2Y8RA

Crystal structure of apo ama1 mutant (tyr230ala) from toxoplasma gondii
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
412
structure length
399
Chain Sequence
b'SGNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVKATKYRYPFVYDSKKRLCHILAVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPLTSQASWNDWWPLHQSDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN, PUTATIVE
publication title Host Cell Invasion by Apicomplexan Parasites: Insights from the Co-Structure of Ama1 with a Ron2 Peptide
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 91
structure length 399
sequence length 412
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2y8rA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2y8rA01
2Y8RA 1GMOA 1GMNA 4A5TS 1BHTA 2K13X 2YILA 3HMRA 3MKPA 5CS9A 4Z0EA 5CS1A 3HMSA 3ZWZA 1GP9A 2Y8SA 1I8NA 1W81A 2Z8VA 4R19A 4UAOA 4UV6A 4APLA 5EODA 4R1BA 4R1CA 2YIPA 5EOKA 2X2ZA 2Z8WA 3ZLDA 3SRIA 2J8LA 2YIOA 1Z40A 2LL4M 3ZLEA 2Q8BA 5CS3A 4IUAA 5CT3A 4Z09A 3SRJA 5CT1A 2Q8AA 2QJ4A 4Z0DA 1W8KA 3HMTA 5I25A 5COEA 5CS5A 1NK1A 2J8JA 4Z0FA 2LL3A 2QJ2A 4R1AA 5CSQA 3SP8A 4DURA 1HKYA 2HGFA 5CT2A 2Y8TA 4APMA 3HN4A 5CP9A 2F83A 1YXEA 4YIZA
chains in the Genus database with same CATH superfamily
1CKLA 4PZ5A 1VVDA 2A55A 1BHTA 2YILA 1H04P 3HMSA 3ZWZA 1U5MA 2Y8SA 2YRAA 1W81A 2Z8VA 1OK1A 4R19A 4UV6A 3WSYA 4APLA 4AYIA 5EODA 2B5ID 2CG6A 4JHSA 1E5GA 4AYMA 2RLPA 2YIPA 3IX0A 1TPGA 2JGWA 1LY2A 3SRIA 3IU3I 2LL4M 2YIOA 3SRJA 3FGTA 2UWNA 1SRZA 4N7EA 2XRDA 1W8KA 3HMTA 2YBYA 3L89M 1MD8A 4C16A 5I25A 2BZMA 4B2SA 1NK1A 4R1AA 1HKYA 2KMSA 3ERBA 4DURA 1HFHA 3KXVA 2JRAA 2JGXA 4J38B 1RLHA 3FGRA 3GXEA 4AYEA 1GMOA 2XWBF 1GMNA 2K13X 3MKPA 1ELVA 2I2LA 1OJYA 3M7PA 1OK9A 3ZD1A 2EC3A 4F4OC 2LOJA 5I0QB 2XRBA 3CI0J 2XQWC 2W80A 5FO8C 4PO7A 4LOTA 5EOKA 2X2ZA 2Z8WA 1TPMA 2RLQA 1ZJKA 3ZRZA 1Q3XA 3ZLEA 2V8EA 1PPQA 1MD7A 2G7IA 4A5WB 2IZ4A 1Z92B 4IUAA 1HFIA 2Q8AA 2MCYA 3RJ3D 4WJG2 4IGDA 2WIIC 1QO6A 4ZH1D 3MQLA 2RL0A 3SP8A 1E8BA 1QGBA 3T5OA 1GKNA 3NJAA 4A5TS 1H2QP 2W81A 1OJVA 5CS9A 4Z0EA 1VVCA 2CG7A 5CS1A 2CKUA 3F6KA 1GP9A 1I8NA 1E88A 1H2PP 1OK3A 1C1ZA 1HCCA 4FXGG 4R1CA 1GPZA 5HYUB 3GOVA 4B2RA 2KL5A 2KRIA 3OXUD 4K12A 4MUCA 5DN5A 1G4FA 2J8LA 3INBC 4MSLA 3NFPI 5CT1A 4Z09A 2O39C 2QJ4A 3ZD2A 2QY0A 1G4GA 3CALA 4AYDA 3EJHA 4Z0FA 1UOTP 2QJ2A 5CSQA 3OEDC 2HGFA 1TPNA 2Y8TA 5HZPB 3R62A 1H03P 5CP9A 2F83A 4CSYA 1YXEA 2Y8RA 2RKZA 3HMRA 5HYPA 3O8EB 4KKDA 4UAOA 2IZ3A 4R1BA 3SW0X 1GHQB 3TVJA 3ZLDA 1O9AA 1Z40A 2Q8BA 1GKGA 3WSXA 4DJZA 5CS3A 5CT3A 2RKYA 1OK2A 5DN4A 3K3TA 4Z0DA 4YNXA 1FBRA 3OP8A 4BWCA 4YIVA 5COEA 5CS5A 2XWJI 2J8JA 1QUBA 2LL3A 3VWOA 2ERJA 1NWVA 3KZJA 5CT2A 2EHFA 2MCZA 2ZYCA 5JPMG 3HN4A 4APMA 4LOSA 1OJWA 4ONTD 5HYTB 1SS2A 4YIZA
