2YIPA

Crystal structure of parasite sarcocystis muris microneme protein sml- 2 in complex with 1-thio-beta-d-galactose (spacegroup p212121)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
QLDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 35
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yipA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yipA01
1W81A 5CS1A 3ZWZA 1W8KA 2Z8WA 2X2ZA 2Y8RA 2YIPA 2J8JA 4R1AA 4Z0DA 2J8LA 2YILA 4R1BA 2HGFA 5CT3A 3SP8A 4Z0FA 5CP9A 4APLA 3SRJA 2K13X 1YXEA 1Z40A 5CS9A 4UV6A 5CS5A 2F83A 2LL4M 4Z0EA 5CSQA 4Z09A 1NK1A 2Q8AA 4APMA 5I25A 5EOKA 4DURA 1BHTA 2Z8VA 5EODA 2QJ4A 4A5TS 5CT1A 5CS3A 5CT2A 3ZLEA 3SRIA 1I8NA 2YIOA 5COEA 1GMOA 4UAOA 1HKYA 2Q8BA 3HN4A 2QJ2A 4IUAA 4R1CA 2LL3A 1GMNA 3HMTA 1GP9A 3HMRA 3MKPA 4R19A 3HMSA
chains in the Genus database with same CATH superfamily
1W81A 1B3CA 2X2ZA 2N66A 5CSQA 1C56A 4AEIA 4APMA 1XRSB 1C55A 2N2QA 2QJ4A 3ZLEA 4H5VA 4IUAA 4V1DC 3A8YA 4HWIA 1QQNA 2QWRA 1YXEA 4UAEF 3FZLA 2QW9A 1B7DA 3JXUA 1BRZA 2QWQA 5AQIA 1BUPA 5FPMA 3I33A 3CQXA 4R19A 2KSKA 1ZFUA 2Q8BA 2B3CA 2NY8X 5F1XA 1PX9A 4Z0FA 2K13X 3FZFA 1OMYA 1HX1A 2QWOA 3FZMA 2LR3A 1N4NA 5FPDA 4UJ0A 5F2RA 1ZUTA 4CQKA 4R1CA 3KOWA 2YBRC 1L4VA 5AQLA 2YILA 5CP9A 1HPMA 5CS9A 1T1TA 5F0XA 4YIZA 5EOKA 1WWNA 2GL1A 3AY9A 1I8NA 3L56A 1KAXA 3MKPA 3E7UX 5AQVA 5AQGA 2D56A 1BK8A 3R2VA 2B68A 1JXCA 1NRAA 5EXWA 1VNBA 3ATUA 5AQTA 1BA1A 1HJOA 3LDNA 4A5TS 3QI7A 1MR4A 1ZYWA 1CN2A 5FPNA 3HN4A 3LDPA 1NGBA 2ATBA 1W8KA 5BN8A 1POIA 3KOYA 4FL9A 5CT3A 2QXLA 4AAZA 5AR0A 3M3ZA 2MZ0A 1ATSA 3HSCA 4HHFA 2LL4M 1FH3A 3FZKA 1KV0A 1NGDA 1SN4A 1WMTA 3C7NA 1BHTA 1UGLA 1T0ZA 4FSVA 1DJTA 2KBJA 2E88A 5AQUA 1SNBA 4UV6A 5AQXA 2E3FA 1GPSA 1P0AA 5AQSA 3KOXA 1NGEA 1T7BA 2KYQA 1BA0A 5AQJA 2J8LA 3D2EA 1LQIA 5CS5A 4Z09A 5CT1A 2QWLA 2LI7A 1KAZA 3E7RL 1I2VA 1I2UA 2GMOA 5AQRA 3KOZA 4H5RA 3QMLA 4UAFE 2LY6A 2N2RA 1K8BA 4HE7A 2QWNA 2ASCA 1ZVGA 3KHWA 3PSMA 2QWMA 5AQFA 1KAYA 3L4IA 5EY4A 4DURA 3BK3C 2JDQD 5CT2A 1DKGD 1I6GA 4H5NA 3D2FA 2LL3A 3IUCA 3HMTA 3C7NB 2LKBA 2LT8A 2VY6A 2KHOA 5AQKA 2LY5A 2KBKA 1JKZA 1NGFA 4KBOA 1GPTA 3LDLA 