4GZ6A 4KI0A 1TZCA 4ZO6A 1PX2A 1WKVA 2A5JA 5CB8A 6ABPA 2XBUA 1ICEA 2HBQA 4Z0HO 4WRRA 4ZGWA 3I5MA 3QBJA 4Q24A 4XEHA 3TQTA 4CLEA 3FVQA 3KLNA 1R12A 1N1MA 1MVLA 1Y81A 3SBDA 4ZO4A 5TPWB 2VWPA 2I87A 3DNMA 4FW8A 2A0WA 5DWQA 1T29A 1T8TA 2WUGA 1YR9A 3JZMA 1DB3A 2PAAA 3AFHA 3PXCX 2YWBA 3CSSA 2UXCB 1GTRA 3IOCA 3RT9A 1X7WA 4ZYXA 5CBPB 2I80A 1DAOA 1WDWB 1KP3A 5AW4A 1P7PA 1RLMA 2DBVO 4RTRA 4RADA 1U9IC 2JK0A 3SLGA 1HT0A 4R0NA 2AOWA 2PJZA 4DRZA 2EARA 4W99A 5EEGA 1Q12A 3KT3A 2AB0A 2AX4A 1B1AA 3H9EO 3FTNA 4KNYA 3M6FA 3C6QA 1IK4A 1HE8B 1WCIB 3BYZA 5E3IA 1YTUA 3P0FA 3W2EA 4DAEA 2HWWA 3ANSA 2R7AA 1OXUA 1JHDA 4RULA 3ZI4A 1GDTA 4XPZA 4YUAA 4RPKA 4RVFA 4A0HA 4JX8A 3TSYA 2J87A 2ZBEA 4P0PB 1PZNA 2P4HX 1FPMA 2D2XA 3IAS1 3H2KA 4HFNA 1U6JA 3M2PA 4WNIA 3OCWA 2X6TA 3SOPA 1MVOA 5KX5B 2QD2A 4GC5A 2XPCA 5IM4F 5HRUA 3BKXA 2YZ2A 4J4BA 2QAGC 2Z5LA 5DTQA 1F20A 1XTJA 2RGNC 5I7OA 3FPHA 3PBKA 1U8EA 5JO0A 3G2MA 2MSWA 2VDKB 1LDMA 5JRZA 1QFXA 2GJ4A 2ODPA 2JGMA 1R0LA 5CHYA 5G53C 1KZ9A 1JFSA 1C4OA 5LP6B 3DZJA 2I2CA 1J8QA 3I1IA 4QLOA 3CZMA 2GEJA 2H59A 3PKIA 3OF5A 3FPBA 1L5WA 3DONA 2Q2NA 2I7CA 4IDEA 4RACA 5GPBA 2NP6A 5ALVA 2CJFA 4OJNA 3H0CA 5EZ5A 1C7QA 1JEJA 1QK5A 3O84A 1Y5MA 4U5XA 4BQPA 3MG9A 1HMPA 1SUFA 1JI3A 3PPVA 3K6RA 4EZBA 2VPPA 3RRNA 3RS4A 4CFSA 4WVLA 5J43A 2ZU6A 1DQSA 3R41A 3EVNA 4CT0A 3TCXB 2B1QA 3NAMA 3U49A 1FW6A 3FHTA 2IP1A 2ZAYA 1HA3A 2FZKA 3LTEA 5ALFA 5FOSA 3I6YA 4E2ZA 4O4LA 2VCEA 2FQYA 5JEEA 1N5KA 5BWBA 4JUFA 1PSWA 1PHRA 3UK1A 5AQ1A 3L8DA 1JAIA 4ZIRA 2NTJA 3SE7A 5LU8A 1CUZA 1SM4A 2CMDA 3EWSA 5SY9A 4C0XA 3DVRX 4MGZR 4QBFA 3K71B 1CUJA 1XP8A 3PCXA 3EPKA 4RORA 1EESA 2H0AA 1G6GA 1IUKA 3H2BA 2L69A 3BFJA 1NBMA 3S1AB 3QEBZ 1DXQA 2HCFA 2I6XA 1SC9A 3CWCA 2WF8A 3JRXA 1EWVA 1N32B 1TJNA 2EX0A 1Y63A 1R6BX 2IQ5A 1FDIA 2RGGA 2VK1A 3PFCA 4G56A 1FL9A 3ZWDA 1SUEA 2QYHA 2EL7A 1MOPA 4X7RA 5LBIA 3IDFA 1KFKB 1SVLA 4H6WA 1GZHB 5DBEX 3M6VA 1DINA 1FFEA 2AVNA 3I5UA 2XQVA 3IP7A 3F4LA 3PZBA 3RPEA 3U62A 5HNKA 3OSZA 4B4UA 