4APLA

Crystal structure of ama1 from neospora caninum
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
412
structure length
398
Chain Sequence
b'TPQNPFQTPELKAFLERYNVTLHHQSGVNVDLGQDKEVDGKLYREAAGLCPVWGKYIQLHQPNRPPYKNNFLEDIPTEAEYQKSGNPLPGGFNMNFVTPAGQRISPYPMELLEKSSKIKASTELGKCAEFAYKTTAMDKSNQATQYRYPFVYDSKRRLCYILSVSMQRMEGSKYCSTNDDPVNLTWYCFEPQKSPTANHNLIFGSAYVGKDPDAFLTKCPNQALKGYRFGHWTNGRCHDYTELADSWIEAVDSKAQCWVKTFTNDEVASDQPRTHSWNDWWPVHEKDQPHSGGDGRNYGFFYFDSNGKGKCALSHKAPDCLVSDSKAVSYTALGSLSEETPDIIIPSNDEALQCRSSEFPETFGSCDVQACKRQKTSCVGGQIQSTSVDCTAEEQNDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1
publication title Babesia Divergens and Neospora Caninum Apical Membrane Antigen 1 (Ama1) Structures Reveal Selectivity and Plasticity in Apicomplexan Parasite Host Cell Invasion.
pubmed doi rcsb
source organism Neospora caninum
molecule tags Membrane protein
total genus 104
structure length 398
sequence length 412
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2012-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 4aplA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4aplA01
2LL3A 5I25A 1I8NA 5CS9A 1W81A 4A5TS 2Q8AA 2QJ4A 5CT3A 4APMA 2LL4M 1Z40A 2K13X 2Q8BA 1BHTA 4R1AA 5CS3A 3SP8A 2X2ZA 2YILA 3SRJA 1GP9A 2J8JA 5CT1A 4UV6A 3ZLEA 2YIOA 2Y8RA 1GMOA 2F83A 2Z8WA 2Z8VA 5COEA 5CS1A 3ZWZA 4Z0FA 4APLA 1GMNA 1W8KA 2Y8SA 2HGFA 3SRIA 2YIPA 3MKPA 5CSQA 5EOKA 4YIZA 5CS5A 1NK1A 3HN4A 3HMSA 4R1BA 4IUAA 4UAOA 3HMRA 4Z09A 4DURA 4R19A 4R1CA 1HKYA 5EODA 4Z0EA 1YXEA 4Z0DA 3HMTA 3ZLDA 2QJ2A 2Y8TA 5CP9A 2J8LA 5CT2A
chains in the Genus database with same CATH superfamily
5I25A 1I8NA 1OK1A 1W81A 4A5WB 5HZPB 1TPMA 5DN4A 1E88A 2K13X 1BHTA 4R1AA 5CT1A 2XWBF 2I2LA 3ZRZA 3SP8A 3FGTA 3OXUD 1G4FA 2YIOA 1GMOA 3ERBA 4MUCA 3NFPI 5COEA 3ZWZA 5CS1A 4APLA 4DJZA 4MSLA 3SRIA 1H03P 4AYEA 1TPNA 2RKZA 2IZ4A 5CS5A 1C1ZA 5JPMG 3IU3I 2RLQA 4IUAA 2YBYA 3INBC 1GHQB 2W80A 4ZH1D 3SW0X 4Z09A 2G7IA 3WSYA 3FGRA 5EODA 4LOTA 2KMSA 2WIIC 1LY2A 4PZ5A 5HYUB 4A5TS 4AYDA 2QJ4A 2YRAA 1NWVA 1PPQA 4FXGG 1HFHA 1QO6A 2CG6A 5CS3A 4IGDA 3O8EB 2EC3A 3GXEA 1GP9A 2J8JA 2YILA 1TPGA 2BZMA 1QUBA 2Y8RA 1H2PP 3OEDC 1ZJKA 4N7EA 4ONTD 3GOVA 1ELVA 4Z0FA 1HFIA 2V8EA 4K12A 3ZD2A 1Z92B 2Y8SA 4KKDA 5DN5A 3VWOA 3WSXA 1GPZA 2MCZA 2ERJA 4C16A 3MKPA 5CSQA 2ZYCA 3CI0J 2RL0A 3HN4A 2XRDA 2RLPA 1E8BA 2CG7A 1OJWA 2MCYA 2CKUA 2XRBA 1H04P 2QJ2A 5CP9A 4J38B 1RLHA 2LL3A 4LOSA 2XWJI 3KZJA 5CS9A 4PO7A 4BWCA 1E5GA 2Q8AA 5CT3A 4APMA 1Z40A 3NJAA 2Q8BA 1U5MA 2X2ZA 4WJG2 1OK2A 