2YIPA

Crystal structure of parasite sarcocystis muris microneme protein sml- 2 in complex with 1-thio-beta-d-galactose (spacegroup p212121)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
QLDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 35
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yipA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yipA01
2YIOA 3HMTA 5COEA 5CT2A 2Y8RA 3HMRA 4DURA 4Z0DA 2YILA 2QJ2A 3HN4A 4Z0FA 5EODA 2F83A 2K13X 3ZLEA 4A5TS 4R1BA 1YXEA 4R19A 3ZWZA 1BHTA 1I8NA 1W8KA 1HKYA 2Q8BA 3SRIA 2J8JA 5CS9A 3HMSA 2QJ4A 4R1AA 2Q8AA 2Z8VA 4Z09A 4Z0EA 2X2ZA 2J8LA 4APMA 1GMOA 5CT1A 4IUAA 3SP8A 2LL3A 5CS5A 2YIPA 1NK1A 1W81A 3SRJA 4UV6A 5EOKA 1Z40A 4R1CA 5CS1A 3MKPA 5I25A 5CP9A 2LL4M 4APLA 2Z8WA 2HGFA 5CS3A 1GMNA 5CT3A 1GP9A 5CSQA 4UAOA
chains in the Genus database with same CATH superfamily
1HJOA 2BRZA 4UAFE 3E7RL 3KOXA 3QFUA 2LY6A 2LT8A 3GDQA 2J8JA 3PSMA 2LKBA 3C7NA 1ATRA 1ICAA 2KL5A 4H5NA 5AQXA 2QWRA 5BN8A 5AQMA 5FPEA 2YC1C 1BHTA 4H5TA 3LDOA 2LL3A 5AQYA 4YIZA 5EOKA 1I6FA 4R1CA 3GL1A 3I33A 2M8BB 5EY4A 1QQOA 3HMRA 2LJMA 2MBKA 3KP0A 3HN4A 5AQLA 1B7DA 2E8AA 1I8NA 2D56A 1PX9A 1NGJA 1T0ZA 2J8LA 4APMA 3KOYA 1POIA 4IUAA 2KYQA 3SF4D 1QQNA 2Z8WA 1HPMA 4UAOA 5AQGA 5COEA 1T7BA 2Y8RA 3D2FB 3KOZA 4DURA 1NGHA 3KHWA 2K13X 3ZLEA 1KAZA 3QFPA 5AQOA 5EVZA 2NY8X 2QXLA 1AYJA 1P00A 4FL9A 3D2EB 1B3CA 1Z40A 2VY6A 3GKUA 2HGFA 2QWNA 5AQUA 1GP9A 1ZVGA 3L56A 2YBRC 2QWLA 2N66A 2F83A 1ZYWA 3JXUA 4R19A 1SN4A 5F2RA 3M3ZA 1NGGA 3SRJA 2LL4M 3LDPA 3LDLA 2A7TA 1JZAA 1BA0A 1BA1A 2QWQA 5AQJA 5FPMA 2V7ZA 4AAZA 1NE5A 3FZHA 5AQTA 1BK8A 1W8KA 5BPMA 1HKYA 4YIVA 1JZBA 1NGIA 3AY9A 2MZ0A 2KBKA 4FSVA 3FZFA 2K35A 1ZYVA 1I2VA 1MYNA 5CS3A 3L6QA 2KBHA 3A8YA 5FPNA 1P0AA 4Z09A 5CS9A 3HMSA 4KBOA 2KJAA 3LDNA 4HWIA 1I6GA 2YEOA 3D2FA 3IUCA 1CN2A 3FZMA 5CP9A 1TI5A 5AQZA 5BN9A 2I61A 2QWPA 1OZZA 3ATUA 2JDQD 4Z0DA 2B68A 5FPDA 1WWNA 2QJ4A 1T7EA 1NRBA 2E3GA 2LY5A 3SP8A 5CS5A 1NK1A 5CS1A 1NGDA 3KOWA 1DJTA 4H5WA 1N4NA 1C56A 5AQVA 4KYPA 5EODA 4R1BA 4H5RA 4AB0A 2X2ZA 1MR4A 1ZVEA 4H5VA 1VNBA 5EXWA 1YUWA 3FE1A 3E7UX 2KSKA 1PE4A 2LN8A 