5CY0A 1NE5A 3D2EB 3L6QA 1ZU3A 5AQWA 2E2FA 1ZYVA 2LN8A 3GDQA 1AHOA 2J8JA 5BPLA 4KYPA 3SP8A 3GL1A 3KP0A 1MYNA 2Q8AA 4AB0A 1I6FA 3QFUA 2MBKA 5CS3A 1YUWA 5AQHA 2M8BB 3LDQA 1TI5A 3D2FB 4R1BA 2HGFA 5AQQA 5BPMA 1JZAA 2K35A 2KBHA 4GNIA 5AQOA 2KL5A 3CW4A 5EODA 1P00A 1NGGA 5BPNA 2KJAA 4UAOA 2A7TA 5AQZA 2KPYA 2E0HA 5AQMA 5AQYA 4IO8A 2QJ2A 1QQOA 3FE1A 2SN3A 4APLA 1OZZA 1Z40A 1NGCA 1BCGA 2YEOA 2Z8VA 2G2KA 4H5WA 1SEGA 2I61A 1BMRA 5COEA 2MN5A 1ATRA 1NH5A 1NPIA 1WT7A 1ZVEA 5EVZA 1AYJA 3KP1A 3FZHA 3SRJA 1NGHA 4Z0EA 1NRBA 2BUPA 5I25A 1NGJA 2E8AA 2N69A 5EX5A 2YIOA 1NGAA 4UADE 2KGQA 5CS1A 3ZWZA 2Y8RA 2YIPA 5FPEA 4H5TA 5BN9A 3LDOA 1NK1A 1T7AA 1HKYA 1S3XA 2QWPA 1GP9A 3HMRA 1NGIA 5AQNA 2LJMA 3ATVA 2NY9X 3KC6A 3KVGA 2V7ZA 1PTXA 1PE4A 5KK4A 4YIVA 1LQQA 1GMOA 3QFPA 1T7EA 1JZBA 3GKUA 3HMSA 1CHZA 2Z8WA 4Z0DA 4R1AA 3SF4D 1DQ7A 2E3GA 1ICAA 5AQPA 2F83A 2BRZA 1SN1A 2LJ7A 2YC1C 3SRIA 1VNAA 1LQHA 1QQMA 1GMNA
chains in the Genus database with same CATH topology
1W81A 5AQVA 5AQGA 2D56A 2X2ZA 5EVZA 2VY6A 2KHOA 5AQKA 3R2VA 3FZHA 3SRJA 1NGFA 1NGHA 4KBOA 5EXWA 4Z0EA 3ATUA 5AQTA 2BUPA 5CSQA 1BA1A 1HJOA 3LDNA 4APMA 5I25A 3LDLA 1NGJA 2E8AA 4A5TS 2QJ4A 3QI7A 5EX5A 3D2EB 3ZLEA 3L6QA 2YIOA 5AQWA 2E2FA 4H5VA 5FPNA 2LN8A 3HN4A 3GDQA 4IUAA 3LDPA 1NGAA 1NGBA 3A8YA 4UADE 5CS1A 3ZWZA 1W8KA 5BN8A 2Y8RA 1POIA 2YIPA 5FPEA 2J8JA 5BPLA 4FL9A 4HWIA 3SP8A 5CT3A 2QXLA 1QQNA 4H5TA 5AR0A 3M3ZA 2QWRA 1ATSA 3GL1A 5BN9A 3HSCA 1YXEA 2LL4M 3FZKA 4UAEF 1NGDA 3FZLA 3LDOA 2QW9A 1NK1A 2Q8AA 3C7NA 3JXUA 1BHTA 3QFUA 2MBKA 5CS3A 1YUWA 2QWQA 4FSVA 1HKYA 5AQIA 1S3XA 1BUPA 2QWPA 5FPMA 1GP9A 3HMRA 3I33A 3CQXA 2E88A 1NGIA 5AQHA 5AQXA 5AQUA 4R19A 5AQNA 4UV6A 2Q8BA 3ATVA 3LDQA 5F1XA 5AQSA 1NGEA 5AQJA 2J8LA 1BA0A 3D2FB 4R1BA 3KC6A 2HGFA 4Z0FA 3KVGA 2V7ZA 5AQQA 5BPMA 3D2EA 2K13X 5CS5A 3FZFA 2K35A 4GNIA 4Z09A 5AQOA 1HX1A 2QWOA 3FZMA 4YIVA 2KL5A 3CW4A 5EODA 5FPDA 5CT1A 1NGGA 5BPNA 5F2RA 1GMOA 2QWLA 4UAOA 1KAZA 3QFPA 5AQZA 5AQMA 5AQYA 2QJ2A 4IO8A 4R1CA 1QQOA 3FE1A 3HMSA 2GMOA 5AQRA 2Z8WA 4H5RA 4Z0DA 5AQLA 4R1AA 3SF4D 3QMLA 4UAFE 2YILA 5CP9A 4APLA 3MKPA 2QWNA 5AQPA 1HPMA 1Z40A 5CS9A 