4YIVA

Crystal structure of engineered tgama1 lacking the dii loop
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
388
structure length
374
Chain Sequence
GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPGQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNPSVTPPTTALQCPDSFGACDVQACKRQKTSCVGGQIQSTSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen AMA1
publication title An Extended Surface Loop on Toxoplasma gondii Apical Membrane Antigen 1 (AMA1) Governs Ligand Binding Selectivity.
pubmed doi rcsb
source organism Toxoplasma gondii me49
molecule tags Immune system
total genus 101
structure length 374
sequence length 388
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.30 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4yivA01
4YIZA 4YIVA
chains in the Genus database with same CATH superfamily
4R1AA 4R19A 4R1CA 2YILA 5CS5A 4R1BA 5CSQA 2J8LA 3SP8A 2F83A 1I8NA 3MKPA 1BHTA 2Y8RA 5CT3A 2KL5A 4YIZA 5EOKA 5CT1A 3HMTA 5CT2A 5CS1A 2LL3A 1GP9A 2LL4M 5CS3A 5CP9A 1Z40A 2Q8AA 2QJ4A 2K13X 4IUAA 2J8JA 4UAOA 4YIVA 5EODA 3ZWZA 1W81A 1HKYA 1W8KA 1YXEA 3HN4A 3SRIA 4Z09A 4Z0FA 4Z0EA 4UV6A 2QJ2A 4DURA 2Z8VA 1NK1A 3HMRA 4APLA 5CS9A 1GMNA 2YIOA 5COEA 2X2ZA 3HMSA 3ZLEA 5I25A 2YIPA 2HGFA 4A5TS 4Z0DA 3SRJA 4APMA 2Z8WA 2Q8BA 1GMOA
chains in the Genus database with same CATH topology
4R1AA 4R19A 4R1CA 2YILA 5CS5A 4R1BA 5CSQA 2J8LA 3SP8A 2F83A 1I8NA 3MKPA 1BHTA 2Y8RA 5CT3A 2KL5A 4YIZA 5EOKA 5CT1A 3HMTA 5CT2A 5CS1A 2LL3A 1GP9A 2LL4M 5CS3A 5CP9A 1Z40A 2Q8AA 2QJ4A 2K13X 4IUAA 2J8JA 4UAOA 4YIVA 5EODA 3ZWZA 1W81A 1HKYA 1W8KA 1YXEA 3HN4A 3SRIA 4Z09A 4Z0FA 4Z0EA 4UV6A 2QJ2A 4DURA 2Z8VA 1NK1A 3HMRA 4APLA 5CS9A 1GMNA 2YIOA 5COEA 2X2ZA 3HMSA 3ZLEA 5I25A 2YIPA 2HGFA 4A5TS 4Z0DA 3SRJA 4APMA 2Z8WA 2Q8BA 1GMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIZ A;  4YIV A; 
#chains in the Genus database with same CATH topology
 4R1A A;  4R19 A;  4R1C A;  2YIL A;  5CS5 A;  4R1B A;  5CSQ A;  2J8L A;  3SP8 A;  2F83 A;  1I8N A;  3MKP A;  1BHT A;  2Y8R A;  5CT3 A;  2KL5 A;  4YIZ A;  5EOK A;  5CT1 A;  3HMT A;  5CT2 A;  5CS1 A;  2LL3 A;  1GP9 A;  2LL4 M;  5CS3 A;  5CP9 A;  1Z40 A;  2Q8A A;  2QJ4 A;  2K13 X;  4IUA A;  2J8J A;  4UAO A;  4YIV A;  5EOD A;  3ZWZ A;  1W81 A;  1HKY A;  1W8K A;  1YXE A;  3HN4 A;  3SRI A;  4Z09 A;  4Z0F A;  4Z0E A;  4UV6 A;  2QJ2 A;  4DUR A;  2Z8V A;  1NK1 A;  3HMR A;  4APL A;  5CS9 A;  1GMN A;  2YIO A;  5COE A;  2X2Z A;  3HMS A;  3ZLE A;  5I25 A;  2YIP A;  2HGF A;  4A5T S;  4Z0D A;  3SRJ A;  4APM A;  2Z8W A;  2Q8B A;  1GMO A; 
#chains in the Genus database with same CATH homology
 4R1A A;  4R19 A;  4R1C A;  2YIL A;  5CS5 A;  4R1B A;  5CSQ A;  2J8L A;  3SP8 A;  2F83 A;  1I8N A;  3MKP A;  1BHT A;  2Y8R A;  5CT3 A;  2KL5 A;  4YIZ A;  5EOK A;  5CT1 A;  3HMT A;  5CT2 A;  5CS1 A;  2LL3 A;  1GP9 A;  2LL4 M;  5CS3 A;  5CP9 A;  1Z40 A;  2Q8A A;  2QJ4 A;  2K13 X;  4IUA A;  2J8J A;  4UAO A;  4YIV A;  5EOD A;  3ZWZ A;  1W81 A;  1HKY A;  1W8K A;  1YXE A;  3HN4 A;  3SRI A;  4Z09 A;  4Z0F A;  4Z0E A;  4UV6 A;  2QJ2 A;  4DUR A;  2Z8V A;  1NK1 A;  3HMR A;  4APL A;  5CS9 A;  1GMN A;  2YIO A;  5COE A;  2X2Z A;  3HMS A;  3ZLE A;  5I25 A;  2YIP A;  2HGF A;  4A5T S;  4Z0D A;  3SRJ A;  4APM A;  2Z8W A;  2Q8B A;  1GMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...