2Y8RA

Crystal structure of apo ama1 mutant (tyr230ala) from toxoplasma gondii
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
412
structure length
399
Chain Sequence
SGNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVKATKYRYPFVYDSKKRLCHILAVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPLTSQASWNDWWPLHQSDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN, PUTATIVE
publication title Host Cell Invasion by Apicomplexan Parasites: Insights from the Co-Structure of Ama1 with a Ron2 Peptide
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 91
structure length 399
sequence length 412
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2y8rA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2y8rA01
5EODA 4R1AA 3SRJA 5CS9A 4R1CA 1BHTA 4Z0EA 4A5TS 2QJ4A 1HKYA 3HMSA 2X2ZA 4DURA 2Q8BA 5EOKA 3ZWZA 5CT1A 4UV6A 3ZLDA 2LL4M 2Z8WA 4Z09A 5CS3A 4YIZA 3SRIA 5I25A 5CP9A 3MKPA 2Z8VA 1Z40A 3HMRA 5CS1A 4Z0DA 2Y8RA 2YILA 4R19A 2HGFA 1I8NA 1W8KA 2J8JA 1GMOA 2Y8SA 2Y8TA 1YXEA 4IUAA 3SP8A 2YIPA 2LL3A 1GMNA 5CS5A 1W81A 2K13X 5CT2A 5CSQA 4APMA 1GP9A 2J8LA 3HMTA 4Z0FA 2F83A 4R1BA 5CT3A 2QJ2A 2Q8AA 3HN4A 1NK1A 3ZLEA 4UAOA 4APLA 5COEA 2YIOA
chains in the Genus database with same CATH superfamily
1VVCA 4A5WB 2BZMA 1OK3A 1C1ZA 1G4GA 1HFIA 3FGRA 4LOTA 4R1AA 2ERJA 5I0QB 5CS9A 2B5ID 3RJ3D 1OK2A 3HMSA 1MD8A 5DN4A 4Z09A 3MKPA 3CI0J 4K12A 2UWNA 2Y8RA 1E8BA 2Y8SA 4AYMA 5FO8C 3ZRZA 4DJZA 3CALA 1HCCA 1QGBA 4MUCA 5CS5A 3K3TA 4KKDA 5CT2A 5CSQA 1NWVA 1TPGA 1GP9A 1TPMA 2WIIC 3ZD2A 1G4FA 3OEDC 2QJ2A 2XWBF 3ERBA 3ZLEA 3OP8A 1NK1A 5COEA 2YBYA 2EHFA 1GHQB 4JHSA 3IU3I 2YRAA 2W81A 3GOVA 4MSLA 4AYDA 4CSYA 2KL5A 5EODA 3NJAA 5JPMG 3SW0X 1UOTP 4FXGG 4A5TS 2Q8BA 3ZWZA 1H04P 2EC3A 3ZLDA 3FGTA 2LL4M 4YIZA 2CG6A 3M7PA 2XRDA 4Z0DA 1Z40A 5CS1A 2MCYA 2W80A 1TPNA 3TVJA 2XWJI 1I8NA 1W8KA 1VVDA 1OJYA 1Z92B 4IUAA 3INBC 3OXUD 2YIPA 1GMNA 4LOSA 1W81A 1ELVA 3GXEA 4F4OC 4APMA 4Z0FA 4R1BA 5DN5A 1GKNA 3L89M 2RKZA 1SS2A 3VWOA 2Q8AA 3KZJA 2O39C 2JRAA 1QUBA 4B2RA 1GPZA 3WSYA 2RLQA 4R1CA 1LY2A 1Q3XA 1HKYA 1GKGA 4DURA 2JGXA 5EOKA 5CT1A 4UV6A 2Z8WA 4ONTD 5CS3A 3SRIA 4YNXA 1FBRA 2ZYCA 2XRBA 4PO7A 3T5OA 5HYPA 5CP9A 3EJHA 2QY0A 2IZ3A 2YILA 4BWCA 1GMOA 2Y8TA 3ZD1A 4AYEA 1O9AA 2IZ4A 3KXVA 4IGDA 2K13X 3HMTA 2J8LA 4J38B 3HN4A 3MQLA 3NFPI 2RLPA 2YIOA 1OJVA 1H2PP 4YIVA 1QO6A 3SRJA 1E88A 1MD7A 1U5MA 3IX0A 1PPQA 3R62A 2KRIA 2XQWC 4WJG2 1BHTA 2QJ4A 2X2ZA 3F6KA 4Z0EA 4B2SA 2RKYA 2JGWA 4N7EA 1H03P 5HZPB 2CG7A 1SRZA 1RLHA 2G7IA 5I25A 2I2LA 2Z8VA 3HMRA 2A55A 1OJWA 3O8EB 1E5GA 1OK1A 4R19A 1H2QP 2HGFA 2J8JA 2RL0A 3WSXA 1YXEA 2LOJA 3SP8A 2LL3A 1OK9A 4PZ5A 5HYTB 2V8EA 4ZH1D 1ZJKA 5HYUB 4C16A 4AYIA 2F83A 5CT3A 2KMSA 1CKLA 4UAOA 1HFHA 4APLA 2CKUA 2MCZA
