2YILA

Crystal structure of parasite sarcocystis muris lectin sml-2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
b'QLDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 36
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yilA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yilA01
2J8JA 1GMOA 4UV6A 3SRIA 2YIPA 4R1BA 1GP9A 2YILA 4IUAA 4Z0DA 5I25A 4Z09A 2HGFA 4A5TS 3MKPA 2Z8VA 4R1AA 4R19A 1NK1A 5CS1A 2QJ4A 4APMA 1HKYA 3HMTA 5EOKA 3HMSA 1I8NA 3HN4A 5CS5A 5EODA 1Z40A 2Q8BA 5CT1A 1GMNA 5CSQA 2J8LA 5COEA 3ZWZA 2LL3A 2F83A 2LL4M 5CT3A 4R1CA 3HMRA 1W8KA 4Z0FA 1W81A 1BHTA 5CP9A 3ZLEA 2Q8AA 2K13X 5CS9A 2X2ZA 4DURA 5CS3A 4APLA 3SP8A 5CT2A 2Z8WA 1YXEA 4UAOA 2QJ2A 2YIOA 3SRJA 2Y8RA 4Z0EA
chains in the Genus database with same CATH superfamily
3KC6A 2LJMA 4IUAA 2KBKA 1NGEA 1FH3A 3C7NA 3GKUA 5AQSA 1NGFA 2LL4M 1W8KA 3QFPA 5CP9A 2Q8AA 1N4NA 1ZU3A 4UADE 1LQHA 1ATRA 2BUPA 1AYJA 3HMSA 5CY0A 2BRZA 4HHFA 1KAXA 3R2VA 5KK4A 4H5NA 1BA0A 1WMTA 4CQKA 3E7UX 3E7RL 1P0AA 2MZ0A 4UAOA 2MN5A 1NH5A 1GMOA 3SRIA 2N2QA 1C56A 1NGBA 3KP1A 2LN8A 4H5RA 5FPMA 2QXLA 5EOKA 5CS5A 5CT1A 1GMNA 2M8BB 3LDPA 1ZUTA 5F1XA 5AQUA 1JXCA 1KV0A 4H5VA 2QJ2A 5EX5A 4GNIA 1GPSA 5AQWA 2QWPA 3HMTA 5EODA 3HN4A 3ZWZA 1AHOA 1TI5A 4AAZA 5CT2A 1YXEA 2LT8A 3FE1A 5AQMA 1YUWA 1I6GA 1I2UA 1K8BA 1BA1A 3D2EB 2G2KA 2NY8X 1SNBA 2YC1C 3FZKA 1Z40A 2KHOA 5AQFA 1BK8A 2LY5A 5AR0A 3QMLA 2J8JA 3LDNA 1JKZA 4Z09A 1T7EA 3MKPA 5AQVA 1OMYA 1VNAA 2KJAA 3L6QA 4FL9A 2GMOA 2LY6A 1C55A 3KHWA 1QQNA 1NPIA 5AQQA 1KAZA 4HE7A 3KOXA 4FSVA 2E2FA 2QWLA 1OZZA 1ZYVA 5F0XA 5AQZA 5EXWA 2E3FA 2B68A 5FPEA 1JZAA 1BRZA 1MR4A 1NE5A 5AQIA 2KSKA 1ATSA 4KYPA 1T7AA 1P00A 1BCGA 2LR3A 1BMRA 2GL1A 2QWMA 3FZMA 3A8YA 3AY9A 1DQ7A 5F2RA 2QJ4A 2Q8BA 2KYQA 2LJ7A 3CQXA 3FZLA 2F83A 5AQOA 1BHTA 2K13X 2QWOA 1HJOA 1T0ZA 5AQRA 1NGGA 1QQMA 1GP9A 1NGJA 4R19A 1NK1A 2I61A 2D56A 5AQGA 2KPYA 5COEA 4AB0A 3D2FA 2E88A 5AQTA 1L4VA 3KVGA 4Z0EA 4H5TA 1I6FA 3JXUA 1GPTA 1XRSB 1HPMA 2QWNA 5BN9A 2QW9A 4APMA 1HKYA 3SF4D 3C7NB 5FPDA 2J8LA 1ZFUA 5FPNA 3M3ZA 4DURA 2V7ZA 2Y8RA 3ATUA 2KBJA 1CHZA 2LKBA 2KBHA 3KOYA 