2YIPA

Crystal structure of parasite sarcocystis muris microneme protein sml- 2 in complex with 1-thio-beta-d-galactose (spacegroup p212121)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
QLDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
total genus 35
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yipA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yipA01
4UV6A 4DURA 5CS9A 2J8LA 2Z8WA 4R1CA 3HN4A 3SRJA 1GP9A 5EOKA 2Q8AA 4APMA 5CS3A 5CS5A 2Q8BA 1YXEA 5EODA 3HMTA 2X2ZA 3ZLEA 2K13X 4R1BA 2HGFA 2Z8VA 1NK1A 5CT3A 1HKYA 1W8KA 4R19A 4UAOA 4A5TS 3SRIA 1I8NA 2YILA 3SP8A 3HMRA 2YIOA 4IUAA 5CSQA 4Z0FA 2LL3A 2Y8RA 5CT2A 2QJ2A 2LL4M 4Z09A 2F83A 4APLA 4Z0DA 3ZWZA 5CP9A 4R1AA 5CT1A 3HMSA 3MKPA 2J8JA 1BHTA 5COEA 2YIPA 5I25A 1GMOA 5CS1A 4Z0EA 1Z40A 1W81A 1GMNA 2QJ4A
chains in the Genus database with same CATH superfamily
1UGLA 1QQMA 2N2QA 2J8LA 5AQTA 1K8BA 3HN4A 2MBKA 3PSMA 2BUPA 2KJAA 2HGFA 3CQXA 1NGAA 3SRIA 1T7AA 3QI7A 2N69A 3KP0A 1S3XA 5AQIA 3FZHA 2B3CA 1ATRA 3KOZA 2LJ7A 1HPMA 5AQOA 1YXEA 2E8AA 2M8BB 3BK3C 3JXUA 3LDNA 4AEIA 4FSVA 5CT2A 4HWIA 1T7BA 3ATVA 5AQXA 3QMLA 1FH3A 1ZVGA 5AQZA 3HSCA 1W81A 5COEA 2E88A 4UV6A 2QWQA 5CS3A 2Q8BA 5EODA 1I6FA 2I61A 2KBJA 1P0AA 1NGFA 5CT3A 3KOXA 2GL1A 2QWLA 2QWOA 3L56A 4HE7A 4AB0A 2BRZA 1POIA 2KBKA 3KVGA 5EXWA 4AAZA 1PX9A 1JKZA 1HJOA 3FZFA 5F0XA 3KHWA 3GKUA 3L6QA 2X2ZA 3FZKA 3QFUA 4UAOA 2V7ZA 1NGHA 2LJMA 5AQLA 2G2KA 1MR4A 2QWMA 2J8JA 2LI7A 1T1TA 2YC1C 3KOWA 1AHOA 2LY5A 2KPYA 1NRBA 1ICAA 1NRAA 3D2EA 1ATSA 2KBHA 2KL5A 1DKGD 5AQNA 4R19A 2LN8A 1WT7A 3AY9A 5AQYA 4H5WA 5AQVA 1LQIA 5CT1A 2JDQD 5AQHA 3HMSA 1NH5A 4UJ0A 1BMRA 4HHFA 1WWNA 3SRJA 1ZYWA 4APMA 1SNBA 1AYJA 1ZFUA 1NGEA 4KYPA 3LDPA 4Z0FA 2QJ2A 1GPSA 1SEGA 1DQ7A 5EY4A 5EVZA 1HX1A 1BHTA 5BN8A 5CY0A 3LDLA 4R1CA 4IO8A 4H5RA 1NGJA 2KHOA 2KSKA 3FZLA 2LY6A 1TI5A 2Z8VA 3HMRA 3LDOA 2B68A 5AQSA 2QWRA 2N66A 1ZU3A 4V1DC 2YEOA 3KOYA 3KP1A 1NK1A 1QQNA 5AQWA 1W8KA 3FZMA 4CQKA 5FPEA 3D2EB 4YIZA 1I2VA 4R1AA 1I6GA 1NGIA 5AQPA 2QW9A 2YIPA 2E3GA 3ATUA 5CS9A 1JXCA 5BPLA 1KAXA 1KV0A 4KBOA 2NY9X 4UADE 5AQGA 2ASCA 1L4VA 3ZWZA 5CP9A 