3KHWA 2F83A 1NGCA 2QWMA 5AQFA 1KAYA 3L4IA 5EY4A 5F0XA 4YIZA 5EOKA 4DURA 2Z8VA 3BK3C 2JDQD 4H5WA 5CT2A 3AY9A 3SRIA 1I8NA 1DKGD 5COEA 2MN5A 3L56A 4H5NA 1KAXA 1ATRA 3D2FA 2LL3A 1QQMA 3IUCA 1GMNA 3HMTA 3C7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W81 A;  5CS1 A;  3ZWZ A;  1W8K A;  2Z8W A;  2X2Z A;  2Y8R A;  2YIP A;  2J8J A;  4R1A A;  4Z0D A;  2J8L A;  2YIL A;  4R1B A;  2HGF A;  5CT3 A;  3SP8 A;  4Z0F A;  5CP9 A;  4APL A;  3SRJ A;  2K13 X;  1YXE A;  1Z40 A;  5CS9 A;  4UV6 A;  5CS5 A;  2F83 A;  2LL4 M;  4Z0E A;  5CSQ A;  4Z09 A;  1NK1 A;  2Q8A A;  4APM A;  5I25 A;  5EOK A;  4DUR A;  1BHT A;  2Z8V A;  5EOD A;  2QJ4 A;  4A5T S;  5CT1 A;  5CS3 A;  5CT2 A;  3ZLE A;  3SRI A;  1I8N A;  2YIO A;  5COE A;  1GMO A;  4UAO A;  1HKY A;  2Q8B A;  3HN4 A;  2QJ2 A;  4IUA A;  4R1C A;  2LL3 A;  1GMN A;  3HMT A;  1GP9 A;  3HMR A;  3MKP A;  4R19 A;  3HMS A; 
#chains in the Genus database with same CATH topology
 1W81 A;  1B3C A;  2X2Z A;  2N66 A;  5CSQ A;  1C56 A;  4AEI A;  4APM A;  1XRS B;  1C55 A;  2N2Q A;  2QJ4 A;  3ZLE A;  4H5V A;  4IUA A;  4V1D C;  3A8Y A;  4HWI A;  1QQN A;  2QWR A;  1YXE A;  4UAE F;  3FZL A;  2QW9 A;  1B7D A;  3JXU A;  1BRZ A;  2QWQ A;  5AQI A;  1BUP A;  5FPM A;  3I33 A;  3CQX A;  4R19 A;  2KSK A;  1ZFU A;  2Q8B A;  2B3C A;  2NY8 X;  5F1X A;  1PX9 A;  4Z0F A;  2K13 X;  3FZF A;  1OMY A;  1HX1 A;  2QWO A;  3FZM A;  2LR3 A;  1N4N A;  5FPD A;  4UJ0 A;  5F2R A;  1ZUT A;  4CQK A;  4R1C A;  3KOW A;  2YBR C;  1L4V A;  5AQL A;  2YIL A;  5CP9 A;  1HPM A;  5CS9 A;  1T1T A;  5F0X A;  4YIZ A;  5EOK A;  1WWN A;  2GL1 A;  3AY9 A;  1I8N A;  3L56 A;  1KAX A;  3MKP A;  3E7U X;  5AQV A;  5AQG A;  2D56 A;  1BK8 A;  3R2V A;  2B68 A;  1JXC A;  1NRA A;  5EXW A;  1VNB A;  3ATU A;  5AQT A;  1BA1 A;  1HJO A;  3LDN A;  4A5T S;  3QI7 A;  1MR4 A;  1ZYW A;  1CN2 A;  5FPN A;  3HN4 A;  3LDP A;  1NGB A;  2ATB A;  1W8K A;  5BN8 A;  1POI A;  3KOY A;  4FL9 A;  5CT3 A;  2QXL A;  4AAZ A;  5AR0 A;  3M3Z A;  2MZ0 A;  1ATS A;  3HSC A;  4HHF A;  2LL4 M;  1FH3 A;  3FZK A;  1KV0 A;  1NGD A;  1SN4 A;  1WMT A;  3C7N A;  1BHT A;  1UGL