chains in the Genus database with same CATH topology
1BHTA 2YILA 3HMSA 3ZWZA 2Y8SA 1W81A 2Z8VA 4R19A 4UV6A 3WSYA 4APLA 5EODA 2YIPA 3SRIA 2YIOA 2LL4M 3SRJA 3FGTA 4N7EA 1W8KA 3HMTA 5I25A 1NK1A 4R1AA 1HKYA 4DURA 3FGRA 1GMOA 1GMNA 2K13X 3MKPA 2I2LA 4PO7A 5EOKA 2X2ZA 2Z8WA 3ZLEA 4IUAA 2Q8AA 3SP8A 3NJAA 4A5TS 5CS9A 4Z0EA 5CS1A 1GP9A 3F6KA 1I8NA 4R1CA 2KL5A 2J8LA 4MSLA 5CT1A 4Z09A 2QJ4A 4Z0FA 2QJ2A 5CSQA 2HGFA 2Y8TA 5CP9A 2F83A 1YXEA 2Y8RA 3HMRA 4UAOA 4R1BA 3ZLDA 1Z40A 2Q8BA 3WSXA 5CS3A 5CT3A 4Z0DA 4YIVA 4BWCA 5COEA 5CS5A 2J8JA 2LL3A 5CT2A 4APMA 3HN4A 4YIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8R A;  1GMO A;  1GMN A;  4A5T S;  1BHT A;  2K13 X;  2YIL A;  3HMR A;  3MKP A;  5CS9 A;  4Z0E A;  5CS1 A;  3HMS A;  3ZWZ A;  1GP9 A;  2Y8S A;  1I8N A;  1W81 A;  2Z8V A;  4R19 A;  4UAO A;  4UV6 A;  4APL A;  5EOD A;  4R1B A;  4R1C A;  2YIP A;  5EOK A;  2X2Z A;  2Z8W A;  3ZLD A;  3SRI A;  2J8L A;  2YIO A;  1Z40 A;  2LL4 M;  3ZLE A;  2Q8B A;  5CS3 A;  4IUA A;  5CT3 A;  4Z09 A;  3SRJ A;  5CT1 A;  2Q8A A;  2QJ4 A;  4Z0D A;  1W8K A;  3HMT A;  5I25 A;  5COE A;  5CS5 A;  1NK1 A;  2J8J A;  4Z0F A;  2LL3 A;  2QJ2 A;  4R1A A;  5CSQ A;  3SP8 A;  4DUR A;  1HKY A;  2HGF A;  5CT2 A;  2Y8T A;  4APM A;  3HN4 A;  5CP9 A;  2F83 A;  1YXE A;  4YIZ A; 
#chains in the Genus database with same CATH topology
 1CKL A;  4PZ5 A;  1VVD A;  2A55 A;  1BHT A;  2YIL A;  1H04 P;  3HMS A;  3ZWZ A;  1U5M A;  2Y8S A;  2YRA A;  1W81 A;  2Z8V A;  1OK1 A;  4R19 A;  4UV6 A;  3WSY A;  4APL A;  4AYI A;  5EOD A;  2B5I D;  2CG6 A;  4JHS A;  1E5G A;  4AYM A;  2RLP A;  2YIP A;  3IX0 A;  1TPG A;  2JGW A;  1LY2 A;  3SRI A;  3IU3 I;  2LL4 M;  2YIO A;  3SRJ A;  3FGT A;  2UWN A;  1SRZ A;  4N7E A;  2XRD A;  1W8K A;  3HMT A;  2YBY A;  3L89 M;  1MD8 A;  4C16 A;  5I25 A;  2BZM A;  4B2S A;  1NK1 A;  4R1A A;  1HKY A;  2KMS A;  3ERB A;  4DUR A;  1HFH A;  3KXV A;  2JRA A;  2JGX A;  4J38 B;  1RLH A;  3FGR A;  3GXE A;  4AYE A;  1GMO A;  2XWB F;  1GMN A;  2K13 X;  3MKP A;  1ELV A;  2I2L A;  1OJY A;  3M7P A;  1OK9 