4APLA

Crystal structure of ama1 from neospora caninum
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
412
structure length
398
Chain Sequence
TPQNPFQTPELKAFLERYNVTLHHQSGVNVDLGQDKEVDGKLYREAAGLCPVWGKYIQLHQPNRPPYKNNFLEDIPTEAEYQKSGNPLPGGFNMNFVTPAGQRISPYPMELLEKSSKIKASTELGKCAEFAYKTTAMDKSNQATQYRYPFVYDSKRRLCYILSVSMQRMEGSKYCSTNDDPVNLTWYCFEPQKSPTANHNLIFGSAYVGKDPDAFLTKCPNQALKGYRFGHWTNGRCHDYTELADSWIEAVDSKAQCWVKTFTNDEVASDQPRTHSWNDWWPVHEKDQPHSGGDGRNYGFFYFDSNGKGKCALSHKAPDCLVSDSKAVSYTALGSLSEETPDIIIPSNDEALQCRSSEFPETFGSCDVQACKRQKTSCVGGQIQSTSVDCTAEEQNDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1
publication title Babesia Divergens and Neospora Caninum Apical Membrane Antigen 1 (Ama1) Structures Reveal Selectivity and Plasticity in Apicomplexan Parasite Host Cell Invasion.
pubmed doi rcsb
source organism Neospora caninum
molecule tags Membrane protein
total genus 104
structure length 398
sequence length 412
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2012-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 4aplA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4aplA01
2YIOA 2YILA 1HKYA 1YXEA 4R1BA 5EOKA 5CT2A 4UV6A 2Y8TA 4R1AA 2LL4M 2YIPA 2QJ4A 4UAOA 1I8NA 3ZWZA 3ZLEA 1W8KA 1W81A 1BHTA 3ZLDA 2Z8WA 4APMA 4DURA 2LL3A 2Q8BA 4Z0DA 2QJ2A 3HMSA 4Z09A 2K13X 2Q8AA 4APLA 2X2ZA 3HMRA 1GP9A 4Z0EA 5CT1A 5I25A 4Z0FA 5EODA 5COEA 1GMNA 5CP9A 5CS1A 3HN4A 2Y8SA 2HGFA 4R1CA 2J8JA 2J8LA 2Y8RA 5CS3A 1Z40A 3SRIA 5CSQA 3MKPA 4R19A 3SRJA 4A5TS 3SP8A 5CT3A 2F83A 2Z8VA 3HMTA 5CS5A 4IUAA 1GMOA 1NK1A 5CS9A 4YIZA
chains in the Genus database with same CATH superfamily
4AYMA 1VVCA 4FXGG 1NWVA 1OK1A 3VWOA 1QUBA 4R1AA 4UAOA 3FGRA 4AYIA 3ZLEA 3NJAA 3ZD1A 1W8KA 1BHTA 3ZLDA 2KL5A 2Q8BA 2QY0A 3RJ3D 4Z09A 2X2ZA 2JGWA 2JRAA 2XRDA 2ZYCA 1O9AA 5COEA 1TPMA 5CS1A 1QO6A 3INBC 4R1CA 1OK3A 1OJYA 2Y8RA 3CALA 1HFHA 5FO8C 1SRZA 5CSQA 1SS2A 4PO7A 3SRJA 2V8EA 2LOJA 3GXEA 1E88A 1MD8A 2JGXA 2WIIC 3KZJA 1H04P 5CS9A 2YIOA 1CKLA 1YXEA 1UOTP 3F6KA 4JHSA 4F4OC 2YIPA 2QJ4A 1I8NA 2BZMA 1GKNA 1LY2A 4YIVA 5HYPA 5DN4A 3KXVA 2XRBA 2KRIA 5HYUB 4Z0DA 2QJ2A 2K13X 2UWNA 3O8EB 4Z0FA 1TPNA 1Z92B 1H2PP 1QGBA 2XWJI 5HYTB 1E8BA 1HFIA 5CS3A 5HZPB 3TVJA 1Z40A 1VVDA 3SW0X 5DN5A 2O39C 4A5TS 3SP8A 5CT3A 2B5ID 2Z8VA 1E5GA 1GMOA 2W80A 1H2QP 2YILA 2CG7A 4PZ5A 5EOKA 1C1ZA 4ONTD 5CT2A 3ZWZA 4ZH1D 2YBYA 1W81A 3MQLA 4DURA 3OP8A 2LL3A 4KKDA 2YRAA 2A55A 2IZ3A 2RKZA 5I0QB 1OJWA 2I2LA 3M7PA 3R62A 2Q8AA 4Z0EA 5I25A 3WSYA 4R1BA 1HCCA 4DJZA 4K12A 3HN4A 2Y8SA 