2YILA

Crystal structure of parasite sarcocystis muris lectin sml-2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
QLDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
total genus 36
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yilA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yilA01
5CT1A 1GMOA 2Q8AA 5CP9A 5EODA 2J8LA 2LL4M 1GMNA 4R1CA 3SP8A 3SRIA 2YILA 2QJ2A 4R19A 2J8JA 2F83A 2LL3A 2Z8VA 3MKPA 4UV6A 5CSQA 4APMA 5CT2A 4R1AA 4APLA 4Z0FA 2YIPA 4IUAA 2X2ZA 4DURA 2HGFA 1Z40A 5CS1A 5I25A 3ZLEA 3HMRA 4R1BA 1NK1A 1GP9A 5EOKA 5CT3A 4Z0EA 1HKYA 1BHTA 1W81A 5CS9A 5CS3A 1W8KA 1I8NA 2K13X 1YXEA 2Y8RA 5COEA 5CS5A 4UAOA 4Z0DA 3ZWZA 4A5TS 2QJ4A 3HMTA 2Z8WA 2Q8BA 2YIOA 3SRJA 3HMSA 4Z09A 3HN4A
chains in the Genus database with same CATH superfamily
5CT1A 3A8YA 4R1CA 2QWRA 5AQFA 1T7BA 3AY9A 5AQQA 1I6GA 1ATRA 1ZUTA 5CT3A 4YIZA 1VNBA 2K13X 2Z8WA 1NGDA 5EODA 5AQMA 1B3CA 2SN3A 3SP8A 1B7DA 1WWNA 4DURA 3LDQA 5I25A 2G2KA 2BUPA 1XRSB 5EY4A 3ATVA 5AQWA 4A5TS 2N2QA 2ATBA 5AR0A 2QXLA 1T7EA 5AQSA 3PSMA 4IO8A 5CT2A 5F1XA 3KOXA 1WT7A 1JZAA 1ZYVA 1C55A 3QI7A 3HMRA 1AHOA 1GP9A 3KHWA 5EVZA 3LDLA 1QQMA 2LJMA 1T1TA 2E3GA 4Z09A 5AQKA 2KPYA 5BN8A 4AB0A 2E88A 1OZZA 2J8JA 1ZYWA 3QFUA 3KOYA 4IUAA 3QMLA 3KC6A 2HGFA 1KV0A 3D2EB 3GKUA 5EX5A 4Z0EA 5F0XA 2YC1C 2QJ4A 4GNIA 1PTXA 3HMSA 1MYNA 3M3ZA 1FH3A 2I61A 1S3XA 2LR3A 3C7NB 2VY6A 5AQXA 1QQNA 1BK8A 5BPNA 1NRBA 2MZ0A 3KOZA 3L6QA 2KBJA 2GMOA 1NGJA 2MBKA 2Y8RA 5COEA 1OMYA 5CY0A 3BK3C 1CN2A 2B3CA 1HX1A 3LDOA 5BPLA 2LL4M 2QWMA 3CQXA 3KP1A 4HWIA 5BN9A 4Z0FA 4H5WA 2X2ZA 3FZMA 1NRAA 5AQIA 1Z40A 2E3FA 1LQIA 4R1BA 3FE1A 1HJOA 1YXEA 3ZWZA 3HMTA 2Q8BA 1I6FA 2KL5A 2LJ7A 2KHOA 2NY8X 3SRIA 2QJ2A 5AQVA 1ZU3A 5FPMA 2QWPA 4HHFA 1BA1A 2K35A 1KAXA 3KOWA 1SEGA 2LY5A 3ZLEA 1ZVGA 4V1DC 1K8BA 1BHTA 1W81A 2LT8A 2QWLA 3L56A 5CS3A 1SN4A 3FZLA 1CHZA 1MR4A 1TI5A 2B68A 3SRJA 3HN4A 4H5NA 4UAFE 2Z8VA 3JXUA 3HSCA 1BUPA 3FZKA 1QQOA 1T7AA 1NK1A 1NGCA 5AQNA 1ATSA 2YEOA 4UAOA 5AQUA 1NGEA 4AEIA 4UADE 1NPIA 4H5TA 3ATUA 1GMNA 4R19A 1KAYA 2LL3A 4UV6A 2LI7A 1NGAA 5CS1A 4UJ0A 1HKYA 1NGGA 1P0AA 