1N4NA 1ZYVA 5AQJA 1JZAA 4Z0EA 1CHZA 5EOKA 2Q8AA 1XRSB 3HMTA 2E0HA 1OZZA 4R1BA 1BA1A 1BUPA 3C7NA 2D56A 5AQQA 1SN1A 3GDQA 2MN5A 1VNBA 5CS5A 1C55A 2QWPA 4A5TS 1WMTA 4GNIA 2LL3A 5BN9A 2LL4M 3MKPA 1PE4A 3I33A 1PTXA 5F2RA 5F1XA 5FPDA 3M3ZA 1T0ZA 1GP9A 2LT8A 1JZBA 3GL1A 5AR0A 1CN2A 4H5TA 1ZVEA 3D2FA 5AQUA 4H5NA 1B3CA 4H5VA 2Y8RA 2NY8X 2E3FA 2E2FA 5CS1A 4FL9A 1QQOA 3LDQA 2KYQA 1NGCA 1NGGA 5AQKA 2YILA 3IUCA 1ZUTA 5FPNA 2ATBA 4UAEF 4YIVA 2LKBA 2GMOA 2VY6A 3KC6A 1BCGA 1Z40A 5EX5A 1OMYA 1YUWA 3C7NB 2QJ4A 5FPMA 2Z8WA 1NE5A 1T7EA 5KK4A 2QWNA 1GPTA 1NGDA 1SN4A 1VNAA 2YIOA 4IUAA 4UAFE 1KAZA 3QFPA 1NPIA 1MYNA 1KAYA 1LQHA 3SF4D 1GMOA 4APLA 1GMNA 2MZ0A 4DURA 2QXLA 2YBRC 1BA0A 3E7RL 3ZLEA 3L4IA 2K35A 1I2UA 1HKYA 5AQMA 1I8NA 2KGQA 3R2VA 2N2RA 1P00A 3D2FB 5BPNA 1C56A 3E7UX 2K13X 2LR3A 3A8YA 1B7DA 5AQRA 3FE1A 1BRZA 3SP8A 1LQQA 5CSQA 3CW4A 5BPMA 2SN3A 1NGBA 4Z09A 2F83A 5AQFA 4Z0DA 5I25A 2A7TA 1DJTA 1BK8A
chains in the Genus database with same CATH topology
1QQMA 5CS9A 2J8LA 3LDQA 5AQTA 3HN4A 5BPLA 2MBKA 3D2EA 1KAXA 1ATSA 2BUPA 2KL5A 4KBOA 1DKGD 5AQNA 1NGCA 2HGFA 3CQXA 1NGGA 4R19A 1NGAA 2LN8A 5AQKA 3SRIA 2YILA 3IUCA 4UADE 5AQGA 5FPNA 3AY9A 3QI7A 4UAEF 5AQYA 4H5WA 5AQVA 4YIVA 3ZWZA 5CP9A 5CT1A 2JDQD 5AQHA 1S3XA 2GMOA 5AQIA 3HMSA 2VY6A 3KC6A 3FZHA 5AQJA 1ATRA 4Z0EA 1Z40A 5EX5A 2QJ4A 1YUWA 3C7NB 5FPMA 2Z8WA 3SRJA 5EOKA 1HPMA 2Q8AA 4APMA 5AQOA 1YXEA 3HMTA 2E8AA 4R1BA 2QWNA 1BA1A 3BK3C 3JXUA 1NGDA 1NGEA 1BUPA 3C7NA 2YIOA 3LDNA 4IUAA 3LDPA 4Z0FA 4UAFE 1KAZA 4FSVA 5CT2A 4HWIA 2QJ2A 3QFPA 2D56A 3ATVA 5EY4A 5AQXA 5EVZA 3QMLA 1HX1A 1KAYA 5AQQA 1BHTA 3SF4D 1GMOA 3GDQA 5AQZA 3HSCA 5BN8A 1W81A 1GMNA 5COEA 4APLA 3LDLA 2E88A 4UV6A 2MN5A 4DURA 2QWQA 4R1CA 2QXLA 4IO8A 1BA0A 4H5RA 5CS3A 5CS5A 2Q8BA 5EODA 1NGJA 2KHOA 3ZLEA 3FZLA 3L4IA 2K35A 2Z8VA 2QWPA 1NGFA 5CT3A 1HKYA 4A5TS 5AQMA 1I8NA 3HMRA 4GNIA 3LDOA 2QWLA 2QWOA 3L56A 2LL3A 5BN9A 2LL4M 1POIA 3R2VA 3MKPA 3I33A 3KVGA 5AQSA 5EXWA 5F2RA 2QWRA 3D2FB 5F1XA 5FPDA 5BPNA 1HJOA 3FZFA 5F0XA 3M3ZA 3KHWA 1GP9A 3GL1A 3L6QA 2X2ZA 2K13X 3A8YA 5AR0A 5AQRA 1NK1A 1QQNA 3FZKA 3QFUA 5AQWA 2V7ZA 4H5TA 1W8KA 