A;  3ZD1 A;  2EC3 A;  4F4O C;  2LOJ A;  5I0Q B;  2XRB A;  3CI0 J;  2XQW C;  2W80 A;  5FO8 C;  4PO7 A;  4LOT A;  5EOK A;  2X2Z A;  2Z8W A;  1TPM A;  2RLQ A;  1ZJK A;  3ZRZ A;  1Q3X A;  3ZLE A;  2V8E A;  1PPQ A;  1MD7 A;  2G7I A;  4A5W B;  2IZ4 A;  1Z92 B;  4IUA A;  1HFI A;  2Q8A A;  2MCY A;  3RJ3 D;  4WJG 2;  4IGD A;  2WII C;  1QO6 A;  4ZH1 D;  3MQL A;  2RL0 A;  3SP8 A;  1E8B A;  1QGB A;  3T5O A;  1GKN A;  3NJA A;  4A5T S;  1H2Q P;  2W81 A;  1OJV A;  5CS9 A;  4Z0E A;  1VVC A;  2CG7 A;  5CS1 A;  2CKU A;  3F6K A;  1GP9 A;  1I8N A;  1E88 A;  1H2P P;  1OK3 A;  1C1Z A;  1HCC A;  4FXG G;  4R1C A;  1GPZ A;  5HYU B;  3GOV A;  4B2R A;  2KL5 A;  2KRI A;  3OXU D;  4K12 A;  4MUC A;  5DN5 A;  1G4F A;  2J8L A;  3INB C;  4MSL A;  3NFP I;  5CT1 A;  4Z09 A;  2O39 C;  2QJ4 A;  3ZD2 A;  2QY0 A;  1G4G A;  3CAL A;  4AYD A;  3EJH A;  4Z0F A;  1UOT P;  2QJ2 A;  5CSQ A;  3OED C;  2HGF A;  1TPN A;  2Y8T A;  5HZP B;  3R62 A;  1H03 P;  5CP9 A;  2F83 A;  4CSY A;  1YXE A;  2Y8R A;  2RKZ A;  3HMR A;  5HYP A;  3O8E B;  4KKD A;  4UAO A;  2IZ3 A;  4R1B A;  3SW0 X;  1GHQ B;  3TVJ A;  3ZLD A;  1O9A A;  1Z40 A;  2Q8B A;  1GKG A;  3WSX A;  4DJZ A;  5CS3 A;  5CT3 A;  2RKY A;  1OK2 A;  5DN4 A;  3K3T A;  4Z0D A;  4YNX A;  1FBR A;  3OP8 A;  4BWC A;  4YIV A;  5COE A;  5CS5 A;  2XWJ I;  2J8J A;  1QUB A;  2LL3 A;  3VWO A;  2ERJ A;  1NWV A;  3KZJ A;  5CT2 A;  2EHF A;  2MCZ A;  2ZYC A;  5JPM G;  3HN4 A;  4APM A;  4LOS A;  1OJW A;  4ONT D;  5HYT B;  1SS2 A;  4YIZ A; 
#chains in the Genus database with same CATH homology
 1BHT A;  2YIL A;  3HMS A;  3ZWZ A;  2Y8S A;  1W81 A;  2Z8V A;  4R19 A;  4UV6 A;  3WSY A;  4APL A;  5EOD A;  2YIP A;  3SRI A;  2YIO A;  2LL4 M;  3SRJ A;  3FGT A;  4N7E A;  1W8K A;  3HMT A;  5I25 A;  1NK1 A;  4R1A A;  1HKY A;  4DUR A;  3FGR A;  1GMO A;  1GMN A;  2K13 X;  3MKP A;  2I2L A;  4PO7 A;  5EOK A;  2X2Z A;  2Z8W A;  3ZLE A;  4IUA A;  2Q8A A;  3SP8 A;  3NJA A;  4A5T S;  5CS9 A;  4Z0E A;  5CS1 A;  1GP9 A;  3F6K A;  1I8N A;  4R1C A;  2KL5 A;  2J8L A;  4MSL A;  5CT1 A;  4Z09 A;  2QJ4 A;  4Z0F A;  2QJ2 A;  5CSQ A;  2HGF A;  2Y8T A;  5CP9 A;  2F83 A;  1YXE A;  2Y8R A;  3HMR A;  4UAO A;  4R1B A;  3ZLD A;  1Z40 A;  2Q8B A;  3WSX A;  5CS3 A;  5CT3 A;  4Z0D A;  4YIV A;  4BWC A;  5COE A;  5CS5 A;  2J8J A;  2LL3 A;  5CT2 A;  4APM A;  3HN4 A;  4YIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...