2J8LA

Fxi apple 4 domain loop-out conformation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
b'FCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAGULATION FACTOR XI
publication title Solution Structure of the A4 Domain of Factor Xi Sheds Light on the Mechanism of Zymogen Activation.
pubmed doi rcsb
molecule tags Hydrolase
total genus 17
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.4.21.27: Coagulation factor XIa.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2j8lA00
2F83A 3ZLEA 2HGFA 5CS9A 5CT2A 2LL4M 1GP9A 3MKPA 5EODA 5COEA 2J8JA 2Z8VA 3SRJA 1W8KA 2LL3A 5CSQA 1NK1A 3HMSA 1GMOA 3SP8A 4Z0FA 3HN4A 5CS1A 4Z09A 5CS3A 2Q8BA 2Z8WA 2YIOA 4R1AA 4R1BA 1YXEA 1HKYA 1Z40A 2YILA 4Z0EA 3SRIA 4R19A 4UAOA 1W81A 5CT3A 5I25A 2J8LA 1I8NA 2Q8AA 1BHTA 1GMNA 2Y8RA 2QJ4A 2YIPA 5EOKA 5CS5A 4A5TS 3HMRA 5CP9A 3ZWZA 4IUAA 4Z0DA 4R1CA 5CT1A 4DURA 2K13X 4APLA 4UV6A 4APMA 3HMTA 2X2ZA 2QJ2A
chains in the Genus database with same CATH superfamily
2F83A 3ZLEA 2HGFA 5CS9A 5CT2A 2LL4M 1GP9A 3MKPA 4YIZA 5EODA 5COEA 2J8JA 2Z8VA 3SRJA 1W8KA 2LL3A 5CSQA 1NK1A 3HMSA 1GMOA 3SP8A 4Z0FA 3HN4A 5CS1A 4Z09A 5CS3A 2Q8BA 2Z8WA 2YIOA 4R1AA 4R1BA 1YXEA 1HKYA 1Z40A 2YILA 4Z0EA 3SRIA 4R19A 4UAOA 1W81A 5CT3A 5I25A 2J8LA 1I8NA 2Q8AA 1BHTA 1GMNA 2Y8RA 2QJ4A 2YIPA 5EOKA 5CS5A 4A5TS 3HMRA 5CP9A 3ZWZA 4IUAA 4Z0DA 2KL5A 4R1CA 5CT1A 4DURA 2K13X 4APLA 4UV6A 4APMA 4YIVA 3HMTA 2X2ZA 2QJ2A
chains in the Genus database with same CATH topology
2F83A 3ZLEA 2HGFA 5CS9A 5CT2A 2LL4M 1GP9A 3MKPA 4YIZA 5EODA 5COEA 2J8JA 2Z8VA 3SRJA 1W8KA 2LL3A 5CSQA 1NK1A 3HMSA 1GMOA 3SP8A 4Z0FA 3HN4A 5CS1A 4Z09A 5CS3A 2Q8BA 2Z8WA 2YIOA 4R1AA 4R1BA 1YXEA 1HKYA 1Z40A 2YILA 4Z0EA 3SRIA 4R19A 4UAOA 1W81A 5CT3A 5I25A 2J8LA 1I8NA 2Q8AA 1BHTA 1GMNA 2Y8RA 2QJ4A 2YIPA 5EOKA 5CS5A 4A5TS 3HMRA 5CP9A 3ZWZA 4IUAA 4Z0DA 2KL5A 4R1CA 5CT1A 4DURA 2K13X 4APLA 4UV6A 4APMA 4YIVA 3HMTA 2X2ZA 2QJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F83 A;  3ZLE A;  2HGF A;  5CS9 A;  5CT2 A;  2LL4 M;  1GP9 A;  3MKP A;  5EOD A;  5COE A;  2J8J A;  2Z8V A;  3SRJ A;  1W8K A;  2LL3 A;  5CSQ A;  1NK1 A;  3HMS A;  1GMO A;  3SP8 A;  4Z0F A;  3HN4 A;  5CS1 A;  4Z09 A;  5CS3 A;  2Q8B A;  2Z8W A;  2YIO A;  4R1A A;  4R1B A;  1YXE A;  1HKY A;  1Z40 A;  2YIL A;  4Z0E A;  3SRI A;  4R19 A;  4UAO A;  1W81 A;  5CT3 A;  5I25 A;  2J8L A;  1I8N A;  2Q8A A;  1BHT A;  1GMN A;  2Y8R A;  2QJ4 A;  2YIP A;  5EOK A;  5CS5 A;  4A5T S;  3HMR A;  5CP9 A;  3ZWZ A;  4IUA A;  4Z0D A;  4R1C A;  5CT1 A;  4DUR A;  2K13 X;  4APL A;  4UV6 A;  4APM A;  3HMT A;  2X2Z A;  2QJ2 A; 
#chains in the Genus database with same CATH topology
 2F83 A;  3ZLE A;  2HGF A;  5CS9 A;  5CT2 A;  2LL4 M;  1GP9 A;  3MKP A;  4YIZ A;  5EOD A;  5COE A;  2J8J A;  2Z8V A;  3SRJ A;  1W8K A;  2LL3 A;  5CSQ A;  1NK1 A;  3HMS A;  1GMO A;  3SP8 A;  4Z0F A;  3HN4 A;  5CS1 A;  4Z09 A;  5CS3 A;  2Q8B A;  2Z8W A;  2YIO A;  4R1A A;  4R1B A;  1YXE A;  1HKY A;  1Z40 A;  2YIL A;  4Z0E A;  3SRI A;  4R19 A;  4UAO A;  1W81 A;  5CT3 A;  5I25 A;  2J8L A;  1I8N A;  2Q8A A;  1BHT A;  1GMN A;  2Y8R A;  2QJ4 A;  2YIP A;  5EOK A;  5CS5 A;  4A5T S;  3HMR A;  5CP9 A;  3ZWZ A;  4IUA A;  4Z0D A;  2KL5 A;  4R1C A;  5CT1 A;  4DUR A;  2K13 X;  4APL A;  4UV6 A;  4APM A;  4YIV A;  3HMT A;  2X2Z A;  2QJ2 A; 
#chains in the Genus database with same CATH homology
 2F83 A;  3ZLE A;  2HGF A;  5CS9 A;  5CT2 A;  2LL4 M;  1GP9 A;  3MKP A;  4YIZ A;  5EOD A;  5COE A;  2J8J A;  2Z8V A;  3SRJ A;  1W8K A;  2LL3 A;  5CSQ A;  1NK1 A;  3HMS A;  1GMO A;  3SP8 A;  4Z0F A;  3HN4 A;  5CS1 A;  4Z09 A;  5CS3 A;  2Q8B A;  2Z8W A;  2YIO A;  4R1A A;  4R1B A;  1YXE A;  1HKY A;  1Z40 A;  2YIL A;  4Z0E A;  3SRI A;  4R19 A;  4UAO A;  1W81 A;  5CT3 A;  5I25 A;  2J8L A;  1I8N A;  2Q8A A;  1BHT A;  1GMN A;  2Y8R A;  2QJ4 A;  2YIP A;  5EOK A;  5CS5 A;  4A5T S;  3HMR A;  5CP9 A;  3ZWZ A;  4IUA A;  4Z0D A;  2KL5 A;  4R1C A;  5CT1 A;  4DUR A;  2K13 X;  4APL A;  4UV6 A;  4APM A;  4YIV A;  3HMT A;  2X2Z A;  2QJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...