1NGCA 2GMOA 1ZU3A 1DQ7A 5F0XA 2YILA 1QQMA 1NGFA 5BPNA 5EX5A 2KPYA 1I2UA 3SRIA 4V1DC 1BUPA 2BUPA 2N69A 3QI7A 4Z0EA 2QWMA 2MN5A 1DKGD 5CT1A 2E0HA 4HE7A 1HX1A 2B3CA 2KGQA 1ATSA 1NH5A 2QWOA 1LQIA 3CW4A 4A5TS 2E2FA 1WMTA 5AQHA 1S3XA 2Q8BA 2NY9X 1NGEA 2ASCA 2SN3A 5AQKA 1W81A 4UV6A 4APLA 1NGBA 1NPIA 5CSQA 2GL1A 3CQXA 1NRAA 5AQRA 1BRZA 2Z8VA 1WT7A 1NGAA 1T1TA 2YIPA 2QW9A 2ATBA 5AR0A 1L4VA 3HMTA 5CT2A 5AQNA 1JKZA 4HHFA 4UADE 1K8BA 5AQIA 3D2EA 1SEGA 2N2QA 1BCGA 4CQKA 4R1AA 2Q8AA 3LDQA 3KC6A 1GMOA 2KBJA 1GPSA 4GNIA 1JXCA 3BK3C 1KAYA 1KV0A 5I25A 3C7NB 2LR3A 1GPTA 1LQHA 2LI7A 5AQWA 1YXEA 2N2RA 5AQSA 1UGLA 1T7AA 3L4IA 2E3FA 4AEIA 1KAXA 2LJ7A 3R2VA 1AHOA 2QJ2A 1CHZA 2KHOA 5F1XA 5CY0A 5KK4A 5AQPA 1FH3A 1BMRA 1LQQA 5BPLA 2E88A 2G2KA 3KVGA 3MKPA 1SN1A 1GMNA 5CT3A 1VNAA 2YIOA 1PTXA 1XRSB 4IO8A 1OMYA 4Z0FA 1SNBA 3ZWZA 3QMLA 3FZKA 3FZLA 5AQQA 5AQFA 1C55A 3ATVA 4UAEF 1ZFUA 3HSCA 1ZUTA 3KP1A 4UJ0A
chains in the Genus database with same CATH topology
4H5WA 1HJOA 3L56A 3HMTA 5AQVA 5CT2A 4UAFE 5AQNA 4UADE 2QWLA 5EODA 2F83A 3JXUA 4R1BA 5AQIA 4R19A 3D2EA 3QFUA 4H5RA 3GDQA 2J8JA 4R1AA 2Q8AA 2X2ZA 3LDQA 5F2RA 3KC6A 1GMOA 4H5VA 3C7NA 5EXWA 3M3ZA 1ATRA 1NGGA 4GNIA 3SRJA 1YUWA 3FE1A 2KL5A 3BK3C 4H5NA 5AQXA 2LL4M 1KAYA 3LDPA 2QWRA 3LDLA 5BN8A 1BA0A 5I25A 2LN8A 1GP9A 1NGCA 1BA1A 2GMOA 2QWQA 3C7NB 5AQMA 5F0XA 5AQJA 2YILA 1QQMA 2V7ZA 5FPMA 1NGFA 5BPNA 5FPEA 5EX5A 5AQWA 1YXEA 3FZHA 5AQTA 1BHTA 1W8KA 5BPMA 1HKYA 4H5TA 4YIVA 1BUPA 2BUPA 5AQSA 3SRIA 3QI7A 4Z0EA 2QWMA 2MN5A 1NGIA 3L4IA 1DKGD 5CT1A 3AY9A 1KAXA 3LDOA 4FSVA 5AQYA 2LL3A 4YIZA 3FZFA 2K35A 3R2VA 5EOKA 4R1CA 1HX1A 3GL1A 5CS3A 3L6QA 3I33A 5EY4A 1QQOA 3A8YA 3HMRA 2MBKA 2QJ2A 2KHOA 5FPNA 3HN4A 1ATSA 3CW4A 2QWOA 5AQLA 4A5TS 5F1XA 2E2FA 2E8AA 5AQHA 1I8NA 2D56A 5AQPA 1S3XA 4Z09A 5CS9A 3HMSA 2Q8BA 4KBOA 1NGJA 5BPLA 2J8LA 3LDNA 4APMA 2E88A 4HWIA 1POIA 4IUAA 1NGEA 3D2FA 3KVGA 5AQKA 1W81A 4UV6A 3IUCA 3MKPA 3FZMA 3SF4D 5CP9A 5BN9A 5AQZA 1QQNA 4APLA 1NGBA 2Z8WA 1HPMA 2QWPA 1GMNA 5CT3A 5CSQA 4UAOA 2YIOA 5AQGA 5COEA 3ATUA 2JDQD 4IO8A 2Y8RA 3D2FB 4DURA 1NGHA 4Z0DA 3KHWA 3CQXA 5FPDA 4Z0FA 2K13X 