2YILA

Crystal structure of parasite sarcocystis muris lectin sml-2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
QLDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 36
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yilA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yilA01
2J8JA 5EOKA 2YIPA 2Y8RA 4A5TS 1I8NA 2Q8AA 3HMRA 5CT3A 5CT1A 5CS5A 3HN4A 1Z40A 2Z8WA 2Z8VA 1NK1A 5CP9A 5COEA 4Z0DA 3SRJA 5EODA 1GMNA 1BHTA 4IUAA 5CS1A 4DURA 1W81A 5CT2A 4Z0FA 1GMOA 2LL4M 4R1CA 4Z09A 5I25A 2QJ4A 1GP9A 3HMSA 1W8KA 4UV6A 4R19A 2QJ2A 2K13X 2YILA 3ZLEA 4Z0EA 2HGFA 3SP8A 3ZWZA 3MKPA 1HKYA 5CS9A 5CS3A 4APLA 2X2ZA 4UAOA 3HMTA 4APMA 2YIOA 2LL3A 4R1AA 2F83A 5CSQA 2Q8BA 2J8LA 4R1BA 1YXEA 3SRIA
chains in the Genus database with same CATH superfamily
1KAZA 3LDPA 1B3CA 1LQQA 1I8NA 1S3XA 2KBJA 2QWLA 2Q8AA 3FZFA 1JZAA 4Z0DA 1CHZA 1LQHA 3KP0A 2VY6A 2LJMA 4HE7A 1W8KA 1NRAA 2YEOA 4KYPA 1SN4A 5AQIA 1MYNA 1BK8A 5AQRA 3BK3C 1NGEA 5CP9A 3QI7A 3A8YA 3PSMA 3ATUA 4Z09A 1I6FA 2YC1C 2QW9A 1KV0A 3E7RL 1ZU3A 2Q8BA 3QFUA 5CT3A 1QQNA 2GMOA 4IO8A 1KAYA 2KL5A 2LT8A 4H5VA 2B3CA 2LL4M 3L6QA 4R1CA 5I25A 2K13X 1I2VA 2NY9X 5CS3A 1HPMA 2MBKA 1YUWA 4R1AA 4FL9A 5CSQA 2LY5A 1DJTA 3SRIA 1VNAA 5KK4A 2QWNA 1POIA 3KOZA 1Z40A 1NGGA 2N2QA 5CS1A 2KBKA 2BRZA 1GMOA 1T1TA 4FSVA 4APLA 4UAOA 1FH3A 4APMA 1BA1A 1NGDA 5BPNA 2QWQA 5EXWA 2J8JA 5F1XA 1HJOA 2LJ7A 1NE5A 1ZVEA 2KYQA 1WMTA 3SF4D 1ZYWA 1T7BA 5EODA 3FZKA 5FPEA 4KBOA 3M3ZA 5AQNA 5EY4A 3HMSA 2YILA 5AQHA 1NGFA 3FZHA 1NRBA 3HSCA 1C56A 1CN2A 1I2UA 3QFPA 3GDQA 2MZ0A 5AQYA 4HHFA 2GL1A 1GPSA 3FE1A 3KOWA 1LQIA 5AR0A 4YIZA 1NH5A 5AQOA 1NGJA 2M8BB 2LKBA 1N4NA 2NY8X 1QQOA 2F83A 3L4IA 1SNBA 2N66A 1NGCA 3L56A 1OZZA 3IUCA 1OMYA 2Z8WA 1K8BA 3D2EA 2K35A 4IUAA 2KJAA 3C7NA 5AQQA 2KHOA 2I61A 1WWNA 4Z0EA 5CS9A 2LL3A 1YXEA 5EOKA 1BA0A 4H5TA 4UAEF 1ATRA 3AY9A 1NK1A 5COEA 5AQLA 4AAZA 5AQWA 3GKUA 1P0AA 1I6GA 2HGFA 2X2ZA 3KHWA 5AQSA 1SN1A 1ZVGA 1NGHA 3LDNA 1QQMA 1TI5A 1NGAA 1BCGA 4DURA 3KOXA 4CQKA 2QJ4A 2SN3A 3JXUA 3LDQA 5FPNA 5AQFA 4UV6A 3D2EB 2YBRC 5CS5A 3C7NB 3ATVA 2Z8VA 1BMRA 3QMLA 1PTXA 2QWMA 