4DMCA 2QT9A 2XQJA 5GZ3A 2YXPX 2W2TA 3D7MA 4QRHA 1GNQA 4MRNA 3I9OA 5FPPA 2B92A 4J91A 4OVKA 1D4ZA 1UP4A 5I8ZA 3KYCB 4LQCA 4BVBA 1T8YA 2ZUDA 4Y2UA 3SZGA 4WBNA 2JCBA 3IV7A 4MB2A 1N1GA 4ZANA 3RTCA 1KO5A 4JYCA 2E82A 4M55A 2VH2A 1Y4DE 4YT4A 2FOLA 2X4LA 2A57A 2VUHB 1M2JA 2X0KA 3ETHA 2CD9A 4UUQA 2AFHE 1DKNA 4Q93A 1EUDA 1XQ6A 3CZPA 1VC2A 4PV7A 3W9BA 1MV5A 1VLHA 3HB9A 3L7IA 4NABA 3SR0A 2GSDA 4ID3A 5CBKA 3SZMA 1F2VA 1O6FA 3ZJ4A 1ZM7A 3WYDA 4PFQA 5EFOA 1DAIA 3PYMA 3MB5A 1SKYE 4ZT4A 4BJHB 3PEWA 1U7VA 3RBXA 2XXAA 1O8BA 1U04A 4ZVMA 3DF9A 5J2UB 4JLNA 2E6KA 4Y2TA 1E7RA 3OUUA 4HDOB 2ZKIA 1IAVA 2PTHA 3KE9A 3CG0A 4MWBA 4UE2A 1PO7A 2CVZA 5CRIA 3ZCPA 4E5KA 2Z56A 2X2PA 4U6SA 1DKQA 1I3NA 1WG8A 2BBWA 3LAWA 1G8GA 1SWVA 4KR0A 3RIMA 4AZTA 1IAQA 1U0EA 1CJTC 1CKEA 1X6VA 2VCYA 1I6WA 1R74A 2AKYA 2WJ3A 4J9UE 1X42A 5EJGA 2FWBA 2XTZA 2VRCD 3GQBA 3QVMA 4RIGA 4XQGA 2QQFA 4ILKA 1O97C 3PXBA 1ZU5A 1P1KA 2JF0A 1QR2A 3GLIE 2N0SA 5A6SA 3LCVB 1UC9A 1BMQA 3CN7A 3L4EA 5BN5A 3D81A 3G0OA 4Q3NA 4UCXA 4ZVNA 3R7AA 1OAOC 5FR2A 2D62A 1N92A 1XUOA 4RXTA 2BHNA 4JB3A 5MN5A 2XVMA 5KVVA 4A15A 1BE8A 5A2GA 1PJZA 1U7TA 2AFIA 1K2WA 4IYRA 4RJKA 3FYUC 2ZJFA 3B5EA 3D4OA 4JBGA 5CTJA 3N8HA 3WZMA 4TS3A 2FR8C 3P5BA 4YV7A 3DV0B 1V7QA 3AM3A 3IERA 2JZCA 1WUKS 1XE3A 3TM5A 1G21A 2GXAA 4F72A 1U7HA 2YY7A 2P62A 2PMWB 4HX9A 4CLOA 3ANYB 2PT9A 2YOGA 3Q9SA 3EDCA 4NECA 3GOQA 4PXYA 3TLCA 3DWIA 4YP9A 2P2LA 1WUYA 3E2PA 3SJZA 2DP4E 4KYUA 6GPBA 2ZSDA 1RPTA 4MVJF 1DX6A 4XQCA 1SXGA 2DWOA 1TMYA 3KV3O 3SC6A 5B6JA 4RTQA 3BSFA 4MGKR 4W8HA 1JHAA 2ZXEA 5E1OA 4QM7A 5MFPA 1F7VA 1E1RA 4LNUA 3JAWA 2FOIA 4ZPJA 1Q5PA 3RC9A 3STTA 4JITA 3V34A 4RY8A 1U7WA 4JEMA 4X7PA 4HB2A 3O8LA 4Q9LA 3HZZA 4HLDA 2VAWA 4WDRA 1E8MA 5EPUA 3UT6A 2KB4A 4YUXA 3I39X 3VZSA 1J49A 2HSDA 2BP7A 4LTNA 1DVRA 1UK9A 1QYCA 4TTQA 3V7NA 4HH0A 1XLTC 4M1QA 1PU2A 3T5GA 2JHGA 5FI3A 4UTRA 5B1EA 2WNHA 1MJSA 2RH8A 4QLAA 4IH1A 1N7HA 1B8UA 1LTQA 1QHYA 4OGGA 2Z9CA 3U3MA 4IHJF 2XJ9A 3K9HA 5FJIA 2IWHA 5BNTA 