3ZLEA 5AQRA 1KAZA 3QFPA 3ZWZA 5AQOA 3QMLA 5EVZA 2QJ4A 3FZKA 2Z8VA 3FZLA 5AQQA 5AQFA 1NGAA 3SP8A 2QXLA 3ATVA 4UAEF 4FL9A 2YIPA 3D2EB 1NK1A 5CS5A 1Z40A 2QW9A 5CS1A 1NGDA 2VY6A 5AR0A 2HGFA 2QWNA 5AQUA 3HSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIO A;  3HMT A;  5COE A;  5CT2 A;  2Y8R A;  3HMR A;  4DUR A;  4Z0D A;  2YIL A;  2QJ2 A;  3HN4 A;  4Z0F A;  5EOD A;  2F83 A;  2K13 X;  3ZLE A;  4A5T S;  4R1B A;  1YXE A;  4R19 A;  3ZWZ A;  1BHT A;  1I8N A;  1W8K A;  1HKY A;  2Q8B A;  3SRI A;  2J8J A;  5CS9 A;  3HMS A;  2QJ4 A;  4R1A A;  2Q8A A;  2Z8V A;  4Z09 A;  4Z0E A;  2X2Z A;  2J8L A;  4APM A;  1GMO A;  5CT1 A;  4IUA A;  3SP8 A;  2LL3 A;  5CS5 A;  2YIP A;  1NK1 A;  1W81 A;  3SRJ A;  4UV6 A;  5EOK A;  1Z40 A;  4R1C A;  5CS1 A;  3MKP A;  5I25 A;  5CP9 A;  2LL4 M;  4APL A;  2Z8W A;  2HGF A;  5CS3 A;  1GMN A;  5CT3 A;  1GP9 A;  5CSQ A;  4UAO A; 
#chains in the Genus database with same CATH topology
 1HJO A;  2BRZ A;  4UAF E;  3E7R L;  3KOX A;  3QFU A;  2LY6 A;  2LT8 A;  3GDQ A;  2J8J A;  3PSM A;  2LKB A;  3C7N A;  1ATR A;  1ICA A;  2KL5 A;  4H5N A;  5AQX A;  2QWR A;  5BN8 A;  5AQM A;  5FPE A;  2YC1 C;  1BHT A;  4H5T A;  3LDO A;  2LL3 A;  5AQY A;  4YIZ A;  5EOK A;  1I6F A;  4R1C A;  3GL1 A;  3I33 A;  2M8B B;  5EY4 A;  1QQO A;  3HMR A;  2LJM A;  2MBK A;  3KP0 A;  3HN4 A;  5AQL A;  1B7D A;  2E8A A;  1I8N A;  2D56 A;  1PX9 A;  1NGJ A;  1T0Z A;  2J8L A;  4APM A;  3KOY A;  1POI A;  4IUA A;  2KYQ A;  3SF4 D;  1QQN A;  2Z8W A;  1HPM A;  4UAO A;  5AQG A;  5COE A;  1T7B A;  2Y8R A;  3D2F B;  3KOZ A;  4DUR A;  1NGH A;  3KHW A;  2K13 X;  3ZLE A;  1KAZ A;  3QFP A;  5AQO A;  5EVZ A;  2NY8 X;  2QXL A;  1AYJ A;  1P00 A;  4FL9 A;  3D2E B;  1B3C A;  1Z40 A;  2VY6 A;  3GKU A;  2HGF A;  2QWN A;  5AQU A;  1GP9 A;  1ZVG A;  3L56 A;  2YBR C;  2QWL A;  2N66 A;  2F83 A;  1ZYW A;  3JXU A;  4R19 A;  1SN4 A;  5F2R A;  3M3Z A;  1NGG A;  3SRJ A;  2LL4 M;  3LDP A;  3LDL A;  2A7T A;  1JZA A;  1BA0 A;  1BA1 A;  2QWQ A;  5AQJ A;  5FPM A;  2V7Z A;  4AAZ A;  1NE5 A;  3FZH A;  5AQT A;  1BK8 A;  1W8K A;  5BPM A;  1HKY A;  4YIV A;  1JZB