3RJ3D 3ZLEA 2JGXA 1OJYA 4AYIA 2A55A 2Z8WA 1O9AA 1GMNA 1W8KA 1GKGA 2HGFA 4F4OC 2UWNA 2KRIA 1HCCA 2B5ID 4YIZA 3ZD1A 1NK1A 1OJVA 3HMSA 4R1BA 1MD8A 4B2SA 1G4GA 3HMRA 4R1CA 1OK9A 2O39C 3M7PA 2KL5A 2XQWC 1QGBA 3HMTA 3ZLDA 5I0QB 4YNXA 5CT2A 3TVJA 2W81A 3KXVA 1GKNA 2JRAA 3MQLA 2LL4M 2JGWA 3SRJA 4AYMA 1FBRA 5FO8C 4UV6A 3R62A 2QY0A 1SS2A 4CSYA 5HYTB 2RKYA 3K3TA 5HYPA 1H2QP 2F83A 3T5OA 2Z8VA 4B2RA 3L89M 2YIPA 1MD7A 3CALA 5EOKA 2EHFA 4YIVA 1Q3XA 1UOTP 4UAOA 1VVCA 1OK3A 2LOJA 3IX0A 1VVDA 4DURA 1SRZA 3EJHA 4R19A 3OP8A 1HKYA 1CKLA 4Z0EA 1YXEA 4Z0DA 2Y8TA 4JHSA 2J8LA 2IZ3A 3F6KA
chains in the Genus database with same CATH topology
5I25A 1I8NA 1W81A 2K13X 1BHTA 4R1AA 5CT1A 3SP8A 2I2LA 3FGTA 2YIOA 1GMOA 5COEA 3ZWZA 5CS1A 4APLA 4MSLA 3SRIA 5CS5A 4IUAA 4Z09A 3WSYA 3FGRA 5EODA 4A5TS 2QJ4A 5CS3A 2YILA 1GP9A 2J8JA 2Y8RA 4N7EA 4Z0FA 2Y8SA 3WSXA 3MKPA 5CSQA 3HN4A 2QJ2A 5CP9A 2LL3A 5CS9A 4PO7A 4BWCA 2Q8AA 5CT3A 4APMA 1Z40A 3NJAA 2Q8BA 2X2ZA 3ZLEA 2Z8WA 1GMNA 1W8KA 2HGFA 4YIZA 1NK1A 3HMSA 4R1BA 3HMRA 4R1CA 2KL5A 3HMTA 3ZLDA 5CT2A 2LL4M 3SRJA 4UV6A 2F83A 2Z8VA 2YIPA 5EOKA 4YIVA 4UAOA 4DURA 4R19A 1HKYA 4Z0EA 1YXEA 4Z0DA 2Y8TA 2J8LA 3F6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL3 A;  5I25 A;  1I8N A;  5CS9 A;  1W81 A;  4A5T S;  2Q8A A;  2QJ4 A;  5CT3 A;  4APM A;  2LL4 M;  1Z40 A;  2K13 X;  2Q8B A;  1BHT A;  4R1A A;  5CS3 A;  3SP8 A;  2X2Z A;  2YIL A;  3SRJ A;  1GP9 A;  2J8J A;  5CT1 A;  4UV6 A;  3ZLE A;  2YIO A;  2Y8R A;  1GMO A;  2F83 A;  2Z8W A;  2Z8V A;  5COE A;  5CS1 A;  3ZWZ A;  4Z0F A;  4APL A;  1GMN A;  1W8K A;  2Y8S A;  2HGF A;  3SRI A;  2YIP A;  3MKP A;  5CSQ A;  5EOK A;  4YIZ A;  5CS5 A;  1NK1 A;  3HN4 A;  3HMS A;  4R1B A;  4IUA A;  4UAO A;  3HMR A;  4Z09 A;  4DUR A;  4R19 A;  4R1C A;  1HKY A;  5EOD A;  4Z0E A;  1YXE A;  4Z0D A;  3HMT A;  3ZLD A;  2QJ2 A;  2Y8T A;  5CP9 A;  2J8L A;  5CT2 A; 
#chains in the Genus database with same CATH topology
 5I25 A;  1I8N A;  1OK1 A;  1W81 A;  4A5W B;  5HZP B;  1TPM A;  5DN4 A;  1E88 A;  2K13 X;  1BHT A;  4R1A A;  5CT1 A;  2XWB F;  2I2L A;  3ZRZ A;  3SP8 A;  3FGT A;  3OXU D;  1G4F A;  2YIO A;  1GMO A;  3ERB A;  4MUC A;  3NFP I;  5COE A;  3ZWZ A;  5CS1 A;  4APL A;  4DJZ A;  4MSL A;  3SRI A;  1H03 P;  4AYE A;  1TPN A;  2RKZ A;  2IZ4 A;  5CS5 A;  1C1Z A;  5JPM G;  3IU3 I;  2RLQ A;  4IUA A;  2YBY A;  3INB C;  1GHQ B;  2W80 A;  4ZH1 D;  3SW0 X;  4Z09 A;  2G7I A;  3WSY A;  3FGR A;  5EOD A;  4LOT A;  2KMS A;  2WII C;  1LY2 A;  4PZ5 A;  5HYU B;  4A5T S;  4AYD A;  