2J8LA

Fxi apple 4 domain loop-out conformation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
FCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAGULATION FACTOR XI
publication title Solution Structure of the A4 Domain of Factor Xi Sheds Light on the Mechanism of Zymogen Activation.
pubmed doi rcsb
molecule tags Hydrolase
total genus 17
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.4.21.27: Coagulation factor XIa.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2j8lA00
5EOKA 4R1BA 2J8JA 3HN4A 4IUAA 3SRIA 4Z09A 4Z0DA 2HGFA 3HMSA 3MKPA 5CS9A 1YXEA 5CS1A 1GMOA 5CT3A 2J8LA 2X2ZA 1W81A 2YIPA 3ZLEA 4R19A 2K13X 5CS3A 4Z0EA 2Y8RA 4R1AA 5COEA 1HKYA 5CT2A 2YIOA 1I8NA 2QJ2A 3SRJA 4A5TS 4DURA 5I25A 4UV6A 5CSQA 2LL4M 2YILA 5CS5A 5CP9A 2Q8AA 4R1CA 1BHTA 2QJ4A 2Z8WA 1NK1A 3HMTA 5EODA 1GP9A 2Q8BA 3SP8A 4UAOA 1W8KA 3ZWZA 1Z40A 2LL3A 3HMRA 4APLA 4APMA 4Z0FA 5CT1A 2Z8VA 1GMNA 2F83A
chains in the Genus database with same CATH superfamily
5EOKA 4R1BA 2J8JA 3HN4A 4IUAA 3SRIA 4Z09A 4Z0DA 2HGFA 3HMSA 3MKPA 5CS9A 1YXEA 5CS1A 1GMOA 2KL5A 5CT3A 2J8LA 2X2ZA 1W81A 2YIPA 3ZLEA 4R19A 2K13X 5CS3A 4Z0EA 2Y8RA 4R1AA 5COEA 1HKYA 5CT2A 2YIOA 1I8NA 2QJ2A 3SRJA 4A5TS 4DURA 5I25A 4UV6A 5CSQA 4YIZA 2LL4M 2YILA 5CS5A 5CP9A 2Q8AA 4R1CA 1BHTA 2QJ4A 2Z8WA 1NK1A 3HMTA 5EODA 1GP9A 2Q8BA 3SP8A 4UAOA 1W8KA 3ZWZA 1Z40A 2LL3A 3HMRA 4APLA 4APMA 4Z0FA 5CT1A 2Z8VA 1GMNA 2F83A 4YIVA
chains in the Genus database with same CATH topology
5EOKA 4R1BA 2J8JA 3HN4A 4IUAA 3SRIA 4Z09A 4Z0DA 2HGFA 3HMSA 3MKPA 5CS9A 1YXEA 5CS1A 1GMOA 2KL5A 5CT3A 2J8LA 2X2ZA 1W81A 2YIPA 3ZLEA 4R19A 2K13X 5CS3A 4Z0EA 2Y8RA 4R1AA 5COEA 1HKYA 5CT2A 2YIOA 1I8NA 2QJ2A 3SRJA 4A5TS 4DURA 5I25A 4UV6A 5CSQA 4YIZA 2LL4M 2YILA 5CS5A 5CP9A 2Q8AA 4R1CA 1BHTA 2QJ4A 2Z8WA 1NK1A 3HMTA 5EODA 1GP9A 2Q8BA 3SP8A 4UAOA 1W8KA 3ZWZA 1Z40A 2LL3A 3HMRA 4APLA 4APMA 4Z0FA 5CT1A 2Z8VA 1GMNA 2F83A 4YIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOK A;  4R1B A;  2J8J A;  3HN4 A;  4IUA A;  3SRI A;  4Z09 A;  4Z0D A;  2HGF A;  3HMS A;  3MKP A;  5CS9 A;  1YXE A;  5CS1 A;  1GMO A;  5CT3 A;  2J8L A;  2X2Z A;  1W81 A;  2YIP A;  3ZLE A;  4R19 A;  2K13 X;  5CS3 A;  4Z0E A;  2Y8R A;  4R1A A;  5COE A;  1HKY A;  5CT2 A;  2YIO A;  1I8N A;  2QJ2 A;  3SRJ A;  4A5T S;  4DUR A;  5I25 A;  4UV6 A;  5CSQ A;  2LL4 M;  2YIL A;  5CS5 A;  5CP9 A;  2Q8A A;  4R1C A;  1BHT A;  2QJ4 A;  2Z8W A;  1NK1 A;  3HMT A;  5EOD A;  1GP9 A;  2Q8B A;  3SP8 A;  4UAO A;  1W8K A;  3ZWZ A;  1Z40 A;  2LL3 A;  3HMR A;  4APL A;  4APM A;  4Z0F A;  5CT1 A;  2Z8V A;  1GMN A;  2F83 A; 
#chains in the Genus database with same CATH topology
 5EOK A;  4R1B A;  2J8J A;  3HN4 A;  4IUA A;  3SRI A;  4Z09 A;  4Z0D A;  2HGF A;  3HMS A;  3MKP A;  5CS9 A;  1YXE A;  5CS1 A;  1GMO A;  2KL5 A;  5CT3 A;  2J8L A;  2X2Z A;  1W81 A;  2YIP A;  3ZLE A;  4R19 A;  2K13 X;  5CS3 A;  4Z0E A;  2Y8R A;  4R1A A;  5COE A;  1HKY A;  5CT2 A;  2YIO A;  1I8N A;  2QJ2 A;  3SRJ A;  4A5T S;  4DUR A;  5I25 A;  4UV6 A;  5CSQ A;  4YIZ A;  2LL4 M;  2YIL A;  5CS5 A;  5CP9 A;  2Q8A A;  4R1C A;  1BHT A;  2QJ4 A;  2Z8W A;  1NK1 A;  3HMT A;  5EOD A;  1GP9 A;  2Q8B A;  3SP8 A;  4UAO A;  1W8K A;  3ZWZ A;  1Z40 A;  2LL3 A;  3HMR A;  4APL A;  4APM A;  4Z0F A;  5CT1 A;  2Z8V A;  1GMN A;  2F83 A;  4YIV A; 
#chains in the Genus database with same CATH homology
 5EOK A;  4R1B A;  2J8J A;  3HN4 A;  4IUA A;  3SRI A;  4Z09 A;  4Z0D A;  2HGF A;  3HMS A;  3MKP A;  5CS9 A;  1YXE A;  5CS1 A;  1GMO A;  2KL5 A;  5CT3 A;  2J8L A;  2X2Z A;  1W81 A;  2YIP A;  3ZLE A;  4R19 A;  2K13 X;  5CS3 A;  4Z0E A;  2Y8R A;  4R1A A;  5COE A;  1HKY A;  5CT2 A;  2YIO A;  1I8N A;  2QJ2 A;  3SRJ A;  4A5T S;  4DUR A;  5I25 A;  4UV6 A;  5CSQ A;  4YIZ A;  2LL4 M;  2YIL A;  5CS5 A;  5CP9 A;  2Q8A A;  4R1C A;  1BHT A;  2QJ4 A;  2Z8W A;  1NK1 A;  3HMT A;  5EOD A;  1GP9 A;  2Q8B A;  3SP8 A;  4UAO A;  1W8K A;  3ZWZ A;  1Z40 A;  2LL3 A;  3HMR A;  4APL A;  4APM A;  4Z0F A;  5CT1 A;  2Z8V A;  1GMN A;  2F83 A;  4YIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...