4YIZA

Crystal structure of engineered tgama1 lacking the dii loop in complex with an eimeria tenella ron2d3 peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
399
structure length
392
Chain Sequence
SGNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNPSVTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Apical membrane antigen AMA1
publication title An Extended Surface Loop on Toxoplasma gondii Apical Membrane Antigen 1 (AMA1) Governs Ligand Binding Selectivity.
pubmed doi rcsb
source organism Toxoplasma gondii me49
molecule tags Immune system
total genus 102
structure length 392
sequence length 399
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 4yizA03
3.50.4.30 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4yizA01
2X2ZA 4YIVA 2Y8TA 3ZLEA 3ZLDA 2Y8SA 4YIZA 4APLA 2Y8RA
chains in the Genus database with same CATH superfamily
2JRAA 3FGRA 5I25A 3VWOA 4Z0DA 2QJ4A 3KXVA 4R1CA 2UWNA 4AYEA 2XWJI 1TPMA 2RKZA 5CS3A 3SP8A 2Z8VA 4LOTA 4CSYA 2Y8SA 4YIZA 2YILA 5CT1A 4AYDA 1VVDA 2JGXA 4YNXA 1MD7A 1VVCA 2EC3A 2LL4M 3FGTA 2V8EA 2JGWA 5CP9A 3GXEA 2EHFA 2BZMA 4MSLA 1BHTA 2I2LA 3F6KA 4A5TS 4Z0FA 1H04P 1W8KA 2Y8TA 2XWBF 1GMNA 1CKLA 1NWVA 1TPGA 4WJG2 3TVJA 1Z92B 4MUCA 5CS1A 2XRBA 2CG6A 2X2ZA 2YRAA 4R1BA 4R19A 1OJVA 1OK1A 3O8EB 4ONTD 5CT2A 3ERBA 5CSQA 1SRZA 1OK2A 4IGDA 3K3TA 1O9AA 3NJAA 1E88A 4KKDA 1G4FA 1RLHA 3ZD2A 1GKNA 4FXGG 4APMA 2LL3A 3EJHA 3ZLDA 1C1ZA 1U5MA 3HN4A 4AYMA 1TPNA 1ELVA 1G4GA 1Q3XA 3OP8A 4N7EA 3NFPI 3WSYA 5HYTB 1H03P 1HFHA 4B2SA 1I8NA 3WSXA 3OEDC 1E5GA 1H2QP 2J8LA 2IZ3A 3ZWZA 3MQLA 2MCYA 5CS9A 4ZH1D 1Z40A 1HFIA 1H2PP 5DN4A 2KRIA 1OK3A 1YXEA 1HKYA 2CKUA 4A5WB 2MCZA 2B5ID 3INBC 3M7PA 1GHQB 2RLQA 2W80A 4APLA 2HGFA 3T5OA 1GPZA 2O39C 3RJ3D 1E8BA 4K12A 5HYUB 1NK1A 2ZYCA 5CT3A 3SRJA 2LOJA 4R1AA 2IZ4A 1OJYA 3OXUD 2YIOA 2XQWC 3HMSA 1MD8A 1SS2A 1LY2A 2KMSA 4J38B 3SRIA 4F4OC 2Q8AA 2RL0A 1OJWA 3MKPA 3ZLEA 4UV6A 1HCCA 2W81A 3KZJA 3R62A 3L89M 2G7IA 3ZRZA 1QUBA 3SW0X 3HMTA 5EODA 2QY0A 1GP9A 2J8JA 4PO7A 5DN5A 1QGBA 2XRDA 1FBRA 1GMOA 2ERJA 1W81A 3HMRA 1QO6A 3IX0A 4B2RA 4DJZA 2K13X 2YBYA 2RKYA 3ZD1A 5HZPB 2KL5A 4UAOA 1GKGA 2Y8RA 4Z09A 4AYIA 1OK9A 2CG7A 2A55A 3CI0J 4JHSA 4BWCA 4YIVA 2F83A 4Z0EA 5COEA 4DURA 4LOSA 5EOKA 4IUAA 4C16A 2YIPA 1PPQA 1ZJKA 5CS5A 4PZ5A 2QJ2A 2Q8BA 1UOTP 2RLPA 5HYPA 3IU3I 5JPMG 5FO8C 2Z8WA 5I0QB 3CALA 2WIIC 3GOVA