1GPTA 4Z0DA 2E0HA 1HPMA 1C56A 2Q8AA 1LQQA 2J8LA 5AQOA 1ZVEA 2F83A 4KYPA 4APLA 4R1AA 3FZFA 5AQZA 1NE5A 2D56A 1YUWA 1P00A 1PE4A 1JZBA 1SNBA 2QWQA 2V7ZA 1T0ZA 1AYJA 3E7RL 4FL9A 4CQKA 5EXWA 1SN1A 1BA0A 1JKZA 3I33A 1ZFUA 2QW9A 4YIVA 2LKBA 1NGHA 1NGBA 2YILA 1L4VA 4H5VA 2YBRC 3LDPA 1VNAA 2KYQA 2BRZA 3IUCA 1UGLA 1NGIA 4H5RA 4KBOA 2MN5A 1ICAA 2KGQA 5F2RA 3LDNA 2GL1A 2M8BB 1DJTA 3E7UX 3KP0A 2QWNA 3KVGA 5FPEA 2KBHA 4AAZA 1I2VA 1GPSA 5AQYA 5AQGA 2YIOA 2LY6A 5CP9A 1JXCA 5BPMA 2KJAA 2QWOA 3MKPA 2NY9X 3R2VA 1NGFA 5FPDA 5AQJA 5AQTA 2KSKA 2A7TA 1DQ7A 5AQLA 4HE7A 1BMRA 1W8KA 2N2RA 3GL1A 2E8AA 1POIA 3GDQA 2KBKA 1PX9A 1GMOA 1DKGD 3CW4A 3FZHA 3L4IA 5AQPA 4UAEF 5KK4A 5CSQA 2YIPA 2N69A 5AQRA 5EOKA 3SF4D 1LQHA 1I8NA 1BRZA 5CS5A 2N66A 4FSVA 1BCGA 3D2FB 3D2EA 2ASCA 1WMTA 2LN8A 5FPNA 5AQHA 4APMA 2JDQD 3QFPA 3D2FA 1KAZA 3C7NA 1I2UA 1N4NA 5CS9A 2E2FA 1NH5A
chains in the Genus database with same CATH topology
3M3ZA 5CT1A 3A8YA 3LDNA 1S3XA 4H5TA 3C7NB 3ATUA 1GMNA 4R1CA 4R19A 1KAYA 2QWRA 2VY6A 5AQFA 2LL3A 4UV6A 5AQXA 2QWNA 3KVGA 1QQNA 3AY9A 5BPNA 5AQQA 3HMSA 1ATRA 1NGAA 5FPEA 5CS1A 3L6QA 5CT3A 1HKYA 2GMOA 1NGJA 2MBKA 4YIZA 1NGGA 5AQYA 2K13X 2Y8RA 5COEA 5AQGA 4Z0DA 2Z8WA 3BK3C 2YIOA 1NGDA 1HX1A 1HPMA 3LDOA 5BPLA 2Q8AA 5CP9A 5EODA 2J8LA 5AQMA 2LL4M 5AQOA 3SP8A 5BPMA 2QWMA 3CQXA 2F83A 2QWOA 4HWIA 5BN9A 3MKPA 4APLA 3R2VA 4R1AA 4Z0FA 4H5WA 1NGFA 3FZFA 5FPDA 2X2ZA 3FZMA 5AQZA 5AQIA 5AQJA 5AQTA 4DURA 3LDQA 1Z40A 5I25A 2D56A 4R1BA 3FE1A 1YUWA 1HJOA 5AQLA 2BUPA 1W8KA 3GL1A 1YXEA 2E8AA 1POIA 3ZWZA 3GDQA 5EY4A 3ATVA 3HMTA 2Q8BA 5AQWA 2KL5A 2QWQA 4A5TS 2V7ZA 5AR0A 2QXLA 1GMOA 2KHOA 1DKGD 3CW4A 3SRIA 3FZHA 2QJ2A 5AQVA 3L4IA 5AQSA 5AQPA 5FPMA 4FL9A 2QWPA 4IO8A 1BA1A 4UAEF 5CSQA 5CT2A 2K35A 2YIPA 1KAXA 5F1XA 5AQRA 5EXWA 1BA0A 3I33A 3QI7A 3ZLEA 3HMRA 1GP9A 5EOKA 3KHWA 5EVZA 1BHTA 3SF4D 2QW9A 1W81A 5CS3A 2QWLA 3L56A 1I8NA 3FZLA 3LDLA 1QQMA 5CS5A 4YIVA 4FSVA 3D2FB 3SRJA 1NGHA 5AQKA 4Z09A 3D2EA 3HN4A 1NGBA 2LN8A 4H5NA 5BN8A 2E88A 2YILA 2J8JA 4UAFE 3QFUA 2Z8VA 3JXUA 5FPNA 4H5VA 5AQHA 4APMA 2JDQD 3HSCA 1BUPA 4IUAA 3QMLA 3KC6A 3QFPA 3LDPA 