2HGFA 1NGCA 2A7TA 1NGIA 4KBOA 3I33A 3KP0A 5CSQA 5BN8A 3FZFA 1W81A 3KOZA 2B3CA 2VY6A 5CS9A 5AQKA 1BUPA 1LQIA 1ICAA 1NGHA 3D2EA 2ATBA 3FZHA 1NRBA 3QFUA 4R1AA 1SN1A 2YEOA 2QWRA 3QI7A 2E3GA 1NGAA 1I2VA 4IO8A 5CT3A 1LQQA 4R1CA 4V1DC 1S3XA 4UAFE 1NRAA 2YIPA 1WT7A 3LDQA 2Z8VA 3LDLA 2JDQD 5CS1A 3IUCA 1I8NA 5BPLA 2N69A 1WWNA 3BK3C 2LI7A 4YIZA 3D2FB 1DKGD 3LDOA 4UAEF 2E8AA 1KAYA 4AEIA 1SN4A 2KL5A 5AQJA 1SEGA 2YILA 2N2RA 5BPMA 4A5TS 2K35A 1HX1A 3L56A 5EVZA 3GL1A 2QWQA 1PE4A 1T7BA 5AQNA 4UJ0A 4H5WA 4Z0FA 3ZLEA 1JZBA 2X2ZA 1DJTA 3SP8A 2Z8WA 3SRJA 4R1BA 1ZVGA 1UGLA 2NY9X 3L4IA 1VNBA 2YBRC 2LL3A 1NGDA 3GDQA 2KGQA 5BPNA 2E0HA 1B7DA 5CS3A 1ZYWA 1PTXA 2YIOA 5AQYA 3HSCA 4UV6A 2ASCA 5EY4A 4Z0DA 1POIA 5I25A 4HWIA 3PSMA 2SN3A 5AQLA 3ATVA 1CN2A 5AQPA 1ZVEA 3KOWA 2MBKA 1B3CA 1PX9A 1MYNA 1QQOA 3HMRA 5AQHA 4APLA 1T1TA 3CW4A 2N66A 4YIVA 5AQXA
chains in the Genus database with same CATH topology
5AQMA 1YUWA 2YIPA 3KC6A 1NGGA 5AQRA 1QQMA 1GP9A 4IUAA 1NGJA 1NGEA 1BA1A 3D2EB 3LDQA 2Z8VA 3LDLA 4R19A 1NK1A 2D56A 3C7NA 2JDQD 5CS1A 5AQGA 3IUCA 1I8NA 5BPLA 3FZKA 1Z40A 5AQSA 5COEA 1NGFA 3BK3C 2LL4M 3D2FA 2KHOA 5AQFA 1W8KA 4YIZA 3QFPA 2E88A 3D2FB 1DKGD 5AQXA 3LDOA 5AQTA 2Q8AA 5CP9A 4UADE 1ATRA 4UAEF 5AR0A 2BUPA 3KVGA 2E8AA 1KAYA 3HMSA 2KL5A 3QMLA 4Z0EA 2J8JA 3LDNA 4H5TA 5AQJA 3JXUA 2YILA 1HPMA 2QWNA 1KAXA 3R2VA 5BPMA 4Z09A 4A5TS 3MKPA 5AQVA 2K35A 1HX1A 2QW9A 5BN9A 3L56A 5EVZA 3GL1A 4H5NA 1BA0A 2QWQA 4APMA 1HKYA 3SF4D 3L6QA 3C7NB 5FPDA 5AQNA 2J8LA 5FPNA 4FL9A 3M3ZA 4H5WA 2GMOA 4Z0FA 3ZLEA 2X2ZA 4DURA 3SP8A 3KHWA 2V7ZA 2Z8WA 1QQNA 4UAOA 2MN5A 5AQQA 3SRJA 2Y8RA 3ATUA 1KAZA 1GMOA 3SRIA 4R1BA 4FSVA 2E2FA 2HGFA 2QWLA 1NGBA 1NGCA 2LN8A 4H5RA 5FPMA 5F0XA 1NGIA 4KBOA 5AQZA 2QXLA 3I33A 5EOKA 5CS5A 5EXWA 3L4IA 5CT1A 1GMNA 5CSQA 5BN8A 5FPEA 2LL3A 1NGDA 3LDPA 3FZFA 3GDQA 5F1XA 1W81A 5AQUA 5BPNA 5AQIA 2VY6A 5CS9A 5CS3A 5AQKA 1ATSA 1BUPA 4H5VA 2QJ2A 2YIOA 5AQYA 5EX5A 4GNIA 3HSCA 1NGHA 3D2EA 4UV6A 5AQWA 5EY4A 3FZHA 4Z0DA 1POIA 5I25A 2QWPA 4HWIA 3QFUA 5AQLA 2QWMA 3FZMA 4R1AA 3A8YA 3ATVA 3AY9A 5F2RA 2QJ4A 5AQPA 2QWRA 3QI7A 3HMTA 3HN4A 5EODA 2Q8BA 1NGAA 2MBKA 3ZWZA 3CQXA 3FZLA 2F83A 4IO8A 5AQOA 5CT3A 4R1CA 1QQOA 3HMRA 1BHTA 5AQHA 2K13X 2QWOA 1S3XA 4APLA 3CW4A 1HJOA 5CT2A 4UAFE 4YIVA 1YXEA 3FE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8J A;  1GMO A;  4UV6 A;  3SRI A;  2YIP A;  4R1B A;  1GP9 A;  2YIL A;  4IUA A;  4Z0D A;  5I25 A;  4Z09 A;  2HGF A;  4A5T S;  3MKP A;  2Z8V A;  4R1A A;  4R19 A;  1NK1 A;  5CS1 A;  2QJ4 A;  4APM A;  1HKY A;  3HMT A;  5EOK A;  3HMS A;  1I8N A;  3HN4 A;  5CS5 A;  5EOD A;  1Z40 A;  2Q8B A;  5CT1 A;  1GMN A;  5CSQ A;  2J8L A;  5COE A;  3ZWZ A;  2LL3 A;  2F83 A;  2LL4 M;  5CT3 A;  4R1C A;  3HMR A;  1W8K A;  4Z0F A;  1W81 A;  1BHT A;  5CP9 A;  3ZLE A;  2Q8A A;  2K13 X;  5CS9 A;  2X2Z A;  4DUR A;  5CS3 A;  4APL A;  3SP8 A;  5CT2 A;  2Z8W A;  1YXE A;  4UAO A;  2QJ2 A;  2YIO A;  3SRJ A;  2Y8R A;  4Z0E A; 
#chains in the Genus database with same CATH topology
 3KC6 A;  2LJM A;  4IUA A;  2KBK A;  1NGE A;  1FH3 A;  3C7N A;  3GKU A;  5AQS A;  1NGF A;  2LL4 M;  1W8K A;  3QFP A;  5CP9 A;  2Q8A A;  1N4N A;  1ZU3 A;  4UAD E;  1LQH A;  1ATR A;  2BUP A;  1AYJ A;  3HMS A;  5CY0 A;  2BRZ A;  4HHF A;  1KAX A;  3R2V A;  5KK4 A;  4H5N A;  1BA0 A;  1WMT A;  4CQK A;  3E7U X;  3E7R L;  1P0A A;  2MZ0 A;  4UAO A;  2MN5 A;  1NH5 A;  1GMO A;  3SRI A;  2N2Q A;  1C56 A;  1NGB A;  3KP1 A;  2LN8 A;  4H5R A;  5FPM A;  2QXL A;  5EOK A;  5CS5 A;  5CT1 A;  1GMN A;  2M8B B;  3LDP A;  1ZUT A;  5F1X A;  5AQU A;  1JXC A;  1KV0 A;  4H5V A;  2QJ2 A;  5EX5 A;  4GNI A;  1GPS A;  5AQW A;  2QWP A;  3HMT A;  5EOD A;  3HN4 A;  3ZWZ A;  1AHO A;  1TI5 A;  4AAZ A;  5CT2 A;  1YXE A;  2LT8 A;  3FE1 A;  5AQM A;  1YUW A;  1I6G A;  1I2U A;  1K8B A;  1BA1 A;  3D2E B;  2G2K A;  2NY8 X;  1SNB A;  2YC1 C;  3FZK A;  1Z40 A;  2KHO A;  5AQF A;  1BK8 A;  2LY5 A;  5AR0 A;  3QML A;  2J8J A;  3LDN A;  1JKZ A;  4Z09 A;  1T7E A;  3MKP A;  5AQV A;  1OMY A;  1VNA A;  2KJA A;  3L6Q A;  4FL9 A;  2GMO A;  2LY6 A;  1C55 A;  3KHW A;  1QQN A;  1NPI A;  5AQQ A;  1KAZ A;  4HE7 A;  3KOX A;  4FSV A;  2E2F A;  2QWL A;  1OZZ A;  1ZYV A;  5F0X A;  5AQZ A;  5EXW