chains in the Genus database with same CATH topology
3FGRA 5I25A 4Z0DA 2QJ4A 4R1CA 5CS3A 3SP8A 2Z8VA 2Y8SA 4YIZA 2YILA 5CT1A 2LL4M 3FGTA 5CP9A 4MSLA 1BHTA 2I2LA 3F6KA 4A5TS 4Z0FA 1W8KA 2Y8TA 1GMNA 5CS1A 2X2ZA 4R1BA 4R19A 5CT2A 5CSQA 3NJAA 4APMA 2LL3A 3ZLDA 3HN4A 4N7EA 3WSYA 1I8NA 3WSXA 2J8LA 3ZWZA 5CS9A 1Z40A 1YXEA 1HKYA 4APLA 2HGFA 5CT3A 1NK1A 3SRJA 4R1AA 2YIOA 3HMSA 3SRIA 2Q8AA 3MKPA 3ZLEA 4UV6A 3HMTA 5EODA 1GP9A 2J8JA 4PO7A 1GMOA 1W81A 3HMRA 2K13X 2KL5A 4UAOA 2Y8RA 4Z09A 4BWCA 4YIVA 2F83A 4Z0EA 5COEA 4DURA 5EOKA 4IUAA 2YIPA 5CS5A 2QJ2A 2Q8BA 2Z8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2Z A;  4YIV A;  2Y8T A;  3ZLE A;  3ZLD A;  2Y8S A;  4YIZ A;  4APL A;  2Y8R A; 
#chains in the Genus database with same CATH topology
 2JRA A;  3FGR A;  5I25 A;  3VWO A;  4Z0D A;  2QJ4 A;  3KXV A;  4R1C A;  2UWN A;  4AYE A;  2XWJ I;  1TPM A;  2RKZ A;  5CS3 A;  3SP8 A;  2Z8V A;  4LOT A;  4CSY A;  2Y8S A;  4YIZ A;  2YIL A;  5CT1 A;  4AYD A;  1VVD A;  2JGX A;  4YNX A;  1MD7 A;  1VVC A;  2EC3 A;  2LL4 M;  3FGT A;  2V8E A;  2JGW A;  5CP9 A;  3GXE A;  2EHF A;  2BZM A;  4MSL A;  1BHT A;  2I2L A;  3F6K A;  4A5T S;  4Z0F A;  1H04 P;  1W8K A;  2Y8T A;  2XWB F;  1GMN A;  1CKL A;  1NWV A;  1TPG A;  4WJG 2;  3TVJ A;  1Z92 B;  4MUC A;  5CS1 A;  2XRB A;  2CG6 A;  2X2Z A;  2YRA A;  4R1B A;  4R19 A;  1OJV A;  1OK1 A;  3O8E B;  4ONT D;  5CT2 A;  3ERB A;  5CSQ A;  1SRZ A;  1OK2 A;  4IGD A;  3K3T A;  1O9A A;  3NJA A;  1E88 A;  4KKD A;  1G4F A;  1RLH A;  3ZD2 A;  1GKN A;  4FXG G;  4APM A;  2LL3 A;  3EJH A;  3ZLD A;  1C1Z A;  1U5M A;  3HN4 A;  4AYM A;  1TPN A;  1ELV A;  1G4G A;  1Q3X A;  3OP8 A;  4N7E A;  3NFP I;  3WSY A;  5HYT B;  1H03 P;  1HFH A;  4B2S A;  1I8N A;  3WSX A;  3OED C;  1E5G A;  1H2Q P;  2J8L A;  2IZ3 A;  