1L4VA 2QJ2A 1T7AA 3HMTA 1ZYVA 1HX1A 4V1DC 4A5TS 2ASCA 2JDQD 4AB0A 2LY6A 1JZBA 5AQXA 1WT7A 1ATSA 5AQTA 4AEIA 2E88A 1UGLA 3LDLA 1T7EA 2J8LA 5F0XA 5AQVA 2YIPA 3KC6A 2E8AA 2KGQA 1AHOA 5F2RA 1C55A 2KBHA 1DKGD 1GMNA 2N2RA 2B68A 4H5NA 2QWOA 1NPIA 3GL1A 3ZLEA 3D2FA 3LDOA 3MKPA 5AQMA 2QWRA 2Y8RA 3E7UX 3KP1A 4UAFE 5EX5A 2E0HA 1BRZA 1JXCA 5BPMA 2E3FA 3KOYA 1MR4A 2QXLA 2V7ZA 5BN8A 1BUPA 1ZUTA 2LI7A 1SEGA 1T0ZA 2MN5A 3CQXA 1GPTA 5AQKA 5AQPA 5AQUA 4UADE 4H5RA 5CT1A 5AQJA 2E3GA 3R2VA 4HWIA 3HN4A 1ICAA 1NGBA 3FZLA 4Z0FA 1W81A 2LN8A 2ATBA 3FZMA 4R19A 2D56A 3ZWZA 2N69A 2LR3A 1JKZA 4GNIA 5AQGA 2KPYA 3D2FB 5CY0A 5FPMA 3I33A 1GP9A 2E2FA 5BPLA 4UJ0A 1PX9A 1HKYA 1VNBA 2BUPA 1DQ7A 1NGIA 5AQZA 1ZFUA 2G2KA 4H5WA 1PE4A 3HMRA 3KVGA 1AYJA 3SRJA 1BHTA 5CT2A 1XRSB 1KAXA 2A7TA 5EVZA 5FPDA 4YIVA 1B7DA 2KSKA 3SP8A 1P00A 3CW4A 2QWPA 2YIOA 5BN9A 4R1BA
chains in the Genus database with same CATH topology
2J8JA 3LDNA 5F1XA 1HJOA 1KAZA 1QQMA 3LDPA 2Y8RA 1I8NA 2Q8AA 1S3XA 2QWLA 4UAFE 3FZFA 5EX5A 5BN9A 3SF4D 4Z0DA 5BPMA 1NGAA 5EODA 3FZKA 4DURA 2V7ZA 2QXLA 5BN8A 2VY6A 5FPEA 4KBOA 3M3ZA 5AQNA 2QJ4A 5EY4A 3HMSA 1W8KA 3JXUA 2YILA 1BUPA 3LDQA 5AQHA 1NGFA 3FZHA 5FPNA 3HSCA 5AQIA 5AQFA 3CQXA 2MN5A 4UV6A 5AQKA 5AQPA 3D2EB 3QFPA 5AQUA 3GDQA 4UADE 4H5RA 5CT1A 5AQJA 3R2VA 5AQRA 5CS5A 4HWIA 3C7NB 3ATVA 3BK3C 5AQYA 1NGEA 2Z8VA 3HN4A 5CP9A 3QI7A 1NGBA 3A8YA 3FZLA 4Z0FA 3FE1A 3QMLA 1W81A 2LN8A 3ATUA 4Z09A 2QWMA 5AR0A 3FZMA 4R19A 2QW9A 2QJ2A 4YIZA 2D56A 5AQOA 3ZWZA 1NGJA 3HMTA 4R1BA 1QQOA 2F83A 3L4IA 1HX1A 2Q8BA 3QFUA 1NGCA 4A5TS 5CT3A 4GNIA 1QQNA 2GMOA 3L56A 4IO8A 2JDQD 3IUCA 5AQGA 2Z8WA 1KAYA 3D2EA 2K35A 2KL5A 4H5VA 5AQXA 3D2FB 4IUAA 1ATSA 2LL4M 5FPMA 3L6QA 3C7NA 3I33A 5AQTA 5AQQA 4R1CA 5I25A 1GP9A 2E2FA 2KHOA 5BPLA 2K13X 4Z0EA 1HKYA 5CS9A 5CS3A 1HPMA 2E88A 2MBKA 1YUWA 2BUPA 3LDLA 2LL3A 4R1AA 4FL9A 1NGIA 5AQZA 5CSQA 4H5WA 2J8LA 1YXEA 3SRIA 5EOKA 5F0XA 5AQVA 1BA0A 2YIPA 4H5TA 3HMRA 4UAEF 3KC6A 2E8AA 1ATRA 2QWNA 3AY9A 1POIA 5F2RA 1Z40A 3KVGA 1NK1A 5COEA 1NGGA 5AQLA 3SRJA 1DKGD 1GMNA 1BHTA 5CS1A 5AQWA 5CT2A 1KAXA 1GMOA 4H5NA 2QWOA 5EVZA 