A;  1NGI A;  3AY9 A;  2MZ0 A;  2KBK A;  4FSV A;  3FZF A;  2K35 A;  1ZYV A;  1I2V A;  1MYN A;  5CS3 A;  3L6Q A;  2KBH A;  3A8Y A;  5FPN A;  1P0A A;  4Z09 A;  5CS9 A;  3HMS A;  4KBO A;  2KJA A;  3LDN A;  4HWI A;  1I6G A;  2YEO A;  3D2F A;  3IUC A;  1CN2 A;  3FZM A;  5CP9 A;  1TI5 A;  5AQZ A;  5BN9 A;  2I61 A;  2QWP A;  1OZZ A;  3ATU A;  2JDQ D;  4Z0D A;  2B68 A;  5FPD A;  1WWN A;  2QJ4 A;  1T7E A;  1NRB A;  2E3G A;  2LY5 A;  3SP8 A;  5CS5 A;  1NK1 A;  5CS1 A;  1NGD A;  3KOW A;  1DJT A;  4H5W A;  1N4N A;  1C56 A;  5AQV A;  4KYP A;  5EOD A;  4R1B A;  4H5R A;  4AB0 A;  2X2Z A;  1MR4 A;  1ZVE A;  4H5V A;  1VNB A;  5EXW A;  1YUW A;  3FE1 A;  3E7U X;  2KSK A;  1PE4 A;  2LN8 A;  1NGC A;  2GMO A;  1ZU3 A;  1DQ7 A;  5F0X A;  2YIL A;  1QQM A;  1NGF A;  5BPN A;  5EX5 A;  2KPY A;  1I2U A;  3SRI A;  4V1D C;  1BUP A;  2BUP A;  2N69 A;  3QI7 A;  4Z0E A;  2QWM A;  2MN5 A;  1DKG D;  5CT1 A;  2E0H A;  4HE7 A;  1HX1 A;  2B3C A;  2KGQ A;  1ATS A;  1NH5 A;  2QWO A;  1LQI A;  3CW4 A;  4A5T S;  2E2F A;  1WMT A;  5AQH A;  1S3X A;  2Q8B A;  2NY9 X;  1NGE A;  2ASC A;  2SN3 A;  5AQK A;  1W81 A;  4UV6 A;  4APL A;  1NGB A;  1NPI A;  5CSQ A;  2GL1 A;  3CQX A;  1NRA A;  5AQR A;  1BRZ A;  2Z8V A;  1WT7 A;  1NGA A;  1T1T A;  2YIP A;  2QW9 A;  2ATB A;  5AR0 A;  1L4V A;  3HMT A;  5CT2 A;  5AQN A;  1JKZ A;  4HHF A;  4UAD E;  1K8B A;  5AQI A;  3D2E A;  1SEG A;  2N2Q A;  1BCG A;  4CQK A;  4R1A A;  2Q8A A;  3LDQ A;  3KC6 A;  1GMO A;  2KBJ A;  1GPS A;  4GNI A;  1JXC A;  3BK3 C;  1KAY A;  1KV0 A;  5I25 A;  3C7N B;  2LR3 A;  1GPT A;  1LQH A;  2LI7 A;  5AQW A;  1YXE A;  2N2R A;  5AQS A;  1UGL A;  1T7A A;  3L4I A;  2E3F A;  4AEI A;  1KAX A;  2LJ7 A;  3R2V A;  1AHO A;  2QJ2 A;  1CHZ A;  2KHO A;  5F1X A;  5CY0 A;  5KK4 A;  5AQP A;  1FH3 A;  1BMR A;  1LQQ A;  5BPL A;  2E88 A;  2G2K A;  3KVG A;  3MKP A;  1SN1 A;  1GMN A;  5CT3 A;  1VNA A;  2YIO A;  1PTX A;  1XRS B;  4IO8 A;  1OMY A;  4Z0F A;  1SNB A;  3ZWZ A;  3QML A;  3FZK A;  3FZL A;  5AQQ A;  5AQF A;  1C55 A;  3ATV A;  4UAE F;  1ZFU A;  3HSC A;  1ZUT A;  3KP1 A;  4UJ0 A; 