3D2FA 3FZKA 2HGFA 1QQOA 1KAZA 3C7NA 3IUCA 1NGIA 3D2EB 1NK1A 1NGCA 5EX5A 4Z0EA 4H5RA 4KBOA 5AQNA 5F0XA 2E2FA 2MN5A 5CS9A 1ATSA 4UAOA 2QJ4A 4GNIA 5AQUA 1NGEA 4UADE 5F2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CT1 A;  1GMO A;  2Q8A A;  5CP9 A;  5EOD A;  2J8L A;  2LL4 M;  1GMN A;  4R1C A;  3SP8 A;  3SRI A;  2YIL A;  2QJ2 A;  4R19 A;  2J8J A;  2F83 A;  2LL3 A;  2Z8V A;  3MKP A;  4UV6 A;  5CSQ A;  4APM A;  5CT2 A;  4R1A A;  4APL A;  4Z0F A;  2YIP A;  4IUA A;  2X2Z A;  4DUR A;  2HGF A;  1Z40 A;  5CS1 A;  5I25 A;  3ZLE A;  3HMR A;  4R1B A;  1NK1 A;  1GP9 A;  5EOK A;  5CT3 A;  4Z0E A;  1HKY A;  1BHT A;  1W81 A;  5CS9 A;  5CS3 A;  1W8K A;  1I8N A;  2K13 X;  1YXE A;  2Y8R A;  5COE A;  5CS5 A;  4UAO A;  4Z0D A;  3ZWZ A;  4A5T S;  2QJ4 A;  3HMT A;  2Z8W A;  2Q8B A;  2YIO A;  3SRJ A;  3HMS A;  4Z09 A;  3HN4 A; 
#chains in the Genus database with same CATH topology
 5CT1 A;  3A8Y A;  4R1C A;  2QWR A;  5AQF A;  1T7B A;  3AY9 A;  5AQQ A;  1I6G A;  1ATR A;  1ZUT A;  5CT3 A;  4YIZ A;  1VNB A;  2K13 X;  2Z8W A;  1NGD A;  5EOD A;  5AQM A;  1B3C A;  2SN3 A;  3SP8 A;  1B7D A;  1WWN A;  4DUR A;  3LDQ A;  5I25 A;  2G2K A;  2BUP A;  1XRS B;  5EY4 A;  3ATV A;  5AQW A;  4A5T S;  2N2Q A;  2ATB A;  5AR0 A;  2QXL A;  1T7E A;  5AQS A;  3PSM A;  4IO8 A;  5CT2 A;  5F1X A;  3KOX A;  1WT7 A;  1JZA A;  1ZYV A;  1C55 A;  3QI7 A;  3HMR A;  1AHO A;  1GP9 A;  3KHW A;  5EVZ A;  3LDL A;  1QQM A;  2LJM A;  1T1T A;  2E3G A;  4Z09 A;  5AQK A;  2KPY A;  5BN8 A;  4AB0 A;  2E88 A;  1OZZ A;  2J8J A;  1ZYW A;  3QFU A;  3KOY A;  4IUA A;  3QML A;  3KC6 A;  2HGF A;  1KV0 A;  3D2E B;  3GKU A;  5EX5 A;  4Z0E A;  5F0X A;  2YC1 C;  2QJ4 A;  4GNI A;  1PTX A;  3HMS A;  1MYN A;  3M3Z A;  1FH3 A;  2I61 A;  1S3X A;  2LR3 A;  3C7N B;  2VY6 A;  5AQX A;  1QQN A;  1BK8 A;  5BPN A;  1NRB A;  2MZ0 A;  3KOZ A;  3L6Q A;  2KBJ A;  2GMO A;  1NGJ A;  2MBK A;  2Y8R A;  5COE A;  1OMY A;  5CY0 A;  3BK3 C;  1CN2 A;  2B3C A;  1HX1 A;  3LDO A;  5BPL A;  2LL4 M;  2QWM A;  3CQX A;  3KP1 A;  4HWI A;  5BN9 A;  4Z0F A;  4H5W A;  2X2Z A;  3FZM A;  1NRA A;  