A;  1T0Z A;  4FSV A;  1DJT A;  2KBJ A;  2E88 A;  5AQU A;  1SNB A;  4UV6 A;  5AQX A;  2E3F A;  1GPS A;  1P0A A;  5AQS A;  3KOX A;  1NGE A;  1T7B A;  2KYQ A;  1BA0 A;  5AQJ A;  2J8L A;  3D2E A;  1LQI A;  5CS5 A;  4Z09 A;  5CT1 A;  2QWL A;  2LI7 A;  1KAZ A;  3E7R L;  1I2V A;  1I2U A;  2GMO A;  5AQR A;  3KOZ A;  4H5R A;  3QML A;  4UAF E;  2LY6 A;  2N2R A;  1K8B A;  4HE7 A;  2QWN A;  2ASC A;  1ZVG A;  3KHW A;  3PSM A;  2QWM A;  5AQF A;  1KAY A;  3L4I A;  5EY4 A;  4DUR A;  3BK3 C;  2JDQ D;  5CT2 A;  1DKG D;  1I6G A;  4H5N A;  3D2F A;  2LL3 A;  3IUC A;  3HMT A;  3C7N B;  2LKB A;  2LT8 A;  2VY6 A;  2KHO A;  5AQK A;  2LY5 A;  2KBK A;  1JKZ A;  1NGF A;  4KBO A;  1GPT A;  3LDL A;  5CY0 A;  1NE5 A;  3D2E B;  3L6Q A;  1ZU3 A;  5AQW A;  2E2F A;  1ZYV A;  2LN8 A;  3GDQ A;  1AHO A;  2J8J A;  5BPL A;  4KYP A;  3SP8 A;  3GL1 A;  3KP0 A;  1MYN A;  2Q8A A;  4AB0 A;  1I6F A;  3QFU A;  2MBK A;  5CS3 A;  1YUW A;  5AQH A;  2M8B B;  3LDQ A;  1TI5 A;  3D2F B;  4R1B A;  2HGF A;  5AQQ A;  5BPM A;  1JZA A;  2K35 A;  2KBH A;  4GNI A;  5AQO A;  2KL5 A;  3CW4 A;  5EOD A;  1P00 A;  1NGG A;  5BPN A;  2KJA A;  4UAO A;  2A7T A;  5AQZ A;  2KPY A;  2E0H A;  5AQM A;  5AQY A;  4IO8 A;  2QJ2 A;  1QQO A;  3FE1 A;  2SN3 A;  4APL A;  1OZZ A;  1Z40 A;  1NGC A;  1BCG A;  2YEO A;  2Z8V A;  2G2K A;  4H5W A;  1SEG A;  2I61 A;  1BMR A;  5COE A;  2MN5 A;  1ATR A;  1NH5 A;  1NPI A;  1WT7 A;  1ZVE A;  5EVZ A;  1AYJ A;  3KP1 A;  3FZH A;  3SRJ A;  1NGH A;  4Z0E A;  1NRB A;  2BUP A;  5I25 A;  1NGJ A;  2E8A A;  2N69 A;  5EX5 A;  2YIO A;  1NGA A;  4UAD E;  2KGQ A;  5CS1 A;  3ZWZ A;  2Y8R A;  2YIP A;  5FPE A;  4H5T A;  5BN9 A;  3LDO A;  1NK1 A;  1T7A A;  1HKY A;  1S3X A;  2QWP A;  1GP9 A;  3HMR A;  1NGI A;  5AQN A;  2LJM A;  3ATV A;  2NY9 X;  3KC6 A;  3KVG A;  2V7Z A;  1PTX A;  1PE4 A;  5KK4 A;  4YIV A;  1LQQ A;  1GMO A;  3QFP A;  1T7E A;  1JZB A;  3GKU A;  3HMS A;  1CHZ A;  2Z8W A;  4Z0D A;  4R1A A;  3SF4 D;  1DQ7 A;  2E3G A;  1ICA A;  5AQP A;  2F83 A;  2BRZ A;  1SN1 A;  2LJ7 A;  2YC1 C;  3SRI A;  1VNA A;  1LQH A;  1QQM A;  1GMN A; 
