1YXEA

Structure and inter-domain interactions of domain ii from the blood stage malarial protein, apical membrane antigen 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
140
structure length
140
Chain Sequence
MRGSHHHHHHGSNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTGAFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords apical membrane antigen 1
publication title Structure and Inter-domain Interactions of Domain II from the Blood-stage Malarial Protein, Apical Membrane Antigen 1.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 11
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2005-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1yxeA01
3HMTA 5CS1A 5EOKA 3SRJA 2YIOA 3HN4A 3MKPA 2HGFA 3SRIA 3ZLEA 4Z0FA 1GP9A 1GMNA 3SP8A 2QJ4A 2Q8BA 5CP9A 2J8JA 2LL4M 2YILA 4R1CA 1GMOA 5CS3A 2Q8AA 2K13X 2F83A 4DURA 1NK1A 3HMSA 4A5TS 4Z0DA 1I8NA 2X2ZA 4R1AA 5CS9A 5I25A 4APLA 2YIPA 3ZWZA 1YXEA 4IUAA 2Y8RA 5COEA 1Z40A 4Z09A 2QJ2A 5CSQA 5CT1A 2Z8VA 4UAOA 1BHTA 5CS5A 3HMRA 1W8KA 4R19A 4R1BA 2J8LA 4UV6A 4Z0EA 4APMA 5CT2A 1HKYA 2Z8WA 5EODA 1W81A 5CT3A 2LL3A
chains in the Genus database with same CATH superfamily
3HMTA 5CS1A 5EOKA 3SRJA 2YIOA 3HN4A 3MKPA 2HGFA 3SRIA 3ZLEA 4Z0FA 1GP9A 1GMNA 3SP8A 2QJ4A 2Q8BA 4YIVA 5CP9A 2J8JA 2LL4M 2YILA 4R1CA 1GMOA 5CS3A 2Q8AA 2K13X 2F83A 4DURA 1NK1A 3HMSA 4A5TS 4Z0DA 1I8NA 2X2ZA 4R1AA 5CS9A 5I25A 4APLA 2YIPA 3ZWZA 1YXEA 4IUAA 2Y8RA 5COEA 1Z40A 4Z09A 2QJ2A 5CSQA 5CT1A 2Z8VA 4UAOA 1BHTA 4YIZA 5CS5A 2KL5A 3HMRA 1W8KA 4R19A 4R1BA 2J8LA 4UV6A 4Z0EA 4APMA 5CT2A 1HKYA 2Z8WA 5EODA 1W81A 5CT3A 2LL3A
chains in the Genus database with same CATH topology
3HMTA 5CS1A 5EOKA 3SRJA 2YIOA 3HN4A 3MKPA 2HGFA 3SRIA 3ZLEA 4Z0FA 1GP9A 1GMNA 3SP8A 2QJ4A 2Q8BA 4YIVA 5CP9A 2J8JA 2LL4M 2YILA 4R1CA 1GMOA 5CS3A 2Q8AA 2K13X 2F83A 4DURA 1NK1A 3HMSA 4A5TS 4Z0DA 1I8NA 2X2ZA 4R1AA 5CS9A 5I25A 4APLA 2YIPA 3ZWZA 1YXEA 4IUAA 2Y8RA 5COEA 1Z40A 4Z09A 2QJ2A 5CSQA 5CT1A 2Z8VA 4UAOA 1BHTA 4YIZA 5CS5A 2KL5A 3HMRA 1W8KA 4R19A 4R1BA 2J8LA 4UV6A 4Z0EA 4APMA 5CT2A 1HKYA 2Z8WA 5EODA 1W81A 5CT3A 2LL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMT A;  5CS1 A;  5EOK A;  3SRJ A;  2YIO A;  3HN4 A;  3MKP A;  2HGF A;  3SRI A;  3ZLE A;  4Z0F A;  1GP9 A;  1GMN A;  3SP8 A;  2QJ4 A;  2Q8B A;  5CP9 A;  2J8J A;  2LL4 M;  2YIL A;  4R1C A;  1GMO A;  5CS3 A;  2Q8A A;  2K13 X;  2F83 A;  4DUR A;  1NK1 A;  3HMS A;  4A5T S;  4Z0D A;  1I8N A;  2X2Z A;  4R1A A;  5CS9 A;  5I25 A;  4APL A;  2YIP A;  3ZWZ A;  1YXE A;  4IUA A;  2Y8R A;  5COE A;  1Z40 A;  4Z09 A;  2QJ2 A;  5CSQ A;  5CT1 A;  2Z8V A;  4UAO A;  1BHT A;  5CS5 A;  3HMR A;  1W8K A;  4R19 A;  4R1B A;  2J8L A;  4UV6 A;  4Z0E A;  4APM A;  5CT2 A;  1HKY A;  2Z8W A;  5EOD A;  1W81 A;  5CT3 A;  2LL3 A; 
#chains in the Genus database with same CATH topology
 3HMT A;  5CS1 A;  5EOK A;  3SRJ A;  2YIO A;  3HN4 A;  3MKP A;  2HGF A;  3SRI A;  3ZLE A;  4Z0F A;  1GP9 A;  1GMN A;  3SP8 A;  2QJ4 A;  2Q8B A;  4YIV A;  5CP9 A;  2J8J A;  2LL4 M;  2YIL A;  4R1C A;  1GMO A;  5CS3 A;  2Q8A A;  2K13 X;  2F83 A;  4DUR A;  1NK1 A;  3HMS A;  4A5T S;  4Z0D A;  1I8N A;  2X2Z A;  4R1A A;  5CS9 A;  5I25 A;  4APL A;  2YIP A;  3ZWZ A;  1YXE A;  4IUA A;  2Y8R A;  5COE A;  1Z40 A;  4Z09 A;  2QJ2 A;  5CSQ A;  5CT1 A;  2Z8V A;  4UAO A;  1BHT A;  4YIZ A;  5CS5 A;  2KL5 A;  3HMR A;  1W8K A;  4R19 A;  4R1B A;  2J8L A;  4UV6 A;  4Z0E A;  4APM A;  5CT2 A;  1HKY A;  2Z8W A;  5EOD A;  1W81 A;  5CT3 A;  2LL3 A; 
#chains in the Genus database with same CATH homology
 3HMT A;  5CS1 A;  5EOK A;  3SRJ A;  2YIO A;  3HN4 A;  3MKP A;  2HGF A;  3SRI A;  3ZLE A;  4Z0F A;  1GP9 A;  1GMN A;  3SP8 A;  2QJ4 A;  2Q8B A;  4YIV A;  5CP9 A;  2J8J A;  2LL4 M;  2YIL A;  4R1C A;  1GMO A;  5CS3 A;  2Q8A A;  2K13 X;  2F83 A;  4DUR A;  1NK1 A;  3HMS A;  4A5T S;  4Z0D A;  1I8N A;  2X2Z A;  4R1A A;  5CS9 A;  5I25 A;  4APL A;  2YIP A;  3ZWZ A;  1YXE A;  4IUA A;  2Y8R A;  5COE A;  1Z40 A;  4Z09 A;  2QJ2 A;  5CSQ A;  5CT1 A;  2Z8V A;  4UAO A;  1BHT A;  4YIZ A;  5CS5 A;  2KL5 A;  3HMR A;  1W8K A;  4R19 A;  4R1B A;  2J8L A;  4UV6 A;  4Z0E A;  4APM A;  5CT2 A;  1HKY A;  2Z8W A;  5EOD A;  1W81 A;  5CT3 A;  2LL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...