5AQI A;  1Z40 A;  2E3F A;  1LQI A;  4R1B A;  3FE1 A;  1HJO A;  1YXE A;  3ZWZ A;  3HMT A;  2Q8B A;  1I6F A;  2KL5 A;  2LJ7 A;  2KHO A;  2NY8 X;  3SRI A;  2QJ2 A;  5AQV A;  1ZU3 A;  5FPM A;  2QWP A;  4HHF A;  1BA1 A;  2K35 A;  1KAX A;  3KOW A;  1SEG A;  2LY5 A;  3ZLE A;  1ZVG A;  4V1D C;  1K8B A;  1BHT A;  1W81 A;  2LT8 A;  2QWL A;  3L56 A;  5CS3 A;  1SN4 A;  3FZL A;  1CHZ A;  1MR4 A;  1TI5 A;  2B68 A;  3SRJ A;  3HN4 A;  4H5N A;  4UAF E;  2Z8V A;  3JXU A;  3HSC A;  1BUP A;  3FZK A;  1QQO A;  1T7A A;  1NK1 A;  1NGC A;  5AQN A;  1ATS A;  2YEO A;  4UAO A;  5AQU A;  1NGE A;  4AEI A;  4UAD E;  1NPI A;  4H5T A;  3ATU A;  1GMN A;  4R19 A;  1KAY A;  2LL3 A;  4UV6 A;  2LI7 A;  1NGA A;  5CS1 A;  4UJ0 A;  1HKY A;  1NGG A;  1P0A A;  1GPT A;  4Z0D A;  2E0H A;  1HPM A;  1C56 A;  2Q8A A;  1LQQ A;  2J8L A;  5AQO A;  1ZVE A;  2F83 A;  4KYP A;  4APL A;  4R1A A;  3FZF A;  5AQZ A;  1NE5 A;  2D56 A;  1YUW A;  1P00 A;  1PE4 A;  1JZB A;  1SNB A;  2QWQ A;  2V7Z A;  1T0Z A;  1AYJ A;  3E7R L;  4FL9 A;  4CQK A;  5EXW A;  1SN1 A;  1BA0 A;  1JKZ A;  3I33 A;  1ZFU A;  2QW9 A;  4YIV A;  2LKB A;  1NGH A;  1NGB A;  2YIL A;  1L4V A;  4H5V A;  2YBR C;  3LDP A;  1VNA A;  2KYQ A;  2BRZ A;  3IUC A;  1UGL A;  1NGI A;  4H5R A;  4KBO A;  2MN5 A;  1ICA A;  2KGQ A;  5F2R A;  3LDN A;  2GL1 A;  2M8B B;  1DJT A;  3E7U X;  3KP0 A;  2QWN A;  3KVG A;  5FPE A;  2KBH A;  4AAZ A;  1I2V A;  1GPS A;  5AQY A;  5AQG A;  2YIO A;  2LY6 A;  5CP9 A;  1JXC A;  5BPM A;  2KJA A;  2QWO A;  3MKP A;  2NY9 X;  3R2V A;  1NGF A;  5FPD A;  5AQJ A;  5AQT A;  2KSK A;  2A7T A;  1DQ7 A;  5AQL A;  4HE7 A;  1BMR A;  1W8K A;  2N2R A;  3GL1 A;  2E8A A;  1POI A;  3GDQ A;  2KBK A;  1PX9 A;  1GMO A;  1DKG D;  3CW4 A;  3FZH A;  3L4I A;  5AQP A;  4UAE F;  5KK4 A;  5CSQ A;  2YIP A;  2N69 A;  5AQR A;  5EOK A;  3SF4 D;  1LQH A;  1I8N A;  1BRZ A;  5CS5 A;  2N66 A;  4FSV A;  1BCG A;  3D2F B;  3D2E A;  2ASC A;  1WMT A;  2LN8 A;  5FPN A;  5AQH A;  4APM A;  2JDQ D;  3QFP A;  3D2F A;  1KAZ A;  3C7N A;  1I2U A;  1N4N A;  5CS9 A;  2E2F A;  1NH5 A; 
#chains in the Genus database with same CATH homology