chains in the Genus database with same CATH topology
4R1AA 3FGRA 5CS9A 3HMSA 4Z09A 3MKPA 2Y8RA 2Y8SA 5CS5A 5CT2A 5CSQA 1GP9A 2QJ2A 1NK1A 3ZLEA 5COEA 5EODA 4MSLA 2KL5A 3NJAA 4A5TS 2Q8BA 3ZWZA 3ZLDA 3FGTA 2LL4M 4YIZA 4Z0DA 1Z40A 5CS1A 1I8NA 1W8KA 4IUAA 2YIPA 1GMNA 1W81A 4APMA 4Z0FA 4R1BA 2Q8AA 3WSYA 4R1CA 1HKYA 4DURA 5EOKA 5CT1A 4UV6A 2Z8WA 5CS3A 3SRIA 4PO7A 5CP9A 2YILA 4BWCA 1GMOA 2Y8TA 2K13X 3HMTA 2J8LA 3HN4A 2YIOA 4YIVA 3SRJA 1BHTA 4Z0EA 2QJ4A 3F6KA 2X2ZA 4N7EA 5I25A 2I2LA 2Z8VA 3HMRA 4R19A 2HGFA 2J8JA 3WSXA 1YXEA 3SP8A 2LL3A 2F83A 5CT3A 4UAOA 4APLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOD A;  4R1A A;  3SRJ A;  5CS9 A;  4R1C A;  1BHT A;  4Z0E A;  4A5T S;  2QJ4 A;  1HKY A;  3HMS A;  2X2Z A;  4DUR A;  2Q8B A;  5EOK A;  3ZWZ A;  5CT1 A;  4UV6 A;  3ZLD A;  2LL4 M;  2Z8W A;  4Z09 A;  5CS3 A;  4YIZ A;  3SRI A;  5I25 A;  5CP9 A;  3MKP A;  2Z8V A;  1Z40 A;  3HMR A;  5CS1 A;  4Z0D A;  2Y8R A;  2YIL A;  4R19 A;  2HGF A;  1I8N A;  1W8K A;  2J8J A;  1GMO A;  2Y8S A;  2Y8T A;  1YXE A;  4IUA A;  3SP8 A;  2YIP A;  2LL3 A;  1GMN A;  5CS5 A;  1W81 A;  2K13 X;  5CT2 A;  5CSQ A;  4APM A;  1GP9 A;  2J8L A;  3HMT A;  4Z0F A;  2F83 A;  4R1B A;  5CT3 A;  2QJ2 A;  2Q8A A;  3HN4 A;  1NK1 A;  3ZLE A;  4UAO A;  4APL A;  5COE A;  2YIO A; 
#chains in the Genus database with same CATH topology
 1VVC A;  4A5W B;  2BZM A;  1OK3 A;  1C1Z A;  1G4G A;  1HFI A;  3FGR A;  4LOT A;  4R1A A;  2ERJ A;  5I0Q B;  5CS9 A;  2B5I D;  3RJ3 D;  1OK2 A;  3HMS A;  1MD8 A;  5DN4 A;  4Z09 A;  3MKP A;  3CI0 J;  4K12 A;  2UWN A;  2Y8R A;  1E8B A;  2Y8S A;  4AYM A;  5FO8 C;  3ZRZ A;  4DJZ A;  3CAL A;  1HCC A;  1QGB A;  4MUC A;  5CS5 A;  3K3T A;  4KKD A;  5CT2 A;  5CSQ A;  1NWV A;  1TPG A;  1GP9 A;  1TPM A;  2WII C;  3ZD2 A;  1G4F A;  3OED C;  2QJ2 A;  2XWB F;  3ERB A;  3ZLE A;  3OP8 A;  1NK1 A;  5COE A;  2YBY A;  2EHF A;  1GHQ B;  4JHS A;  3IU3 I;  2YRA A;  2W81 A;  3GOV A;  4MSL A;  4AYD A;  4CSY A;  2KL5 A;  5EOD A;  3NJA A;  5JPM G;  3SW0 X;  1UOT P;  4FXG G;  4A5T S;  2Q8B A;  3ZWZ A;  1H04 P;  2EC3 A;  3ZLD A;  3FGT A;  2LL4 M;  4YIZ A;  2CG6 A;  3M7P A;  2XRD A;  4Z0D A;  1Z40 A;  5CS1 A;  2MCY A;  2W80 A;  1TPN A;  3TVJ A;  2XWJ I;  1I8N A;  1W8K A;  1VVD A;  1OJY A;  1Z92 B;  4IUA A;  3INB C;  3OXU D;  2YIP A;  1GMN A;  4LOS A;  1W81 A;  1ELV A;  3GXE A;  4F4O C;  4APM A;  4Z0F A;  4R1B A;  5DN5 A;  1GKN A;  3L89 M;  2RKZ A;  1SS2 A;  3VWO A;  2Q8A A;  3KZJ A;  2O39 C;  2JRA A;  1QUB A;  4B2R A;  1GPZ A;  3WSY A;  2RLQ A;  4R1C A;  1LY2 A;  1Q3X A;  1HKY A;  1GKG A;  4DUR A;  2JGX A;  5EOK A;  5CT1 A;  4UV6 A;  2Z8W A;  4ONT D;  5CS3 A;  3SRI A;  4YNX A;  1FBR A;  2ZYC A;  2XRB A;  4PO7 A;  3T5O A;  5HYP A;  5CP9 A;  3EJH A;  2QY0 A;  2IZ3 A;  2YIL A;  4BWC A;  1GMO A;  2Y8T A;  3ZD1 A;  4AYE A;  1O9A A;  2IZ4 A;  3KXV A;  4IGD A;  2K13 X;  3HMT A;  2J8L A;  4J38 B;  3HN4 A;  3MQL A;  3NFP I;  2RLP A;  2YIO A;  1OJV A;  1H2P P;  4YIV A;  1QO6 A;  3SRJ A;  1E88 A;  1MD7 A;  1U5M A;  3IX0 A;  1PPQ A;  3R62 A;  2KRI A;  2XQW C;  4WJG 2;  1BHT A;  2QJ4 A;  2X2Z A;  3F6K A;  4Z0E A;  4B2S A;  2RKY A;  2JGW A;  4N7E A;  1H03 P;  5HZP B;  2CG7 A;  1SRZ A;  1RLH A;  2G7I A;  5I25 A;  2I2L A;  2Z8V A;  3HMR A;  2A55 A;  1OJW A;  3O8E B;  1E5G A;  1OK1 A;  4R19 A;  1H2Q P;  2HGF A;  2J8J A;  2RL0 A;  3WSX A;  1YXE A;  2LOJ A;  3SP8 A;  2LL3 A;  1OK9 A;  4PZ5 A;  5HYT B;  2V8E A;  4ZH1 D;  1ZJK A;  5HYU B;  4C16 A;  4AYI A;  2F83 A;  5CT3 A;  2KMS A;  1CKL A;  4UAO A;  1HFH A;  4APL A;  2CKU A;  2MCZ A; 
#chains in the Genus database with same CATH homology
 4R1A A;  3FGR A;  5CS9 A;  3HMS A;  4Z09 A;  3MKP A;  2Y8R A;  2Y8S A;  5CS5 A;  5CT2 A;  5CSQ A;  1GP9 A;  2QJ2 A;  1NK1 A;  3ZLE A;  5COE A;  5EOD A;  4MSL A;  2KL5 A;  3NJA A;  4A5T S;  2Q8B A;  3ZWZ A;  3ZLD A;  3FGT A;  2LL4 M;  4YIZ A;  4Z0D A;  1Z40 A;  5CS1 A;  1I8N A;  1W8K A;  4IUA A;  2YIP A;  1GMN A;  1W81 A;  4APM A;  4Z0F A;  4R1B A;  2Q8A A;  3WSY A;  4R1C A;  1HKY A;  4DUR A;  5EOK A;  5CT1 A;  4UV6 A;  2Z8W A;  5CS3 A;  3SRI A;  4PO7 A;  5CP9 A;  2YIL A;  4BWC A;  1GMO A;  2Y8T A;  2K13 X;  3HMT A;  2J8L A;  3HN4 A;  2YIO A;  4YIV A;  3SRJ A;  1BHT A;  4Z0E A;  2QJ4 A;  3F6K A;  2X2Z A;  4N7E A;  5I25 A;  2I2L A;  2Z8V A;  3HMR A;  4R19 A;  2HGF A;  2J8J A;  3WSX A;  1YXE A;  3SP8 A;  2LL3 A;  2F83 A;  5CT3 A;  4UAO A;  4APL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...