5FPDA 4YIVA 4FSVA 3GL1A 3ZLEA 3D2FA 3SP8A 2HGFA 3LDOA 3MKPA 3CW4A 2QWPA 4APLA 2X2ZA 4UAOA 3KHWA 5AQSA 4APMA 1NGHA 2YIOA 1BA1A 1NGDA 5BPNA 5AQMA 2QWQA 5EXWA 2QWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8J A;  5EOK A;  2YIP A;  2Y8R A;  4A5T S;  1I8N A;  2Q8A A;  3HMR A;  5CT3 A;  5CT1 A;  5CS5 A;  3HN4 A;  1Z40 A;  2Z8W A;  2Z8V A;  1NK1 A;  5CP9 A;  5COE A;  4Z0D A;  3SRJ A;  5EOD A;  1GMN A;  1BHT A;  4IUA A;  5CS1 A;  4DUR A;  1W81 A;  5CT2 A;  4Z0F A;  1GMO A;  2LL4 M;  4R1C A;  4Z09 A;  5I25 A;  2QJ4 A;  1GP9 A;  3HMS A;  1W8K A;  4UV6 A;  4R19 A;  2QJ2 A;  2K13 X;  2YIL A;  3ZLE A;  4Z0E A;  2HGF A;  3SP8 A;  3ZWZ A;  3MKP A;  1HKY A;  5CS9 A;  5CS3 A;  4APL A;  2X2Z A;  4UAO A;  3HMT A;  4APM A;  2YIO A;  2LL3 A;  4R1A A;  2F83 A;  5CSQ A;  2Q8B A;  2J8L A;  4R1B A;  1YXE A;  3SRI A; 
#chains in the Genus database with same CATH topology
 1KAZ A;  3LDP A;  1B3C A;  1LQQ A;  1I8N A;  1S3X A;  2KBJ A;  2QWL A;  2Q8A A;  3FZF A;  1JZA A;  4Z0D A;  1CHZ A;  1LQH A;  3KP0 A;  2VY6 A;  2LJM A;  4HE7 A;  1W8K A;  1NRA A;  2YEO A;  4KYP A;  1SN4 A;  5AQI A;  1MYN A;  1BK8 A;  5AQR A;  3BK3 C;  1NGE A;  5CP9 A;  3QI7 A;  3A8Y A;  3PSM A;  3ATU A;  4Z09 A;  1I6F A;  2YC1 C;  2QW9 A;  1KV0 A;  3E7R L;  1ZU3 A;  2Q8B A;  3QFU A;  5CT3 A;  1QQN A;  2GMO A;  4IO8 A;  1KAY A;  2KL5 A;  2LT8 A;  4H5V A;  2B3C A;  2LL4 M;  3L6Q A;  4R1C A;  5I25 A;  2K13 X;  1I2V A;  2NY9 X;  5CS3 A;  1HPM A;  2MBK A;  1YUW A;  4R1A A;  4FL9 A;  5CSQ A;  2LY5 A;  1DJT A;  3SRI A;  1VNA A;  5KK4 A;  2QWN A;  1POI A;  3KOZ A;  1Z40 A;  1NGG A;  2N2Q A;  5CS1 A;  2KBK A;  2BRZ A;  1GMO A;  1T1T A;  4FSV A;  4APL A;  4UAO A;  1FH3 A;  4APM A;  1BA1 A;  1NGD A;  5BPN A;  2QWQ A;  5EXW A;  2J8J A;  5F1X A;  1HJO A;  2LJ7 A;  1NE5 A;  1ZVE A;  2KYQ A;  1WMT A;  3SF4 D;  1ZYW A;  1T7B A;  5EOD A;  3FZK A;  5FPE A;  4KBO A;  3M3Z A;  5AQN A;  5EY4 A;  3HMS A;  2YIL A;  5AQH A;  1NGF A;  3FZH A;  1NRB A;  3HSC A;  1C56 A;  1CN2 A;  1I2U A;  3QFP A;  3GDQ A;  2MZ0 A;  5AQY A;  4HHF A;  2GL1 A;  1GPS A;  3FE1 