5J5VA 1ZLYA 4YX9A 5DK6A 1JAYA 2Q3MA 1P4SA 3LXRA 3TNFA 3OLYA 4G86A 3D3QA 5MFZA 3JQCA 1SK9A 2YH2A 1UBUS 4XYLA 2J3MA 4WESA 1CU1A 1OFIA 1PR4A 1RHQA 5GWXA 1EKXA 1W2GA 1QKKA 3X44A 3EUWA 3U60B 1NX6A 3ZGZA 2JVIA 3D02A 1WXGA 3PPYA 5JZVA 3E3NA 1UPXA 4QXQA 3RM3A 1NNSA 1NQ5A 2HMVA 3K2BA 1PQ4A 1GG5A 1UAGA 2PBRA 2Q4OA 2CVOA 3IFSA 4O25A 4YECA 4YN3A 5TMDA 2XMDA 1J9ZA 4OHPA 5CG1A 3BZBA 2VIIA 1E7WA 4HB0A 1PS9A 1TQ2A 2AXQA 1KIFA 1ZOQA 4BLUA 5IMSA 4BAUA 5F33A 3WMXA 3DD1A 2HSEA 4NHOA 3AB3A 3WDSA 1T3TA 3ZWXA 2DCMA 2XB6A 3ZZ0A 2IPAB 4JYPA 1JMVA 1RZUA 3FPKA 3M89A 3R44A 5EP3A 4BQFA 2JPEA 4DYHA 4R31A 3KSAC 1I94B 4ZRMA 1QOPB 521PA 2ZS8A 4DIDA 4YVFA 4LJ5A 3LPDA 3QVGB 5HDBB 3B8EA 2L17A 3GVHA 4LHYA 4RKEA 1EBUA 4W1QA 4R8RA 1HLFA 4KAFA 3AZQA 5T64A 4RA6B 3VV3A 3TOXA 4XTRA 4LZWA 1MAAA 4EKYA 4QOEA 3BHJA 3LQ4A 1I10A 5INTA 1X87A 1PN3A 4HWSA 1Y98A 2OV2A 1DMSA 2C78A 3S99A 1Z4JA 3U13A 4F56A 1FQOA 3KHKA 1BX1A 1DBPA 2XMBA 2N1MA 3X1ZA 5FL3A 2AJ8A 3HH8A 2E4AA 2HY7A 2JIMA 4W63A 3AR7A 2GS9A 4WUVA 1P9RA 2F55A 1FJ2A 2FEZA 5ARDA 1I30A 1RYFA 5G4KB 4RJTA 3EUFA 3OIGA 3PUVA 4J6EA 4XX1A 5DSZA 4YT8A 1OKKA 4X1IA 5K0JA 1YE8A 1M2VA 3K5WA 2GPBA 3Q9NA 4G0UA 1KI3A 2E7ZA 4PSUA 5CPBA 2P90A 2W2QA 1PWXA 2C95A 1JFFA 2TMKA 3BBPA 1NU6A 4R7GA 3AINA 1KAOA 1PTJA 3H6GA 1Y34E 4PO8A 1QOQB 3F71A 2AOTA 1LK7A 1RHMA 2B1GA 3FWZA 4K6GA 3TLBA 5BNWA 1G5IA 3GDHA 3IPLA 5KVAA 1KE2A 3N3AC 4ZI3A 2PLRA 3A9VA 3CLTD 4QBIA 1E0JA 1PDOA 4HZUB 4M1YA 1EDEA 4HCJA 4S0XA 1E5TA 2V96A 1INLA 1EUQA 2WYVA 2GBGA 2V9CA 3DE1X 2R1UA 3WLNA 4E70A 2PKYX 3MMPA 4KKVA 1VBFA 5JH7B 2PK3A 4L4RA 3KKPA 4DC0A 2ZEJA 4IDFA 1ZRSA 4DNPA 3U44A 3BICA 4FGKA 3GEHA 1DELA 4IEFB 4Y9RA 2OCGA 2Z57A 1DFIA 4GE3A 3CLRC 4NHEA 5DJ5A 4GL4A 1PAUA 1P73A 3E18A 4BLRA 2BDEA 4BZPA 4HBZA 1FX1A 1LPOA 3DMNA 5DMXA 3U4CA 4KPEC 3T4EA 2GYUA 2XCLA 3MT8A 1PDVA 1NW6A 3H9UA 3IPCA 5AW0A 5KQMA 4LZZA 4LWPA 2OZEA 4FHFA 1QYRA 2CL0X 2OR3A 3GV0A 1HY3A 1AK9A 4IOMA 2GARA 4EUFA 3C15C 3ON5A 3QRWA 4NJMB 3BG5A 1TUIA 1HYGA 3O75A 