 3M3Z A;  5CT1 A;  3A8Y A;  3LDN A;  1S3X A;  4H5T A;  3C7N B;  3ATU A;  1GMN A;  4R1C A;  4R19 A;  1KAY A;  2QWR A;  2VY6 A;  5AQF A;  2LL3 A;  4UV6 A;  5AQX A;  2QWN A;  3KVG A;  1QQN A;  3AY9 A;  5BPN A;  5AQQ A;  3HMS A;  1ATR A;  1NGA A;  5FPE A;  5CS1 A;  3L6Q A;  5CT3 A;  1HKY A;  2GMO A;  1NGJ A;  2MBK A;  4YIZ A;  1NGG A;  5AQY A;  2K13 X;  2Y8R A;  5COE A;  5AQG A;  4Z0D A;  2Z8W A;  3BK3 C;  2YIO A;  1NGD A;  1HX1 A;  1HPM A;  3LDO A;  5BPL A;  2Q8A A;  5CP9 A;  5EOD A;  2J8L A;  5AQM A;  2LL4 M;  5AQO A;  3SP8 A;  5BPM A;  2QWM A;  3CQX A;  2F83 A;  2QWO A;  4HWI A;  5BN9 A;  3MKP A;  4APL A;  3R2V A;  4R1A A;  4Z0F A;  4H5W A;  1NGF A;  3FZF A;  5FPD A;  2X2Z A;  3FZM A;  5AQZ A;  5AQI A;  5AQJ A;  5AQT A;  4DUR A;  3LDQ A;  1Z40 A;  5I25 A;  2D56 A;  4R1B A;  3FE1 A;  1YUW A;  1HJO A;  5AQL A;  2BUP A;  1W8K A;  3GL1 A;  1YXE A;  2E8A A;  1POI A;  3ZWZ A;  3GDQ A;  5EY4 A;  3ATV A;  3HMT A;  2Q8B A;  5AQW A;  2KL5 A;  2QWQ A;  4A5T S;  2V7Z A;  5AR0 A;  2QXL A;  1GMO A;  2KHO A;  1DKG D;  3CW4 A;  3SRI A;  3FZH A;  2QJ2 A;  5AQV A;  3L4I A;  5AQS A;  5AQP A;  5FPM A;  4FL9 A;  2QWP A;  4IO8 A;  1BA1 A;  4UAE F;  5CSQ A;  5CT2 A;  2K35 A;  2YIP A;  1KAX A;  5F1X A;  5AQR A;  5EXW A;  1BA0 A;  3I33 A;  3QI7 A;  3ZLE A;  3HMR A;  1GP9 A;  5EOK A;  3KHW A;  5EVZ A;  1BHT A;  3SF4 D;  2QW9 A;  1W81 A;  5CS3 A;  2QWL A;  3L56 A;  1I8N A;  3FZL A;  3LDL A;  1QQM A;  5CS5 A;  4YIV A;  4FSV A;  3D2F B;  3SRJ A;  1NGH A;  5AQK A;  4Z09 A;  3D2E A;  3HN4 A;  1NGB A;  2LN8 A;  4H5N A;  5BN8 A;  2E88 A;  2YIL A;  2J8J A;  4UAF E;  3QFU A;  2Z8V A;  3JXU A;  5FPN A;  4H5V A;  5AQH A;  4APM A;  2JDQ D;  3HSC A;  1BUP A;  4IUA A;  3QML A;  3KC6 A;  3QFP A;  3LDP A;  3D2F A;  3FZK A;  2HGF A;  1QQO A;  1KAZ A;  3C7N A;  3IUC A;  1NGI A;  3D2E B;  1NK1 A;  1NGC A;  5EX5 A;  4Z0E A;  4H5R A;  4KBO A;  5AQN A;  5F0X A;  2E2F A;  2MN5 A;  5CS9 A;  1ATS A;  4UAO A;  2QJ4 A;  4GNI A;  5AQU A;  1NGE A;  4UAD E;  5F2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...