4UAOA 1NGHA 3FE1A 3D2FA 3FZMA 5AQUA 3SP8A 5FPEA 5CSQA 3CW4A 4H5NA 5BPMA 3D2EB 5AQLA 4H5VA 4YIZA 1NGBA 2Y8RA 4Z09A 2F83A 5AQFA 4Z0DA 2QWMA 4R1AA 1NGIA 5AQPA 2J8JA 2QW9A 2E2FA 2YIPA 5I25A 5CS1A 3ATUA 4FL9A 1QQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UV6 A;  4DUR A;  5CS9 A;  2J8L A;  2Z8W A;  4R1C A;  3HN4 A;  3SRJ A;  1GP9 A;  5EOK A;  2Q8A A;  4APM A;  5CS3 A;  5CS5 A;  2Q8B A;  1YXE A;  5EOD A;  3HMT A;  2X2Z A;  3ZLE A;  2K13 X;  4R1B A;  2HGF A;  2Z8V A;  1NK1 A;  5CT3 A;  1HKY A;  1W8K A;  4R19 A;  4UAO A;  4A5T S;  3SRI A;  1I8N A;  2YIL A;  3SP8 A;  3HMR A;  2YIO A;  4IUA A;  5CSQ A;  4Z0F A;  2LL3 A;  2Y8R A;  5CT2 A;  2QJ2 A;  2LL4 M;  4Z09 A;  2F83 A;  4APL A;  4Z0D A;  3ZWZ A;  5CP9 A;  4R1A A;  5CT1 A;  3HMS A;  3MKP A;  2J8J A;  1BHT A;  5COE A;  2YIP A;  5I25 A;  1GMO A;  5CS1 A;  4Z0E A;  1Z40 A;  1W81 A;  1GMN A;  2QJ4 A; 
#chains in the Genus database with same CATH topology
 1UGL A;  1QQM A;  2N2Q A;  2J8L A;  5AQT A;  1K8B A;  3HN4 A;  2MBK A;  3PSM A;  2BUP A;  2KJA A;  2HGF A;  3CQX A;  1NGA A;  3SRI A;  1T7A A;  3QI7 A;  2N69 A;  3KP0 A;  1S3X A;  5AQI A;  3FZH A;  2B3C A;  1ATR A;  3KOZ A;  2LJ7 A;  1HPM A;  5AQO A;  1YXE A;  2E8A A;  2M8B B;  3BK3 C;  3JXU A;  3LDN A;  4AEI A;  4FSV A;  5CT2 A;  4HWI A;  1T7B A;  3ATV A;  5AQX A;  3QML A;  1FH3 A;  1ZVG A;  5AQZ A;  3HSC A;  1W81 A;  5COE A;  2E88 A;  4UV6 A;  2QWQ A;  5CS3 A;  2Q8B A;  5EOD A;  1I6F A;  2I61 A;  2KBJ A;  1P0A A;  1NGF A;  5CT3 A;  3KOX A;  2GL1 A;  2QWL A;  2QWO A;  3L56 A;  4HE7 A;  4AB0 A;  2BRZ A;  1POI A;  2KBK A;  3KVG A;  5EXW A;  4AAZ A;  1PX9 A;  1JKZ A;  1HJO A;  3FZF A;  5F0X A;  3KHW A;  3GKU A;  3L6Q A;  2X2Z A;  3FZK A;  3QFU A;  4UAO A;  2V7Z A;  1NGH A;  2LJM A;  5AQL A;  2G2K A;  1MR4 A;  2QWM A;  2J8J A;  2LI7 A;  1T1T A;  2YC1 C;  3KOW A;  1AHO A;  2LY5 A;  2KPY A;  1NRB A;  1ICA A;  1NRA A;  3D2E A;  1ATS A;  2KBH A;  2KL5 A;  1DKG D;  5AQN A;  4R19 A;  2LN8 A;  1WT7 A;  3AY9 A;  5AQY A;  4H5W A;  5AQV A;  1LQI A;  5CT1 A;  2JDQ D;  5AQH A;  3HMS A;  1NH5 A;  4UJ0 A;  1BMR A;  