5GZ6A 3EXHB 1Z6QA 5JWOA 4EO7A 2C1ZA 1XI2A 3WNZA 4UD2A 3VAZA 4CXMA 4OLJA 1NJGA 4TVKA 2V6IA 4OMFG 1R6UA 4JVLA 4DLKA 4S05A 5A0FA 1QTNA 3KLOA 1Z4QA 2QZJA 3LIPA 1O6BA 2QRNA 4XJXA 1TFUA 2B83A 3P9CA 2Y1FA 1BHO1 3N7UA 3OHPA 4IGKA 1O9HA 4C87A 5LNK1 4MJLA 4DGSA 2Q8QA 4K26A 2EYQA 4HYQA 3ZWNA 1Q7TA 4FYJA 4F5ZA 4DLAA 5FAXA 1J4QA 2MSKA 1ZYUA 3OQNA 1I7NA 4RLQA 1AZWA 3KJIA 1NPYA 1Z6AA 3C0KA 4M38A 3IE2A 4ZCLA 4G41A 3FHJA 1SXIA 4CMGA 3FNIA 3CRMA 1KSJA 1HZZA 1LBQA 5BYBA 3AM5A 1DQRA 1GG8A 3PRKE 4RMJA 3ZH2A 3QEOA 5IBCA 3NNSA 3HKBA 5LLTA 3EVEA 2O07A 5F5LA 4Q82A 1XEXB 3EVAA 3W8NA 4IY1A 3TR0A 2AFVA 2C0PA 5A04A 1HDZA 3MWFA 3QTLA 1C3XA 2IXDA 2PX5A 4O4IB 4QRDA 4M0KA 3LQFA 1YIAA 4U8GA 3OCZA 3LDUA 2C96A 4KFRA 4M8KA 1FMCA 2W2KA 3HJUA 2ZCVA 3CR8A 1RI3A 1J21A 1FVXA 1W44A 2YCLA 4EK9A 2IUSA 4OV6B 1GL3A 1XO1A 1S2MA 5HXAA 3C3KA 1SVIA 1VI6A 2VDJA 3G8CA 3G2IA 4UBIA 3UM9A 4E4RA 2BTEA 3BJMA 1PZGA 1QLJA 2OUKA 2XLBA 3A4TA 2G82A 2J0UB 1O5IA 1Q0HA 2C7GA 4JI2B 2C8LA 1VA5A 3DVAA 1ZRNA 2ANBA 2J07A 4OGKA 2IV7A 4Z7JA 4BV2A 1RXYA 4FK8A 4X3OA 2WJPA 4MUMA 4ASUD 2WIBA 5DNVA 3PR3A 5BW8A 1VGVA 2XYHA 5IXYA 4B09A 2WIDA 2EZ8A 2XMPA 3UBMA 5JSQA 4D0GA 1ZDMA 3FWKA 3O91A 2ZI6A 4QJ3A 1Q7BA 3WMEA 2RGRA 5CXQA 2B4KA 3E1KA 3OZTA 1S02A 5EPEA 3WWOA 3DOCA 1VSTA 3MELA 3GH1A 3NTRA 5AHKA 5KWEA 3P9XA 3Q88A 4JJGA 1KKLA 1EBFA 3AM4A 1E4OA 3QIVA 4ZO9A 5F73A 4ZKDA 2J9YB 1ZN9A 3GFVA 1VPDA 4PINA 3KB2A 1VL1A 1GRNA 4S24A 2JLBA 3IT1A 3QWAA 2POCA 4KQKA 2Q27A 2KHZA 4AO8A 3CJQA 2W4IA 1KI9A 3B6ZA 3PCTA 5FWXA 4JSTA 1G3RA 4WFIA 5CFRA 1YH3A 1GGHA 1FU7A 1QGUA 5CJJA 3K5PA 5FBHA 5GQSA 2ZRCA 3KTOA 2BZ0A 5EHGA 2VYVA 4ZI5A 3L6RA 4RL6A 3FHOA 4MLPA 3MJVA 3JU3A 3Q0TA 3ZZUA 1PG5A 4IG9A 2AG6A 1T8SA 1NN5A 3H5VA 1E6UA 5HIJA 1R0YA 3AR3A 3BMCB 2C20A 1BXKA 1LBTA 1XQ9A 3ISTA 4C2TA 1Z4MA 4W6QA 3O21A 2ZJAA 1O9BA 1ZRMA 3SMVA 3T1QA 4ALJA 4AZSA 5B36A 3SKXA 5K3CA 3NBXX 1M2EA 3K31A 3N2NA 4O1HA 5CP8A 2C2ZA 4DKJA 3H83A 3V7FA 5AYVA 4U2GA 4RVDA 3SZRA 3U48A 4DDUA 1MP0A 2P9TA