A;  3KOW A;  1LQI A;  5AR0 A;  4YIZ A;  1NH5 A;  5AQO A;  1NGJ A;  2M8B B;  2LKB A;  1N4N A;  2NY8 X;  1QQO A;  2F83 A;  3L4I A;  1SNB A;  2N66 A;  1NGC A;  3L56 A;  1OZZ A;  3IUC A;  1OMY A;  2Z8W A;  1K8B A;  3D2E A;  2K35 A;  4IUA A;  2KJA A;  3C7N A;  5AQQ A;  2KHO A;  2I61 A;  1WWN A;  4Z0E A;  5CS9 A;  2LL3 A;  1YXE A;  5EOK A;  1BA0 A;  4H5T A;  4UAE F;  1ATR A;  3AY9 A;  1NK1 A;  5COE A;  5AQL A;  4AAZ A;  5AQW A;  3GKU A;  1P0A A;  1I6G A;  2HGF A;  2X2Z A;  3KHW A;  5AQS A;  1SN1 A;  1ZVG A;  1NGH A;  3LDN A;  1QQM A;  1TI5 A;  1NGA A;  1BCG A;  4DUR A;  3KOX A;  4CQK A;  2QJ4 A;  2SN3 A;  3JXU A;  3LDQ A;  5FPN A;  5AQF A;  4UV6 A;  3D2E B;  2YBR C;  5CS5 A;  3C7N B;  3ATV A;  2Z8V A;  1BMR A;  3QML A;  1PTX A;  2QWM A;  1L4V A;  2QJ2 A;  1T7A A;  3HMT A;  1ZYV A;  1HX1 A;  4V1D C;  4A5T S;  2ASC A;  2JDQ D;  4AB0 A;  2LY6 A;  1JZB A;  5AQX A;  1WT7 A;  1ATS A;  5AQT A;  4AEI A;  2E88 A;  1UGL A;  3LDL A;  1T7E A;  2J8L A;  5F0X A;  5AQV A;  2YIP A;  3KC6 A;  2E8A A;  2KGQ A;  1AHO A;  5F2R A;  1C55 A;  2KBH A;  1DKG D;  1GMN A;  2N2R A;  2B68 A;  4H5N A;  2QWO A;  1NPI A;  3GL1 A;  3ZLE A;  3D2F A;  3LDO A;  3MKP A;  5AQM A;  2QWR A;  2Y8R A;  3E7U X;  3KP1 A;  4UAF E;  5EX5 A;  2E0H A;  1BRZ A;  1JXC A;  5BPM A;  2E3F A;  3KOY A;  1MR4 A;  2QXL A;  2V7Z A;  5BN8 A;  1BUP A;  1ZUT A;  2LI7 A;  1SEG A;  1T0Z A;  2MN5 A;  3CQX A;  1GPT A;  5AQK A;  5AQP A;  5AQU A;  4UAD E;  4H5R A;  5CT1 A;  5AQJ A;  2E3G A;  3R2V A;  4HWI A;  3HN4 A;  1ICA A;  1NGB A;  3FZL A;  4Z0F A;  1W81 A;  2LN8 A;  2ATB A;  3FZM A;  4R19 A;  2D56 A;  3ZWZ A;  2N69 A;  2LR3 A;  1JKZ A;  4GNI A;  5AQG A;  2KPY A;  3D2F B;  5CY0 A;  5FPM A;  3I33 A;  1GP9 A;  2E2F A;  5BPL A;  4UJ0 A;  1PX9 A;  1HKY A;  1VNB A;  2BUP A;  1DQ7 A;  1NGI A;  5AQZ A;  1ZFU A;  2G2K A;  4H5W A;  1PE4 A;  3HMR A;  3KVG A;  1AYJ A;  3SRJ A;  1BHT A;  5CT2 A;  1XRS B;  1KAX A;  2A7T A;  5EVZ A;  5FPD A;  4YIV A;  1B7D A;  2KSK A;  3SP8 A;  1P00 A;  3CW4 A;  2QWP A;  2YIO A;  5BN9 A;  4R1B A; 
#chains in the Genus database with same CATH homology
