1YXEA

Structure and inter-domain interactions of domain ii from the blood stage malarial protein, apical membrane antigen 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
140
structure length
140
Chain Sequence
b'MRGSHHHHHHGSNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTGAFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords apical membrane antigen 1
publication title Structure and Inter-domain Interactions of Domain II from the Blood-stage Malarial Protein, Apical Membrane Antigen 1.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 11
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2005-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1yxeA01
2LL3A 1HKYA 4APLA 4R1BA 5EODA 2J8JA 5COEA 2J8LA 5CT3A 2YIPA 3HN4A 5CSQA 4DURA 2YIOA 4IUAA 3HMRA 2YILA 4UV6A 5CT2A 1BHTA 4APMA 4Z0EA 1W81A 1NK1A 3HMSA 4R19A 5CS3A 1YXEA 3SP8A 3SRJA 4Z0FA 2Y8RA 5CP9A 2HGFA 3SRIA 3ZLEA 1GMOA 4UAOA 4R1AA 5I25A 5CS5A 1GP9A 1W8KA 4Z09A 2Z8WA 1I8NA 2Z8VA 2Q8BA 2LL4M 3MKPA 3ZWZA 1Z40A 5EOKA 1GMNA 2X2ZA 2QJ2A 3HMTA 2QJ4A 4A5TS 5CS9A 5CS1A 5CT1A 2F83A 4R1CA 2Q8AA 2K13X 4Z0DA
chains in the Genus database with same CATH superfamily
2KL5A 2LL3A 1HKYA 4APLA 4R1BA 5EODA 2J8JA 5COEA 2J8LA 5CT3A 2YIPA 3HN4A 5CSQA 4DURA 2YIOA 4IUAA 3HMRA 2YILA 4UV6A 5CT2A 1BHTA 4APMA 4Z0EA 1W81A 1NK1A 3HMSA 4R19A 5CS3A 1YXEA 3SP8A 3SRJA 4Z0FA 2Y8RA 5CP9A 2HGFA 3SRIA 3ZLEA 1GMOA 4UAOA 4R1AA 5I25A 5CS5A 4YIZA 1GP9A 1W8KA 4Z09A 2Z8WA 1I8NA 2Z8VA 2Q8BA 2LL4M 3MKPA 4YIVA 3ZWZA 1Z40A 5EOKA 1GMNA 2X2ZA 2QJ2A 3HMTA 2QJ4A 4A5TS 5CS9A 5CS1A 5CT1A 2F83A 4R1CA 2Q8AA 2K13X 4Z0DA
chains in the Genus database with same CATH topology
2KL5A 2LL3A 1HKYA 4APLA 4R1BA 5EODA 2J8JA 5COEA 2J8LA 5CT3A 2YIPA 3HN4A 5CSQA 4DURA 2YIOA 4IUAA 3HMRA 2YILA 4UV6A 5CT2A 1BHTA 4APMA 4Z0EA 1W81A 1NK1A 3HMSA 4R19A 5CS3A 1YXEA 3SP8A 3SRJA 4Z0FA 2Y8RA 5CP9A 2HGFA 3SRIA 3ZLEA 1GMOA 4UAOA 4R1AA 5I25A 5CS5A 4YIZA 1GP9A 1W8KA 4Z09A 2Z8WA 1I8NA 2Z8VA 2Q8BA 2LL4M 3MKPA 4YIVA 3ZWZA 1Z40A 5EOKA 1GMNA 2X2ZA 2QJ2A 3HMTA 2QJ4A 4A5TS 5CS9A 5CS1A 5CT1A 2F83A 4R1CA 2Q8AA 2K13X 4Z0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL3 A;  1HKY A;  4APL A;  4R1B A;  5EOD A;  2J8J A;  5COE A;  2J8L A;  5CT3 A;  2YIP A;  3HN4 A;  5CSQ A;  4DUR A;  2YIO A;  4IUA A;  3HMR A;  2YIL A;  4UV6 A;  5CT2 A;  1BHT A;  4APM A;  4Z0E A;  1W81 A;  1NK1 A;  3HMS A;  4R19 A;  5CS3 A;  1YXE A;  3SP8 A;  3SRJ A;  4Z0F A;  2Y8R A;  5CP9 A;  2HGF A;  3SRI A;  3ZLE A;  1GMO A;  4UAO A;  4R1A A;  5I25 A;  5CS5 A;  1GP9 A;  1W8K A;  4Z09 A;  2Z8W A;  1I8N A;  2Z8V A;  2Q8B A;  2LL4 M;  3MKP A;  3ZWZ A;  1Z40 A;  5EOK A;  1GMN A;  2X2Z A;  2QJ2 A;  3HMT A;  2QJ4 A;  4A5T S;  5CS9 A;  5CS1 A;  5CT1 A;  2F83 A;  4R1C A;  2Q8A A;  2K13 X;  4Z0D A; 
#chains in the Genus database with same CATH topology
 2KL5 A;  2LL3 A;  1HKY A;  4APL A;  4R1B A;  5EOD A;  2J8J A;  5COE A;  2J8L A;  5CT3 A;  2YIP A;  3HN4 A;  5CSQ A;  4DUR A;  2YIO A;  4IUA A;  3HMR A;  2YIL A;  4UV6 A;  5CT2 A;  1BHT A;  4APM A;  4Z0E A;  1W81 A;  1NK1 A;  3HMS A;  4R19 A;  5CS3 A;  1YXE A;  3SP8 A;  3SRJ A;  4Z0F A;  2Y8R A;  5CP9 A;  2HGF A;  3SRI A;  3ZLE A;  1GMO A;  4UAO A;  4R1A A;  5I25 A;  5CS5 A;  4YIZ A;  1GP9 A;  1W8K A;  4Z09 A;  2Z8W A;  1I8N A;  2Z8V A;  2Q8B A;  2LL4 M;  3MKP A;  4YIV A;  3ZWZ A;  1Z40 A;  5EOK A;  1GMN A;  2X2Z A;  2QJ2 A;  3HMT A;  2QJ4 A;  4A5T S;  5CS9 A;  5CS1 A;  5CT1 A;  2F83 A;  4R1C A;  2Q8A A;  2K13 X;  4Z0D A; 
#chains in the Genus database with same CATH homology
 2KL5 A;  2LL3 A;  1HKY A;  4APL A;  4R1B A;  5EOD A;  2J8J A;  5COE A;  2J8L A;  5CT3 A;  2YIP A;  3HN4 A;  5CSQ A;  4DUR A;  2YIO A;  4IUA A;  3HMR A;  2YIL A;  4UV6 A;  5CT2 A;  1BHT A;  4APM A;  4Z0E A;  1W81 A;  1NK1 A;  3HMS A;  4R19 A;  5CS3 A;  1YXE A;  3SP8 A;  3SRJ A;  4Z0F A;  2Y8R A;  5CP9 A;  2HGF A;  3SRI A;  3ZLE A;  1GMO A;  4UAO A;  4R1A A;  5I25 A;  5CS5 A;  4YIZ A;  1GP9 A;  1W8K A;  4Z09 A;  2Z8W A;  1I8N A;  2Z8V A;  2Q8B A;  2LL4 M;  3MKP A;  4YIV A;  3ZWZ A;  1Z40 A;  5EOK A;  1GMN A;  2X2Z A;  2QJ2 A;  3HMT A;  2QJ4 A;  4A5T S;  5CS9 A;  5CS1 A;  5CT1 A;  2F83 A;  4R1C A;  2Q8A A;  2K13 X;  4Z0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...