1ZJKA 4MUCA 1GHQB 2RLQA 4WJG2 2IZ4A 1PPQA 3ZRZA 1MD7A 1OK9A 4B2SA 4J38B 2RL0A 2EHFA 1RLHA 3SRIA 3IU3I 2CG6A 3MKPA 3OXUD 3CI0J 4AYEA 1G4GA 2F83A 1GPZA 5CS5A 4IUAA 2EC3A 3K3TA 3NFPI 2KMSA 3L89M 4N7EA 4YIZA 4CSYA 2XQWC 2HGFA 4R19A 1HKYA 2MCZA 2W81A 3IX0A 1Q3XA 4YNXA 1OK2A 4C16A 4BWCA 1OJVA 1TPGA 2MCYA 2Y8TA 2RLPA 3GOVA 4A5WB 2LL4M 4UV6A 4LOTA 4AYDA 3WSXA 2Z8WA 1FBRA 4LOSA 3T5OA 4APMA 1H03P 3ERBA 2ERJA 4B2RA 3HMSA 1GKGA 4APLA 3HMRA 5CT1A 3ZD2A 1GP9A 5EODA 2XWBF 1GMNA 5CP9A 1ELVA 2CKUA 2J8JA 3EJHA 5JPMG 2J8LA 1U5MA 2RKYA 2G7IA 3OEDC 1G4FA 3FGTA 4IGDA 3HMTA 1NK1A 4MSLA
chains in the Genus database with same CATH topology
4R1AA 4UAOA 3FGRA 3ZLEA 3NJAA 1W8KA 1BHTA 3ZLDA 2KL5A 2Q8BA 4Z09A 2X2ZA 5COEA 5CS1A 4R1CA 2Y8RA 5CSQA 4PO7A 3SRJA 5CS9A 2YIOA 1YXEA 3F6KA 2YIPA 2QJ4A 1I8NA 4YIVA 4Z0DA 2QJ2A 2K13X 4Z0FA 5CS3A 1Z40A 4A5TS 3SP8A 5CT3A 2Z8VA 1GMOA 2YILA 5EOKA 5CT2A 3ZWZA 1W81A 4DURA 2LL3A 2Q8AA 2I2LA 4Z0EA 5I25A 3WSYA 3HN4A 2Y8SA 3SRIA 3MKPA 2F83A 5CS5A 4IUAA 4N7EA 2HGFA 4R19A 4YIZA 1HKYA 4R1BA 4BWCA 2Y8TA 4UV6A 2LL4M 3WSXA 2Z8WA 4APMA 3HMSA 3HMRA 4APLA 5CT1A 1GP9A 5EODA 1GMNA 5CP9A 2J8JA 2J8LA 3FGTA 3HMTA 1NK1A 4MSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIO A;  2YIL A;  1HKY A;  1YXE A;  4R1B A;  5EOK A;  5CT2 A;  4UV6 A;  2Y8T A;  4R1A A;  2LL4 M;  2YIP A;  2QJ4 A;  4UAO A;  1I8N A;  3ZWZ A;  3ZLE A;  1W8K A;  1W81 A;  1BHT A;  3ZLD A;  2Z8W A;  4APM A;  4DUR A;  2LL3 A;  2Q8B A;  4Z0D A;  2QJ2 A;  3HMS A;  4Z09 A;  2K13 X;  2Q8A A;  4APL A;  2X2Z A;  3HMR A;  1GP9 A;  4Z0E A;  5CT1 A;  5I25 A;  4Z0F A;  5EOD A;  5COE A;  1GMN A;  5CP9 A;  5CS1 A;  3HN4 A;  2Y8S A;  2HGF A;  4R1C A;  2J8J A;  2J8L A;  2Y8R A;  5CS3 A;  1Z40 A;  3SRI A;  5CSQ A;  3MKP A;  4R19 A;  3SRJ A;  4A5T S;  3SP8 A;  5CT3 A;  2F83 A;  2Z8V A;  3HMT A;  5CS5 A;  4IUA A;  1GMO A;  1NK1 A;  5CS9 A;  4YIZ A; 
#chains in the Genus database with same CATH topology
 4AYM A;  1VVC A;  4FXG G;  1NWV A;  1OK1 A;  3VWO A;  1QUB A;  4R1A A;  4UAO A;  3FGR A;  4AYI A;  3ZLE A;  3NJA A;  3ZD1 A;  1W8K A;  1BHT A;  3ZLD A;  2KL5 A;  2Q8B A;  2QY0 A;  3RJ3 D;  4Z09 A;  2X2Z A;  2JGW A;  2JRA A;  2XRD A;  2ZYC A;  1O9A A;  5COE A;  1TPM A;  5CS1 A;  1QO6 A;  3INB C;  4R1C A;  1OK3 A;  1OJY A;  2Y8R A;  3CAL A;  1HFH A;  5FO8 C;  1SRZ A;  5CSQ A;  1SS2 A;  4PO7 A;  3SRJ A;  2V8E A;  2LOJ A;  3GXE A;  1E88 A;  1MD8 A;  2JGX A;  2WII C;  3KZJ A;  1H04 P;  5CS9 A;  2YIO A;  1CKL A;  1YXE A;  1UOT P;  3F6K A;  4JHS A;  4F4O C;  