A;  2E3F A;  2B68 A;  5FPE A;  1JZA A;  1BRZ A;  1MR4 A;  1NE5 A;  5AQI A;  2KSK A;  1ATS A;  4KYP A;  1T7A A;  1P00 A;  1BCG A;  2LR3 A;  1BMR A;  2GL1 A;  2QWM A;  3FZM A;  3A8Y A;  3AY9 A;  1DQ7 A;  5F2R A;  2QJ4 A;  2Q8B A;  2KYQ A;  2LJ7 A;  3CQX A;  3FZL A;  2F83 A;  5AQO A;  1BHT A;  2K13 X;  2QWO A;  1HJO A;  1T0Z A;  5AQR A;  1NGG A;  1QQM A;  1GP9 A;  1NGJ A;  4R19 A;  1NK1 A;  2I61 A;  2D56 A;  5AQG A;  2KPY A;  5COE A;  4AB0 A;  3D2F A;  2E88 A;  5AQT A;  1L4V A;  3KVG A;  4Z0E A;  4H5T A;  1I6F A;  3JXU A;  1GPT A;  1XRS B;  1HPM A;  2QWN A;  5BN9 A;  2QW9 A;  4APM A;  1HKY A;  3SF4 D;  3C7N B;  5FPD A;  2J8L A;  1ZFU A;  5FPN A;  3M3Z A;  4DUR A;  2V7Z A;  2Y8R A;  3ATU A;  2KBJ A;  1CHZ A;  2LKB A;  2KBH A;  3KOY A;  2HGF A;  1NGC A;  2A7T A;  1NGI A;  4KBO A;  3I33 A;  3KP0 A;  5CSQ A;  5BN8 A;  3FZF A;  1W81 A;  3KOZ A;  2B3C A;  2VY6 A;  5CS9 A;  5AQK A;  1BUP A;  1LQI A;  1ICA A;  1NGH A;  3D2E A;  2ATB A;  3FZH A;  1NRB A;  3QFU A;  4R1A A;  1SN1 A;  2YEO A;  2QWR A;  3QI7 A;  2E3G A;  1NGA A;  1I2V A;  4IO8 A;  5CT3 A;  1LQQ A;  4R1C A;  4V1D C;  1S3X A;  4UAF E;  1NRA A;  2YIP A;  1WT7 A;  3LDQ A;  2Z8V A;  3LDL A;  2JDQ D;  5CS1 A;  3IUC A;  1I8N A;  5BPL A;  2N69 A;  1WWN A;  3BK3 C;  2LI7 A;  4YIZ A;  3D2F B;  1DKG D;  3LDO A;  4UAE F;  2E8A A;  1KAY A;  4AEI A;  1SN4 A;  2KL5 A;  5AQJ A;  1SEG A;  2YIL A;  2N2R A;  5BPM A;  4A5T S;  2K35 A;  1HX1 A;  3L56 A;  5EVZ A;  3GL1 A;  2QWQ A;  1PE4 A;  1T7B A;  5AQN A;  4UJ0 A;  4H5W A;  4Z0F A;  3ZLE A;  1JZB A;  2X2Z A;  1DJT A;  3SP8 A;  2Z8W A;  3SRJ A;  4R1B A;  1ZVG A;  1UGL A;  2NY9 X;  3L4I A;  1VNB A;  2YBR C;  2LL3 A;  1NGD A;  3GDQ A;  2KGQ A;  5BPN A;  2E0H A;  1B7D A;  5CS3 A;  1ZYW A;  1PTX A;  2YIO A;  5AQY A;  3HSC A;  4UV6 A;  2ASC A;  5EY4 A;  4Z0D A;  1POI A;  5I25 A;  4HWI A;  3PSM A;  2SN3 A;  5AQL A;  3ATV A;  1CN2 A;  5AQP A;  1ZVE A;  3KOW A;  2MBK A;  1B3C A;  1PX9 A;  1MYN A;  1QQO A;  3HMR A;  5AQH A;  4APL A;  1T1T A;  3CW4 A;  2N66 A;  4YIV A;  5AQX A; 
#chains in the Genus database with same CATH homology
