4YIZA

Crystal structure of engineered tgama1 lacking the dii loop in complex with an eimeria tenella ron2d3 peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
399
structure length
392
Chain Sequence
SGNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNPSVTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Apical membrane antigen AMA1
publication title An Extended Surface Loop on Toxoplasma gondii Apical Membrane Antigen 1 (AMA1) Governs Ligand Binding Selectivity.
pubmed doi rcsb
source organism Toxoplasma gondii me49
molecule tags Immune system
total genus 102
structure length 392
sequence length 399
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 4yizA03
3.50.4.30 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4yizA01
2X2ZA 4YIZA 2Y8RA 3ZLDA 4YIVA 2Y8TA 2Y8SA 3ZLEA 4APLA
chains in the Genus database with same CATH superfamily
1E8BA 2ERJA 4ZH1D 5HYUB 3SRJA 1H2PP 1C1ZA 4Z0DA 4A5TS 3NFPI 1ELVA 4R1BA 2Y8RA 2CG7A 4LOSA 1RLHA 2BZMA 1SRZA 4B2SA 3ZRZA 4ONTD 1E5GA 2J8JA 4R1CA 1YXEA 4MUCA 1HFIA 1O9AA 1OJWA 3RJ3D 2K13X 5EODA 1HKYA 4APMA 2QJ4A 3SRIA 1TPNA 3T5OA 1TPGA 3KXVA 1G4GA 1TPMA 2YILA 5CS3A 3EJHA 1GPZA 1QUBA 3L89M 3FGTA 4A5WB 2XRDA 1OK9A 2Q8BA 1GHQB 1FBRA 5HYTB 5JPMG 5CP9A 2YIPA 4PO7A 2W81A 2JGXA 3OXUD 2LL4M 3GXEA 3M7PA 1GP9A 2YRAA 3FGRA 1HCCA 2CKUA 2I2LA 5EOKA 1Z92B 2XWBF 4C16A 1GMOA 4AYEA 1OJYA 1LY2A 3TVJA 4IGDA 2O39C 2UWNA 1MD7A 1UOTP 2J8LA 2Z8VA 4JHSA 1H04P 1OJVA 1SS2A 2XRBA 1NK1A 2JGWA 3IU3I 3NJAA 4AYIA 2W80A 2XWJI 4MSLA 3KZJA 2Y8SA 1I8NA 2YBYA 1Q3XA 1VVDA 4N7EA 2X2ZA 4APLA 3SW0X 2V8EA 3MQLA 1U5MA 2RL0A 2Z8WA 2KRIA 2EHFA 1E88A 2G7IA 4B2RA 3WSYA 2CG6A 5I0QB 5HYPA 3ZD2A 3MKPA 3SP8A 5FO8C 1G4FA 4Z09A 1H03P 1ZJKA 3ERBA 3OP8A 2QY0A 4DJZA 2LL3A 2MCZA 2HGFA 4R19A 1VVCA 4YNXA 2KMSA 5CS1A 1W81A 1GMNA 2XQWC 5CT3A 1QGBA 5COEA 5CT2A 5I25A 5HZPB 4Z0FA 4AYDA 2B5ID 2RKZA 4UAOA 3OEDC 1OK3A 1OK1A 4Z0EA 4YIVA 1QO6A 3HMTA 3WSXA 3K3TA 4KKDA 2Q8AA 3HN4A 3ZWZA 2EC3A 2IZ4A 4YIZA 1NWVA 3IX0A 5DN4A 1GKGA 1OK2A 3HMRA 4FXGG 1BHTA 1W8KA 2KL5A 2ZYCA 2IZ3A 2RLPA 2QJ2A 5CSQA 3CI0J 4J38B 4LOTA 3VWOA 2LOJA 2RKYA 4R1AA 1HFHA 1PPQA 1Z40A 2F83A 4WJG2 1MD8A 1GKNA 2Y8TA 3CALA 5CS5A 3ZLEA 3R62A 4DURA 4BWCA 2WIIC 3GOVA 2YIOA 3HMSA 2JRAA 4IUAA 3O8EB 4K12A 5CT1A 5DN5A 3ZD1A 1H2QP 5CS9A 2RLQA 3F6KA 4AYMA 3ZLDA 4UV6A 4PZ5A 4F4OC 1CKLA 4CSYA 2A55A 2MCYA 3INBC