4HHF A;  1WWN A;  3SRJ A;  1ZYW A;  4APM A;  1SNB A;  1AYJ A;  1ZFU A;  1NGE A;  4KYP A;  3LDP A;  4Z0F A;  2QJ2 A;  1GPS A;  1SEG A;  1DQ7 A;  5EY4 A;  5EVZ A;  1HX1 A;  1BHT A;  5BN8 A;  5CY0 A;  3LDL A;  4R1C A;  4IO8 A;  4H5R A;  1NGJ A;  2KHO A;  2KSK A;  3FZL A;  2LY6 A;  1TI5 A;  2Z8V A;  3HMR A;  3LDO A;  2B68 A;  5AQS A;  2QWR A;  2N66 A;  1ZU3 A;  4V1D C;  2YEO A;  3KOY A;  3KP1 A;  1NK1 A;  1QQN A;  5AQW A;  1W8K A;  3FZM A;  4CQK A;  5FPE A;  3D2E B;  4YIZ A;  1I2V A;  4R1A A;  1I6G A;  1NGI A;  5AQP A;  2QW9 A;  2YIP A;  2E3G A;  3ATU A;  5CS9 A;  1JXC A;  5BPL A;  1KAX A;  1KV0 A;  4KBO A;  2NY9 X;  4UAD E;  5AQG A;  2ASC A;  1L4V A;  3ZWZ A;  5CP9 A;  1N4N A;  1ZYV A;  5AQJ A;  1JZA A;  4Z0E A;  1CHZ A;  5EOK A;  2Q8A A;  1XRS B;  3HMT A;  2E0H A;  1OZZ A;  4R1B A;  1BA1 A;  1BUP A;  3C7N A;  2D56 A;  5AQQ A;  1SN1 A;  3GDQ A;  2MN5 A;  1VNB A;  5CS5 A;  1C55 A;  2QWP A;  4A5T S;  1WMT A;  4GNI A;  2LL3 A;  5BN9 A;  2LL4 M;  3MKP A;  1PE4 A;  3I33 A;  1PTX A;  5F2R A;  5F1X A;  5FPD A;  3M3Z A;  1T0Z A;  1GP9 A;  2LT8 A;  1JZB A;  3GL1 A;  5AR0 A;  1CN2 A;  4H5T A;  1ZVE A;  3D2F A;  5AQU A;  4H5N A;  1B3C A;  4H5V A;  2Y8R A;  2NY8 X;  2E3F A;  2E2F A;  5CS1 A;  4FL9 A;  1QQO A;  3LDQ A;  2KYQ A;  1NGC A;  1NGG A;  5AQK A;  2YIL A;  3IUC A;  1ZUT A;  5FPN A;  2ATB A;  4UAE F;  4YIV A;  2LKB A;  2GMO A;  2VY6 A;  3KC6 A;  1BCG A;  1Z40 A;  5EX5 A;  1OMY A;  1YUW A;  3C7N B;  2QJ4 A;  5FPM A;  2Z8W A;  1NE5 A;  1T7E A;  5KK4 A;  2QWN A;  1GPT A;  1NGD A;  1SN4 A;  1VNA A;  2YIO A;  4IUA A;  4UAF E;  1KAZ A;  3QFP A;  1NPI A;  1MYN A;  1KAY A;  1LQH A;  3SF4 D;  1GMO A;  4APL A;  1GMN A;  2MZ0 A;  4DUR A;  2QXL A;  2YBR C;  1BA0 A;  3E7R L;  3ZLE A;  3L4I A;  2K35 A;  1I2U A;  1HKY A;  5AQM A;  1I8N A;  2KGQ A;  3R2V A;  2N2R A;  1P00 A;  3D2F B;  5BPN A;  1C56 A;  3E7U X;  2K13 X;  2LR3 A;  3A8Y A;  1B7D A;  5AQR A;  3FE1 A;  1BRZ A;  3SP8 A;  1LQQ A;  5CSQ A;  3CW4 A;  5BPM A;  2SN3 A;  1NGB A;  4Z09 A;  2F83 A;  5AQF A;  4Z0D A;  5I25 A;  2A7T A;  1DJT A;  1BK8 A; 