#chains in the Genus database with same CATH homology
 4H5W A;  1HJO A;  3L56 A;  3HMT A;  5AQV A;  5CT2 A;  4UAF E;  5AQN A;  4UAD E;  2QWL A;  5EOD A;  2F83 A;  3JXU A;  4R1B A;  5AQI A;  4R19 A;  3D2E A;  3QFU A;  4H5R A;  3GDQ A;  2J8J A;  4R1A A;  2Q8A A;  2X2Z A;  3LDQ A;  5F2R A;  3KC6 A;  1GMO A;  4H5V A;  3C7N A;  5EXW A;  3M3Z A;  1ATR A;  1NGG A;  4GNI A;  3SRJ A;  1YUW A;  3FE1 A;  2KL5 A;  3BK3 C;  4H5N A;  5AQX A;  2LL4 M;  1KAY A;  3LDP A;  2QWR A;  3LDL A;  5BN8 A;  1BA0 A;  5I25 A;  2LN8 A;  1GP9 A;  1NGC A;  1BA1 A;  2GMO A;  2QWQ A;  3C7N B;  5AQM A;  5F0X A;  5AQJ A;  2YIL A;  1QQM A;  2V7Z A;  5FPM A;  1NGF A;  5BPN A;  5FPE A;  5EX5 A;  5AQW A;  1YXE A;  3FZH A;  5AQT A;  1BHT A;  1W8K A;  5BPM A;  1HKY A;  4H5T A;  4YIV A;  1BUP A;  2BUP A;  5AQS A;  3SRI A;  3QI7 A;  4Z0E A;  2QWM A;  2MN5 A;  1NGI A;  3L4I A;  1DKG D;  5CT1 A;  3AY9 A;  1KAX A;  3LDO A;  4FSV A;  5AQY A;  2LL3 A;  4YIZ A;  3FZF A;  2K35 A;  3R2V A;  5EOK A;  4R1C A;  1HX1 A;  3GL1 A;  5CS3 A;  3L6Q A;  3I33 A;  5EY4 A;  1QQO A;  3A8Y A;  3HMR A;  2MBK A;  2QJ2 A;  2KHO A;  5FPN A;  3HN4 A;  1ATS A;  3CW4 A;  2QWO A;  5AQL A;  4A5T S;  5F1X A;  2E2F A;  2E8A A;  5AQH A;  1I8N A;  2D56 A;  5AQP A;  1S3X A;  4Z09 A;  5CS9 A;  3HMS A;  2Q8B A;  4KBO A;  1NGJ A;  5BPL A;  2J8L A;  3LDN A;  4APM A;  2E88 A;  4HWI A;  1POI A;  4IUA A;  1NGE A;  3D2F A;  3KVG A;  5AQK A;  1W81 A;  4UV6 A;  3IUC A;  3MKP A;  3FZM A;  3SF4 D;  5CP9 A;  5BN9 A;  5AQZ A;  1QQN A;  4APL A;  1NGB A;  2Z8W A;  1HPM A;  2QWP A;  1GMN A;  5CT3 A;  5CSQ A;  4UAO A;  2YIO A;  5AQG A;  5COE A;  3ATU A;  2JDQ D;  4IO8 A;  2Y8R A;  3D2F B;  4DUR A;  1NGH A;  4Z0D A;  3KHW A;  3CQX A;  5FPD A;  4Z0F A;  2K13 X;  3ZLE A;  5AQR A;  1KAZ A;  3QFP A;  3ZWZ A;  5AQO A;  3QML A;  5EVZ A;  2QJ4 A;  3FZK A;  2Z8V A;  3FZL A;  5AQQ A;  5AQF A;  1NGA A;  3SP8 A;  2QXL A;  3ATV A;  4UAE F;  4FL9 A;  2YIP A;  3D2E B;  1NK1 A;  5CS5 A;  1Z40 A;  2QW9 A;  5CS1 A;  1NGD A;  2VY6 A;  5AR0 A;  2HGF A;  2QWN A;  5AQU A;  3HSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...