chains in the Genus database with same CATH topology
3SRJA 4Z0DA 4A5TS 4R1BA 2Y8RA 2J8JA 4R1CA 1YXEA 2K13X 5EODA 1HKYA 4APMA 2QJ4A 3SRIA 2YILA 5CS3A 2Q8BA 3FGTA 5CP9A 2YIPA 4PO7A 2LL4M 1GP9A 3FGRA 2I2LA 5EOKA 1GMOA 2J8LA 2Z8VA 1NK1A 3NJAA 4MSLA 2Y8SA 1I8NA 4APLA 4N7EA 2X2ZA 2Z8WA 3WSYA 3MKPA 3SP8A 4Z09A 2LL3A 2HGFA 4R19A 5CS1A 1W81A 1GMNA 5CT3A 5COEA 5CT2A 5I25A 4Z0FA 4UAOA 4Z0EA 4YIVA 3HMTA 3WSXA 2Q8AA 3HN4A 3ZWZA 4YIZA 3HMRA 1BHTA 1W8KA 2KL5A 2QJ2A 5CSQA 4R1AA 1Z40A 2F83A 2Y8TA 4DURA 5CS5A 3ZLEA 4BWCA 2YIOA 3HMSA 4IUAA 5CT1A 5CS9A 3F6KA 3ZLDA 4UV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2Z A;  4YIZ A;  2Y8R A;  3ZLD A;  4YIV A;  2Y8T A;  2Y8S A;  3ZLE A;  4APL A; 
#chains in the Genus database with same CATH topology
 1E8B A;  2ERJ A;  4ZH1 D;  5HYU B;  3SRJ A;  1H2P P;  1C1Z A;  4Z0D A;  4A5T S;  3NFP I;  1ELV A;  4R1B A;  2Y8R A;  2CG7 A;  4LOS A;  1RLH A;  2BZM A;  1SRZ A;  4B2S A;  3ZRZ A;  4ONT D;  1E5G A;  2J8J A;  4R1C A;  1YXE A;  4MUC A;  1HFI A;  1O9A A;  1OJW A;  3RJ3 D;  2K13 X;  5EOD A;  1HKY A;  4APM A;  2QJ4 A;  3SRI A;  1TPN A;  3T5O A;  1TPG A;  3KXV A;  1G4G A;  1TPM A;  2YIL A;  5CS3 A;  3EJH A;  1GPZ A;  1QUB A;  3L89 M;  3FGT A;  4A5W B;  2XRD A;  1OK9 A;  2Q8B A;  1GHQ B;  1FBR A;  5HYT B;  5JPM G;  5CP9 A;  2YIP A;  4PO7 A;  2W81 A;  2JGX A;  3OXU D;  2LL4 M;  3GXE A;  3M7P A;  1GP9 A;  2YRA A;  3FGR A;  1HCC A;  2CKU A;  2I2L A;  5EOK A;  1Z92 B;  2XWB F;  4C16 A;  1GMO A;  4AYE A;  1OJY A;  1LY2 A;  3TVJ A;  4IGD A;  2O39 C;  2UWN A;  1MD7 A;  1UOT P;  2J8L A;  2Z8V A;  4JHS A;  1H04 P;  1OJV A;  1SS2 A;  2XRB A;  1NK1 A;  2JGW A;  3IU3 I;  3NJA A;  4AYI A;  2W80 A;  2XWJ I;  4MSL A;  3KZJ A;  2Y8S A;  1I8N A;  2YBY A;  1Q3X A;  1VVD A;  4N7E A;  2X2Z A;  