 5AQM A;  1YUW A;  2YIP A;  3KC6 A;  1NGG A;  5AQR A;  1QQM A;  1GP9 A;  4IUA A;  1NGJ A;  1NGE A;  1BA1 A;  3D2E B;  3LDQ A;  2Z8V A;  3LDL A;  4R19 A;  1NK1 A;  2D56 A;  3C7N A;  2JDQ D;  5CS1 A;  5AQG A;  3IUC A;  1I8N A;  5BPL A;  3FZK A;  1Z40 A;  5AQS A;  5COE A;  1NGF A;  3BK3 C;  2LL4 M;  3D2F A;  2KHO A;  5AQF A;  1W8K A;  4YIZ A;  3QFP A;  2E88 A;  3D2F B;  1DKG D;  5AQX A;  3LDO A;  5AQT A;  2Q8A A;  5CP9 A;  4UAD E;  1ATR A;  4UAE F;  5AR0 A;  2BUP A;  3KVG A;  2E8A A;  1KAY A;  3HMS A;  2KL5 A;  3QML A;  4Z0E A;  2J8J A;  3LDN A;  4H5T A;  5AQJ A;  3JXU A;  2YIL A;  1HPM A;  2QWN A;  1KAX A;  3R2V A;  5BPM A;  4Z09 A;  4A5T S;  3MKP A;  5AQV A;  2K35 A;  1HX1 A;  2QW9 A;  5BN9 A;  3L56 A;  5EVZ A;  3GL1 A;  4H5N A;  1BA0 A;  2QWQ A;  4APM A;  1HKY A;  3SF4 D;  3L6Q A;  3C7N B;  5FPD A;  5AQN A;  2J8L A;  5FPN A;  4FL9 A;  3M3Z A;  4H5W A;  2GMO A;  4Z0F A;  3ZLE A;  2X2Z A;  4DUR A;  3SP8 A;  3KHW A;  2V7Z A;  2Z8W A;  1QQN A;  4UAO A;  2MN5 A;  5AQQ A;  3SRJ A;  2Y8R A;  3ATU A;  1KAZ A;  1GMO A;  3SRI A;  4R1B A;  4FSV A;  2E2F A;  2HGF A;  2QWL A;  1NGB A;  1NGC A;  2LN8 A;  4H5R A;  5FPM A;  5F0X A;  1NGI A;  4KBO A;  5AQZ A;  2QXL A;  3I33 A;  5EOK A;  5CS5 A;  5EXW A;  3L4I A;  5CT1 A;  1GMN A;  5CSQ A;  5BN8 A;  5FPE A;  2LL3 A;  1NGD A;  3LDP A;  3FZF A;  3GDQ A;  5F1X A;  1W81 A;  5AQU A;  5BPN A;  5AQI A;  2VY6 A;  5CS9 A;  5CS3 A;  5AQK A;  1ATS A;  1BUP A;  4H5V A;  2QJ2 A;  2YIO A;  5AQY A;  5EX5 A;  4GNI A;  3HSC A;  1NGH A;  3D2E A;  4UV6 A;  5AQW A;  5EY4 A;  3FZH A;  4Z0D A;  1POI A;  5I25 A;  2QWP A;  4HWI A;  3QFU A;  5AQL A;  2QWM A;  3FZM A;  4R1A A;  3A8Y A;  3ATV A;  3AY9 A;  5F2R A;  2QJ4 A;  5AQP A;  2QWR A;  3QI7 A;  3HMT A;  3HN4 A;  5EOD A;  2Q8B A;  1NGA A;  2MBK A;  3ZWZ A;  3CQX A;  3FZL A;  2F83 A;  4IO8 A;  5AQO A;  5CT3 A;  4R1C A;  1QQO A;  3HMR A;  1BHT A;  5AQH A;  2K13 X;  2QWO A;  1S3X A;  4APL A;  3CW4 A;  1HJO A;  5CT2 A;  4UAF E;  4YIV A;  1YXE A;  3FE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...