#chains in the Genus database with same CATH homology
 1W81 A;  5AQV A;  5AQG A;  2D56 A;  2X2Z A;  5EVZ A;  2VY6 A;  2KHO A;  5AQK A;  3R2V A;  3FZH A;  3SRJ A;  1NGF A;  1NGH A;  4KBO A;  5EXW A;  4Z0E A;  3ATU A;  5AQT A;  2BUP A;  5CSQ A;  1BA1 A;  1HJO A;  3LDN A;  4APM A;  5I25 A;  3LDL A;  1NGJ A;  2E8A A;  4A5T S;  2QJ4 A;  3QI7 A;  5EX5 A;  3D2E B;  3ZLE A;  3L6Q A;  2YIO A;  5AQW A;  2E2F A;  4H5V A;  5FPN A;  2LN8 A;  3HN4 A;  3GDQ A;  4IUA A;  3LDP A;  1NGA A;  1NGB A;  3A8Y A;  4UAD E;  5CS1 A;  3ZWZ A;  1W8K A;  5BN8 A;  2Y8R A;  1POI A;  2YIP A;  5FPE A;  2J8J A;  5BPL A;  4FL9 A;  4HWI A;  3SP8 A;  5CT3 A;  2QXL A;  1QQN A;  4H5T A;  5AR0 A;  3M3Z A;  2QWR A;  1ATS A;  3GL1 A;  5BN9 A;  3HSC A;  1YXE A;  2LL4 M;  3FZK A;  4UAE F;  1NGD A;  3FZL A;  3LDO A;  2QW9 A;  1NK1 A;  2Q8A A;  3C7N A;  3JXU A;  1BHT A;  3QFU A;  2MBK A;  5CS3 A;  1YUW A;  2QWQ A;  4FSV A;  1HKY A;  5AQI A;  1S3X A;  1BUP A;  2QWP A;  5FPM A;  1GP9 A;  3HMR A;  3I33 A;  3CQX A;  2E88 A;  1NGI A;  5AQH A;  5AQX A;  5AQU A;  4R19 A;  5AQN A;  4UV6 A;  2Q8B A;  3ATV A;  3LDQ A;  5F1X A;  5AQS A;  1NGE A;  5AQJ A;  2J8L A;  1BA0 A;  3D2F B;  4R1B A;  3KC6 A;  2HGF A;  4Z0F A;  3KVG A;  2V7Z A;  5AQQ A;  5BPM A;  3D2E A;  2K13 X;  5CS5 A;  3FZF A;  2K35 A;  4GNI A;  4Z09 A;  5AQO A;  1HX1 A;  2QWO A;  3FZM A;  4YIV A;  2KL5 A;  3CW4 A;  5EOD A;  5FPD A;  5CT1 A;  1NGG A;  5BPN A;  5F2R A;  1GMO A;  2QWL A;  4UAO A;  1KAZ A;  3QFP A;  5AQZ A;  5AQM A;  5AQY A;  2QJ2 A;  4IO8 A;  4R1C A;  1QQO A;  3FE1 A;  3HMS A;  2GMO A;  5AQR A;  2Z8W A;  4H5R A;  4Z0D A;  5AQL A;  4R1A A;  3SF4 D;  3QML A;  4UAF E;  2YIL A;  5CP9 A;  4APL A;  3MKP A;  2QWN A;  5AQP A;  1HPM A;  1Z40 A;  5CS9 A;  3KHW A;  2F83 A;  1NGC A;  2QWM A;  5AQF A;  1KAY A;  3L4I A;  5EY4 A;  5F0X A;  4YIZ A;  5EOK A;  4DUR A;  2Z8V A;  3BK3 C;  2JDQ D;  4H5W A;  5CT2 A;  3AY9 A;  3SRI A;  1I8N A;  1DKG D;  5COE A;  2MN5 A;  3L56 A;  4H5N A;  1KAX A;  1ATR A;  3D2F A;  2LL3 A;  1QQM A;  3IUC A;  1GMN A;  3HMT A;  3C7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...