4APL A;  3SW0 X;  2V8E A;  3MQL A;  1U5M A;  2RL0 A;  2Z8W A;  2KRI A;  2EHF A;  1E88 A;  2G7I A;  4B2R A;  3WSY A;  2CG6 A;  5I0Q B;  5HYP A;  3ZD2 A;  3MKP A;  3SP8 A;  5FO8 C;  1G4F A;  4Z09 A;  1H03 P;  1ZJK A;  3ERB A;  3OP8 A;  2QY0 A;  4DJZ A;  2LL3 A;  2MCZ A;  2HGF A;  4R19 A;  1VVC A;  4YNX A;  2KMS A;  5CS1 A;  1W81 A;  1GMN A;  2XQW C;  5CT3 A;  1QGB A;  5COE A;  5CT2 A;  5I25 A;  5HZP B;  4Z0F A;  4AYD A;  2B5I D;  2RKZ A;  4UAO A;  3OED C;  1OK3 A;  1OK1 A;  4Z0E A;  4YIV A;  1QO6 A;  3HMT A;  3WSX A;  3K3T A;  4KKD A;  2Q8A A;  3HN4 A;  3ZWZ A;  2EC3 A;  2IZ4 A;  4YIZ A;  1NWV A;  3IX0 A;  5DN4 A;  1GKG A;  1OK2 A;  3HMR A;  4FXG G;  1BHT A;  1W8K A;  2KL5 A;  2ZYC A;  2IZ3 A;  2RLP A;  2QJ2 A;  5CSQ A;  3CI0 J;  4J38 B;  4LOT A;  3VWO A;  2LOJ A;  2RKY A;  4R1A A;  1HFH A;  1PPQ A;  1Z40 A;  2F83 A;  4WJG 2;  1MD8 A;  1GKN A;  2Y8T A;  3CAL A;  5CS5 A;  3ZLE A;  3R62 A;  4DUR A;  4BWC A;  2WII C;  3GOV A;  2YIO A;  3HMS A;  2JRA A;  4IUA A;  3O8E B;  4K12 A;  5CT1 A;  5DN5 A;  3ZD1 A;  1H2Q P;  5CS9 A;  2RLQ A;  3F6K A;  4AYM A;  3ZLD A;  4UV6 A;  4PZ5 A;  4F4O C;  1CKL A;  4CSY A;  2A55 A;  2MCY A;  3INB C; 
#chains in the Genus database with same CATH homology
 3SRJ A;  4Z0D A;  4A5T S;  4R1B A;  2Y8R A;  2J8J A;  4R1C A;  1YXE A;  2K13 X;  5EOD A;  1HKY A;  4APM A;  2QJ4 A;  3SRI A;  2YIL A;  5CS3 A;  2Q8B A;  3FGT A;  5CP9 A;  2YIP A;  4PO7 A;  2LL4 M;  1GP9 A;  3FGR A;  2I2L A;  5EOK A;  1GMO A;  2J8L A;  2Z8V A;  1NK1 A;  3NJA A;  4MSL A;  2Y8S A;  1I8N A;  4APL A;  4N7E A;  2X2Z A;  2Z8W A;  3WSY A;  3MKP A;  3SP8 A;  4Z09 A;  2LL3 A;  2HGF A;  4R19 A;  5CS1 A;  1W81 A;  1GMN A;  5CT3 A;  5COE A;  5CT2 A;  5I25 A;  4Z0F A;  4UAO A;  4Z0E A;  4YIV A;  3HMT A;  3WSX A;  2Q8A A;  3HN4 A;  3ZWZ A;  4YIZ A;  3HMR A;  1BHT A;  1W8K A;  2KL5 A;  2QJ2 A;  5CSQ A;  4R1A A;  1Z40 A;  2F83 A;  2Y8T A;  4DUR A;  5CS5 A;  3ZLE A;  4BWC A;  2YIO A;  3HMS A;  4IUA A;  5CT1 A;  5CS9 A;  3F6K A;  3ZLD A;  4UV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...