2YIP A;  2QJ4 A;  1I8N A;  2BZM A;  1GKN A;  1LY2 A;  4YIV A;  5HYP A;  5DN4 A;  3KXV A;  2XRB A;  2KRI A;  5HYU B;  4Z0D A;  2QJ2 A;  2K13 X;  2UWN A;  3O8E B;  4Z0F A;  1TPN A;  1Z92 B;  1H2P P;  1QGB A;  2XWJ I;  5HYT B;  1E8B A;  1HFI A;  5CS3 A;  5HZP B;  3TVJ A;  1Z40 A;  1VVD A;  3SW0 X;  5DN5 A;  2O39 C;  4A5T S;  3SP8 A;  5CT3 A;  2B5I D;  2Z8V A;  1E5G A;  1GMO A;  2W80 A;  1H2Q P;  2YIL A;  2CG7 A;  4PZ5 A;  5EOK A;  1C1Z A;  4ONT D;  5CT2 A;  3ZWZ A;  4ZH1 D;  2YBY A;  1W81 A;  3MQL A;  4DUR A;  3OP8 A;  2LL3 A;  4KKD A;  2YRA A;  2A55 A;  2IZ3 A;  2RKZ A;  5I0Q B;  1OJW A;  2I2L A;  3M7P A;  3R62 A;  2Q8A A;  4Z0E A;  5I25 A;  3WSY A;  4R1B A;  1HCC A;  4DJZ A;  4K12 A;  3HN4 A;  2Y8S A;  1ZJK A;  4MUC A;  1GHQ B;  2RLQ A;  4WJG 2;  2IZ4 A;  1PPQ A;  3ZRZ A;  1MD7 A;  1OK9 A;  4B2S A;  4J38 B;  2RL0 A;  2EHF A;  1RLH A;  3SRI A;  3IU3 I;  2CG6 A;  3MKP A;  3OXU D;  3CI0 J;  4AYE A;  1G4G A;  2F83 A;  1GPZ A;  5CS5 A;  4IUA A;  2EC3 A;  3K3T A;  3NFP I;  2KMS A;  3L89 M;  4N7E A;  4YIZ A;  4CSY A;  2XQW C;  2HGF A;  4R19 A;  1HKY A;  2MCZ A;  2W81 A;  3IX0 A;  1Q3X A;  4YNX A;  1OK2 A;  4C16 A;  4BWC A;  1OJV A;  1TPG A;  2MCY A;  2Y8T A;  2RLP A;  3GOV A;  4A5W B;  2LL4 M;  4UV6 A;  4LOT A;  4AYD A;  3WSX A;  2Z8W A;  1FBR A;  4LOS A;  3T5O A;  4APM A;  1H03 P;  3ERB A;  2ERJ A;  4B2R A;  3HMS A;  1GKG A;  4APL A;  3HMR A;  5CT1 A;  3ZD2 A;  1GP9 A;  5EOD A;  2XWB F;  1GMN A;  5CP9 A;  1ELV A;  2CKU A;  2J8J A;  3EJH A;  5JPM G;  2J8L A;  1U5M A;  2RKY A;  2G7I A;  3OED C;  1G4F A;  3FGT A;  4IGD A;  3HMT A;  1NK1 A;  4MSL A; 
#chains in the Genus database with same CATH homology
 4R1A A;  4UAO A;  3FGR A;  3ZLE A;  3NJA A;  1W8K A;  1BHT A;  3ZLD A;  2KL5 A;  2Q8B A;  4Z09 A;  2X2Z A;  5COE A;  5CS1 A;  4R1C A;  2Y8R A;  5CSQ A;  4PO7 A;  3SRJ A;  5CS9 A;  2YIO A;  1YXE A;  3F6K A;  2YIP A;  2QJ4 A;  1I8N A;  4YIV A;  4Z0D A;  2QJ2 A;  2K13 X;  4Z0F A;  5CS3 A;  1Z40 A;  4A5T S;  3SP8 A;  5CT3 A;  2Z8V A;  1GMO A;  2YIL A;  5EOK A;  5CT2 A;  3ZWZ A;  1W81 A;  4DUR A;  2LL3 A;  2Q8A A;  2I2L A;  4Z0E A;  5I25 A;  3WSY A;  3HN4 A;  2Y8S A;  3SRI A;  3MKP A;  2F83 A;  5CS5 A;  4IUA A;  4N7E A;  2HGF A;  4R19 A;  4YIZ A;  1HKY A;  4R1B A;  4BWC A;  2Y8T A;  4UV6 A;  2LL4 M;  3WSX A;  2Z8W A;  4APM A;  3HMS A;  3HMR A;  4APL A;  5CT1 A;  1GP9 A;  5EOD A;  1GMN A;  5CP9 A;  2J8J A;  2J8L A;  3FGT A;  3HMT A;  1NK1 A;  4MSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...