2QJ4 A;  2YRA A;  1NWV A;  1PPQ A;  4FXG G;  1HFH A;  1QO6 A;  2CG6 A;  5CS3 A;  4IGD A;  3O8E B;  2EC3 A;  3GXE A;  1GP9 A;  2J8J A;  2YIL A;  1TPG A;  2BZM A;  1QUB A;  2Y8R A;  1H2P P;  3OED C;  1ZJK A;  4N7E A;  4ONT D;  3GOV A;  1ELV A;  4Z0F A;  1HFI A;  2V8E A;  4K12 A;  3ZD2 A;  1Z92 B;  2Y8S A;  4KKD A;  5DN5 A;  3VWO A;  3WSX A;  1GPZ A;  2MCZ A;  2ERJ A;  4C16 A;  3MKP A;  5CSQ A;  2ZYC A;  3CI0 J;  2RL0 A;  3HN4 A;  2XRD A;  2RLP A;  1E8B A;  2CG7 A;  1OJW A;  2MCY A;  2CKU A;  2XRB A;  1H04 P;  2QJ2 A;  5CP9 A;  4J38 B;  1RLH A;  2LL3 A;  4LOS A;  2XWJ I;  3KZJ A;  5CS9 A;  4PO7 A;  4BWC A;  1E5G A;  2Q8A A;  5CT3 A;  4APM A;  1Z40 A;  3NJA A;  2Q8B A;  1U5M A;  2X2Z A;  4WJG 2;  1OK2 A;  3RJ3 D;  3ZLE A;  2JGX A;  1OJY A;  4AYI A;  2A55 A;  2Z8W A;  1O9A A;  1GMN A;  1W8K A;  1GKG A;  2HGF A;  4F4O C;  2UWN A;  2KRI A;  1HCC A;  2B5I D;  4YIZ A;  3ZD1 A;  1NK1 A;  1OJV A;  3HMS A;  4R1B A;  1MD8 A;  4B2S A;  1G4G A;  3HMR A;  4R1C A;  1OK9 A;  2O39 C;  3M7P A;  2KL5 A;  2XQW C;  1QGB A;  3HMT A;  3ZLD A;  5I0Q B;  4YNX A;  5CT2 A;  3TVJ A;  2W81 A;  3KXV A;  1GKN A;  2JRA A;  3MQL A;  2LL4 M;  2JGW A;  3SRJ A;  4AYM A;  1FBR A;  5FO8 C;  4UV6 A;  3R62 A;  2QY0 A;  1SS2 A;  4CSY A;  5HYT B;  2RKY A;  3K3T A;  5HYP A;  1H2Q P;  2F83 A;  3T5O A;  2Z8V A;  4B2R A;  3L89 M;  2YIP A;  1MD7 A;  3CAL A;  5EOK A;  2EHF A;  4YIV A;  1Q3X A;  1UOT P;  4UAO A;  1VVC A;  1OK3 A;  2LOJ A;  3IX0 A;  1VVD A;  4DUR A;  1SRZ A;  3EJH A;  4R19 A;  3OP8 A;  1HKY A;  1CKL A;  4Z0E A;  1YXE A;  4Z0D A;  2Y8T A;  4JHS A;  2J8L A;  2IZ3 A;  3F6K A; 
#chains in the Genus database with same CATH homology
 5I25 A;  1I8N A;  1W81 A;  2K13 X;  1BHT A;  4R1A A;  5CT1 A;  3SP8 A;  2I2L A;  3FGT A;  2YIO A;  1GMO A;  5COE A;  3ZWZ A;  5CS1 A;  4APL A;  4MSL A;  3SRI A;  5CS5 A;  4IUA A;  4Z09 A;  3WSY A;  3FGR A;  5EOD A;  4A5T S;  2QJ4 A;  5CS3 A;  2YIL A;  1GP9 A;  2J8J A;  2Y8R A;  4N7E A;  4Z0F A;  2Y8S A;  3WSX A;  3MKP A;  5CSQ A;  3HN4 A;  2QJ2 A;  5CP9 A;  2LL3 A;  5CS9 A;  4PO7 A;  4BWC A;  2Q8A A;  5CT3 A;  4APM A;  1Z40 A;  3NJA A;  2Q8B A;  2X2Z A;  3ZLE A;  2Z8W A;  1GMN A;  1W8K A;  2HGF A;  4YIZ A;  1NK1 A;  3HMS A;  4R1B A;  3HMR A;  4R1C A;  2KL5 A;  3HMT A;  3ZLD A;  5CT2 A;  2LL4 M;  3SRJ A;  4UV6 A;  2F83 A;  2Z8V A;  2YIP A;  5EOK A;  4YIV A;  4UAO A;  4DUR A;  4R19 A;  1HKY A;  4Z0E A;  1YXE A;  4Z0D A;  2Y8T A;  2J8L A;  3F6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...