 2J8J A;  3LDN A;  5F1X A;  1HJO A;  1KAZ A;  1QQM A;  3LDP A;  2Y8R A;  1I8N A;  2Q8A A;  1S3X A;  2QWL A;  4UAF E;  3FZF A;  5EX5 A;  5BN9 A;  3SF4 D;  4Z0D A;  5BPM A;  1NGA A;  5EOD A;  3FZK A;  4DUR A;  2V7Z A;  2QXL A;  5BN8 A;  2VY6 A;  5FPE A;  4KBO A;  3M3Z A;  5AQN A;  2QJ4 A;  5EY4 A;  3HMS A;  1W8K A;  3JXU A;  2YIL A;  1BUP A;  3LDQ A;  5AQH A;  1NGF A;  3FZH A;  5FPN A;  3HSC A;  5AQI A;  5AQF A;  3CQX A;  2MN5 A;  4UV6 A;  5AQK A;  5AQP A;  3D2E B;  3QFP A;  5AQU A;  3GDQ A;  4UAD E;  4H5R A;  5CT1 A;  5AQJ A;  3R2V A;  5AQR A;  5CS5 A;  4HWI A;  3C7N B;  3ATV A;  3BK3 C;  5AQY A;  1NGE A;  2Z8V A;  3HN4 A;  5CP9 A;  3QI7 A;  1NGB A;  3A8Y A;  3FZL A;  4Z0F A;  3FE1 A;  3QML A;  1W81 A;  2LN8 A;  3ATU A;  4Z09 A;  2QWM A;  5AR0 A;  3FZM A;  4R19 A;  2QW9 A;  2QJ2 A;  4YIZ A;  2D56 A;  5AQO A;  3ZWZ A;  1NGJ A;  3HMT A;  4R1B A;  1QQO A;  2F83 A;  3L4I A;  1HX1 A;  2Q8B A;  3QFU A;  1NGC A;  4A5T S;  5CT3 A;  4GNI A;  1QQN A;  2GMO A;  3L56 A;  4IO8 A;  2JDQ D;  3IUC A;  5AQG A;  2Z8W A;  1KAY A;  3D2E A;  2K35 A;  2KL5 A;  4H5V A;  5AQX A;  3D2F B;  4IUA A;  1ATS A;  2LL4 M;  5FPM A;  3L6Q A;  3C7N A;  3I33 A;  5AQT A;  5AQQ A;  4R1C A;  5I25 A;  1GP9 A;  2E2F A;  2KHO A;  5BPL A;  2K13 X;  4Z0E A;  1HKY A;  5CS9 A;  5CS3 A;  1HPM A;  2E88 A;  2MBK A;  1YUW A;  2BUP A;  3LDL A;  2LL3 A;  4R1A A;  4FL9 A;  1NGI A;  5AQZ A;  5CSQ A;  4H5W A;  2J8L A;  1YXE A;  3SRI A;  5EOK A;  5F0X A;  5AQV A;  1BA0 A;  2YIP A;  4H5T A;  3HMR A;  4UAE F;  3KC6 A;  2E8A A;  1ATR A;  2QWN A;  3AY9 A;  1POI A;  5F2R A;  1Z40 A;  3KVG A;  1NK1 A;  5COE A;  1NGG A;  5AQL A;  3SRJ A;  1DKG D;  1GMN A;  1BHT A;  5CS1 A;  5AQW A;  5CT2 A;  1KAX A;  1GMO A;  4H5N A;  2QWO A;  5EVZ A;  5FPD A;  4YIV A;  4FSV A;  3GL1 A;  3ZLE A;  3D2F A;  3SP8 A;  2HGF A;  3LDO A;  3MKP A;  3CW4 A;  2QWP A;  4APL A;  2X2Z A;  4UAO A;  3KHW A;  5AQS A;  4APM A;  1NGH A;  2YIO A;  1BA1 A;  1NGD A;  5BPN A;  5AQM A;  2QWQ A;  5EXW A;  2QWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...