#chains in the Genus database with same CATH homology
 1QQM A;  5CS9 A;  2J8L A;  3LDQ A;  5AQT A;  3HN4 A;  5BPL A;  2MBK A;  3D2E A;  1KAX A;  1ATS A;  2BUP A;  2KL5 A;  4KBO A;  1DKG D;  5AQN A;  1NGC A;  2HGF A;  3CQX A;  1NGG A;  4R19 A;  1NGA A;  2LN8 A;  5AQK A;  3SRI A;  2YIL A;  3IUC A;  4UAD E;  5AQG A;  5FPN A;  3AY9 A;  3QI7 A;  4UAE F;  5AQY A;  4H5W A;  5AQV A;  4YIV A;  3ZWZ A;  5CP9 A;  5CT1 A;  2JDQ D;  5AQH A;  1S3X A;  2GMO A;  5AQI A;  3HMS A;  2VY6 A;  3KC6 A;  3FZH A;  5AQJ A;  1ATR A;  4Z0E A;  1Z40 A;  5EX5 A;  2QJ4 A;  1YUW A;  3C7N B;  5FPM A;  2Z8W A;  3SRJ A;  5EOK A;  1HPM A;  2Q8A A;  4APM A;  5AQO A;  1YXE A;  3HMT A;  2E8A A;  4R1B A;  2QWN A;  1BA1 A;  3BK3 C;  3JXU A;  1NGD A;  1NGE A;  1BUP A;  3C7N A;  2YIO A;  3LDN A;  4IUA A;  3LDP A;  4Z0F A;  4UAF E;  1KAZ A;  4FSV A;  5CT2 A;  4HWI A;  2QJ2 A;  3QFP A;  2D56 A;  3ATV A;  5EY4 A;  5AQX A;  5EVZ A;  3QML A;  1HX1 A;  1KAY A;  5AQQ A;  1BHT A;  3SF4 D;  1GMO A;  3GDQ A;  5AQZ A;  3HSC A;  5BN8 A;  1W81 A;  1GMN A;  5COE A;  4APL A;  3LDL A;  2E88 A;  4UV6 A;  2MN5 A;  4DUR A;  2QWQ A;  4R1C A;  2QXL A;  4IO8 A;  1BA0 A;  4H5R A;  5CS3 A;  5CS5 A;  2Q8B A;  5EOD A;  1NGJ A;  2KHO A;  3ZLE A;  3FZL A;  3L4I A;  2K35 A;  2Z8V A;  2QWP A;  1NGF A;  5CT3 A;  1HKY A;  4A5T S;  5AQM A;  1I8N A;  3HMR A;  4GNI A;  3LDO A;  2QWL A;  2QWO A;  3L56 A;  2LL3 A;  5BN9 A;  2LL4 M;  1POI A;  3R2V A;  3MKP A;  3I33 A;  3KVG A;  5AQS A;  5EXW A;  5F2R A;  2QWR A;  3D2F B;  5F1X A;  5FPD A;  5BPN A;  1HJO A;  3FZF A;  5F0X A;  3M3Z A;  3KHW A;  1GP9 A;  3GL1 A;  3L6Q A;  2X2Z A;  2K13 X;  3A8Y A;  5AR0 A;  5AQR A;  1NK1 A;  1QQN A;  3FZK A;  3QFU A;  5AQW A;  2V7Z A;  4H5T A;  1W8K A;  4UAO A;  1NGH A;  3FE1 A;  3D2F A;  3FZM A;  5AQU A;  3SP8 A;  5FPE A;  5CSQ A;  3CW4 A;  4H5N A;  5BPM A;  3D2E B;  5AQL A;  4H5V A;  4YIZ A;  1NGB A;  2Y8R A;  4Z09 A;  2F83 A;  5AQF A;  4Z0D A;  2QWM A;  4R1A A;  1NGI A;  5AQP A;  2J8J A;  2QW9 A;  2E2F A;  2YIP A;  5I25 A;  5CS1 A;  3ATU A;  4FL9 A;  1QQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...