3ZWZ A;  3MQL A;  2MCY A;  5CS9 A;  4ZH1 D;  1Z40 A;  1HFI A;  1H2P P;  5DN4 A;  2KRI A;  1OK3 A;  1YXE A;  1HKY A;  2CKU A;  4A5W B;  2MCZ A;  2B5I D;  3INB C;  3M7P A;  1GHQ B;  2RLQ A;  2W80 A;  4APL A;  2HGF A;  3T5O A;  1GPZ A;  2O39 C;  3RJ3 D;  1E8B A;  4K12 A;  5HYU B;  1NK1 A;  2ZYC A;  5CT3 A;  3SRJ A;  2LOJ A;  4R1A A;  2IZ4 A;  1OJY A;  3OXU D;  2YIO A;  2XQW C;  3HMS A;  1MD8 A;  1SS2 A;  1LY2 A;  2KMS A;  4J38 B;  3SRI A;  4F4O C;  2Q8A A;  2RL0 A;  1OJW A;  3MKP A;  3ZLE A;  4UV6 A;  1HCC A;  2W81 A;  3KZJ A;  3R62 A;  3L89 M;  2G7I A;  3ZRZ A;  1QUB A;  3SW0 X;  3HMT A;  5EOD A;  2QY0 A;  1GP9 A;  2J8J A;  4PO7 A;  5DN5 A;  1QGB A;  2XRD A;  1FBR A;  1GMO A;  2ERJ A;  1W81 A;  3HMR A;  1QO6 A;  3IX0 A;  4B2R A;  4DJZ A;  2K13 X;  2YBY A;  2RKY A;  3ZD1 A;  5HZP B;  2KL5 A;  4UAO A;  1GKG A;  2Y8R A;  4Z09 A;  4AYI A;  1OK9 A;  2CG7 A;  2A55 A;  3CI0 J;  4JHS A;  4BWC A;  4YIV A;  2F83 A;  4Z0E A;  5COE A;  4DUR A;  4LOS A;  5EOK A;  4IUA A;  4C16 A;  2YIP A;  1PPQ A;  1ZJK A;  5CS5 A;  4PZ5 A;  2QJ2 A;  2Q8B A;  1UOT P;  2RLP A;  5HYP A;  3IU3 I;  5JPM G;  5FO8 C;  2Z8W A;  5I0Q B;  3CAL A;  2WII C;  3GOV A; 
#chains in the Genus database with same CATH homology
 3FGR A;  5I25 A;  4Z0D A;  2QJ4 A;  4R1C A;  5CS3 A;  3SP8 A;  2Z8V A;  2Y8S A;  4YIZ A;  2YIL A;  5CT1 A;  2LL4 M;  3FGT A;  5CP9 A;  4MSL A;  1BHT A;  2I2L A;  3F6K A;  4A5T S;  4Z0F A;  1W8K A;  2Y8T A;  1GMN A;  5CS1 A;  2X2Z A;  4R1B A;  4R19 A;  5CT2 A;  5CSQ A;  3NJA A;  4APM A;  2LL3 A;  3ZLD A;  3HN4 A;  4N7E A;  3WSY A;  1I8N A;  3WSX A;  2J8L A;  3ZWZ A;  5CS9 A;  1Z40 A;  1YXE A;  1HKY A;  4APL A;  2HGF A;  5CT3 A;  1NK1 A;  3SRJ A;  4R1A A;  2YIO A;  3HMS A;  3SRI A;  2Q8A A;  3MKP A;  3ZLE A;  4UV6 A;  3HMT A;  5EOD A;  1GP9 A;  2J8J A;  4PO7 A;  1GMO A;  1W81 A;  3HMR A;  2K13 X;  2KL5 A;  4UAO A;  2Y8R A;  4Z09 A;  4BWC A;  4YIV A;  2F83 A;  4Z0E A;  5COE A;  4DUR A;  5EOK A;  4IUA A;  2YIP A;  5CS5 A;  2QJ2 A;  2Q8B A;  2Z8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...