2K13X

Solution nmr structure of the leech protein saratin, a novel inhibitor of haemostasis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
b'EEREDCWTFYANRKYTDFDKSFKKSSDLDECKKTCFKTEYCYIVFEDTVNKECYYNVVDGEELDQEKFVVDENFTENYLTDCEGKDAGNAAGTGDESDEVDED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Saratin
publication title Structure of the leech protein saratin and characterization of its binding to collagen
pubmed doi rcsb
molecule tags Toxin
total genus 21
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2k13X00
2Z8VA 2J8JA 3HMSA 4APMA 5CSQA 2QJ4A 1BHTA 1GMOA 5CT1A 5I25A 1GMNA 3HMRA 4Z0EA 3SRIA 2YILA 2J8LA 2Q8AA 3SRJA 1W8KA 5CS5A 4DURA 5EODA 1NK1A 4R1BA 5EOKA 1HKYA 2LL4M 3HN4A 3HMTA 4IUAA 1I8NA 2Z8WA 4R1CA 1GP9A 3ZLEA 5CS9A 2QJ2A 3SP8A 3MKPA 4Z0DA 2HGFA 4R19A 2K13X 2YIOA 2LL3A 2X2ZA 2F83A 1YXEA 4UAOA 5COEA 4A5TS 5CT3A 4R1AA 4Z09A 5CS3A 1W81A 3ZWZA 2Y8RA 5CT2A 5CP9A 4Z0FA 2Q8BA 2YIPA 5CS1A 4APLA 4UV6A 1Z40A
chains in the Genus database with same CATH superfamily
2Z8VA 2J8JA 3HMSA 4APMA 5CSQA 2QJ4A 1BHTA 1GMOA 5CT1A 5I25A 1GMNA 3HMRA 4Z0EA 3SRIA 2YILA 2J8LA 2Q8AA 3SRJA 1W8KA 5CS5A 4DURA 5EODA 1NK1A 4R1BA 5EOKA 1HKYA 2LL4M 3HN4A 3HMTA 4IUAA 1I8NA 2Z8WA 4R1CA 1GP9A 3ZLEA 5CS9A 2QJ2A 3SP8A 3MKPA 4Z0DA 2KL5A 2HGFA 4R19A 2K13X 2YIOA 2LL3A 2X2ZA 2F83A 1YXEA 4UAOA 5COEA 4A5TS 5CT3A 4R1AA 4YIVA 4Z09A 5CS3A 1W81A 3ZWZA 2Y8RA 5CT2A 5CP9A 4Z0FA 2Q8BA 2YIPA 5CS1A 4APLA 4YIZA 4UV6A 1Z40A
chains in the Genus database with same CATH topology
2Z8VA 2J8JA 3HMSA 4APMA 5CSQA 2QJ4A 1BHTA 1GMOA 5CT1A 5I25A 1GMNA 3HMRA 4Z0EA 3SRIA 2YILA 2J8LA 2Q8AA 3SRJA 1W8KA 5CS5A 4DURA 5EODA 1NK1A 4R1BA 5EOKA 1HKYA 2LL4M 3HN4A 3HMTA 4IUAA 1I8NA 2Z8WA 4R1CA 1GP9A 3ZLEA 5CS9A 2QJ2A 3SP8A 3MKPA 4Z0DA 2KL5A 2HGFA 4R19A 2K13X 2YIOA 2LL3A 2X2ZA 2F83A 1YXEA 4UAOA 5COEA 4A5TS 5CT3A 4R1AA 4YIVA 4Z09A 5CS3A 1W81A 3ZWZA 2Y8RA 5CT2A 5CP9A 4Z0FA 2Q8BA 2YIPA 5CS1A 4APLA 4YIZA 4UV6A 1Z40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8V A;  2J8J A;  3HMS A;  4APM A;  5CSQ A;  2QJ4 A;  1BHT A;  1GMO A;  5CT1 A;  5I25 A;  1GMN A;  3HMR A;  4Z0E A;  3SRI A;  2YIL A;  2J8L A;  2Q8A A;  3SRJ A;  1W8K A;  5CS5 A;  4DUR A;  5EOD A;  1NK1 A;  4R1B A;  5EOK A;  1HKY A;  2LL4 M;  3HN4 A;  3HMT A;  4IUA A;  1I8N A;  2Z8W A;  4R1C A;  1GP9 A;  3ZLE A;  5CS9 A;  2QJ2 A;  3SP8 A;  3MKP A;  4Z0D A;  2HGF A;  4R19 A;  2K13 X;  2YIO A;  2LL3 A;  2X2Z A;  2F83 A;  1YXE A;  4UAO A;  5COE A;  4A5T S;  5CT3 A;  4R1A A;  4Z09 A;  5CS3 A;  1W81 A;  3ZWZ A;  2Y8R A;  5CT2 A;  5CP9 A;  4Z0F A;  2Q8B A;  2YIP A;  5CS1 A;  4APL A;  4UV6 A;  1Z40 A; 
#chains in the Genus database with same CATH topology
 2Z8V A;  2J8J A;  3HMS A;  4APM A;  5CSQ A;  2QJ4 A;  1BHT A;  1GMO A;  5CT1 A;  5I25 A;  1GMN A;  3HMR A;  4Z0E A;  3SRI A;  2YIL A;  2J8L A;  2Q8A A;  3SRJ A;  1W8K A;  5CS5 A;  4DUR A;  5EOD A;  1NK1 A;  4R1B A;  5EOK A;  1HKY A;  2LL4 M;  3HN4 A;  3HMT A;  4IUA A;  1I8N A;  2Z8W A;  4R1C A;  1GP9 A;  3ZLE A;  5CS9 A;  2QJ2 A;  3SP8 A;  3MKP A;  4Z0D A;  2KL5 A;  2HGF A;  4R19 A;  2K13 X;  2YIO A;  2LL3 A;  2X2Z A;  2F83 A;  1YXE A;  4UAO A;  5COE A;  4A5T S;  5CT3 A;  4R1A A;  4YIV A;  4Z09 A;  5CS3 A;  1W81 A;  3ZWZ A;  2Y8R A;  5CT2 A;  5CP9 A;  4Z0F A;  2Q8B A;  2YIP A;  5CS1 A;  4APL A;  4YIZ A;  4UV6 A;  1Z40 A; 
#chains in the Genus database with same CATH homology
 2Z8V A;  2J8J A;  3HMS A;  4APM A;  5CSQ A;  2QJ4 A;  1BHT A;  1GMO A;  5CT1 A;  5I25 A;  1GMN A;  3HMR A;  4Z0E A;  3SRI A;  2YIL A;  2J8L A;  2Q8A A;  3SRJ A;  1W8K A;  5CS5 A;  4DUR A;  5EOD A;  1NK1 A;  4R1B A;  5EOK A;  1HKY A;  2LL4 M;  3HN4 A;  3HMT A;  4IUA A;  1I8N A;  2Z8W A;  4R1C A;  1GP9 A;  3ZLE A;  5CS9 A;  2QJ2 A;  3SP8 A;  3MKP A;  4Z0D A;  2KL5 A;  2HGF A;  4R19 A;  2K13 X;  2YIO A;  2LL3 A;  2X2Z A;  2F83 A;  1YXE A;  4UAO A;  5COE A;  4A5T S;  5CT3 A;  4R1A A;  4YIV A;  4Z09 A;  5CS3 A;  1W81 A;  3ZWZ A;  2Y8R A;  5CT2 A;  5CP9 A;  4Z0F A;  2Q8B A;  2YIP A;  5CS1 A;  4APL A;  4YIZ A;  4UV6 A;  1Z40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...