1G3GA

Nmr structure of the fha1 domain of yeast rad53
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
164
structure length
164
Chain Sequence
b'GENITQPTQQSTQATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTIEN KINASE SPK1
publication title Structure of the FHA1 domain of yeast Rad53 and identification of binding sites for both FHA1 and its target protein Rad9
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 19
structure length 164
sequence length 164
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1g3gA00
1UHTA 1WLNA 2CSWA 2JQLA 1MZKA 3OUNA 2JQJA 4D9VA 1J4QA 3GQSA 3UMZA 1G3GA 3I0NA 1FHRA 5A8IA 1J4LA 2KB4A 3HX1A 4H87A 1K2NA 3HUEA 2AFFA 4EGXA 3ELSA 5DJOA 3UNMA 4A0EA 3I6UA 3VA4A 3PO8A 1K3JA 1K3QA 5E50A 2EH0A 2A0TA 1LGPA 4QCJA 3HUFA 1QU5A 3KT9A 3UOTA 1FHQA 1YJ5C 2JKDA 2W3OA 3UN0A 4JONA 2KB3A 1DMZA 2FF4A 3VA1A 3MDBA 3I6WA 1GXCA 2FEZA 1LGQA 1G6GA 4EJQA 1K2MA 2JQIA 2G1LA 3VPYA 1J4PA 2JPEA 2KKLA 3UNNA 3POAA 3ELVA 2PIEA 1J4KA 2KFUA 1YJMA 2XT9B 2LC1A 1J4OA 1WV3A 1K3NA 3FM8A 1R21A 3UV0A 4G2SA 3I0MA 2BRFA 1UJXA
chains in the Genus database with same CATH superfamily
4HAOA 1YGSA 5JEJA 3GMJA 1UHTA 1WLNA 5C4VA 2CSWA 2JQLA 1MZKA 3OUNA 2JQJA 4D9VA 5JERA 1J4QA 3GQSA 3UMZA 3V8RA 2I2CA 1G3GA 2QVLA 2QV7A 3I0NA 1FHRA 3V7YA 4L02A 1U0RA 3T5PA 3V8MA 5JEOA 5A8IA 1J4LA 2KB4A 3HX1A 4H87A 1K2NA 3A77A 3HUEA 2I2DA 1MJSA 2AFFA 4KU0D 3V7WA 4EGXA 3ELSA 5DJOA 3UNMA 2AN1A 5EJGA 3VZDA 4A0EA 3I6UA 3VA4A 1Z0ZA 3PO8A 4R9PA 5EJFA 1K3JA 1K3QA 1Z0SA 1QWTA 2EH0A 5E50A 2A0TA 1LGPA 2XXSA 2BONA 5DHPA 3VZCA 4QCJA 3DSHA 1U7FA 3HUFA 1QU5A 3KT9A 3UOTA 1U7VA 1J2FA 1FHQA 1YT5A 1YJ5C 2JKDA 4DY6A 4JIVD 2W3OA 4JONA 3UN0A 2KB3A 1SUWA 1DMZA 2FF4A 5DHRA 1U7VB 3VA1A 1G88A 1KHUA 3MDBA 5EJIA 5JEKA 1MK2A 1Y3IA 3I6WA 1GXCA 2FEZA 5DHSA 2I2AA 3V8NA 1LGQA 1Y3HA 1G6GA 3V8QA 3V8PA 5JELA 4EJQA 1K2MA 3VZBA 3PFNA 2Q5FA 5DHUA 1DEVA 5JEMA 2I2BA 2JQIA 3V7UA 1U0TA 3AFOA 2G1LA 1KHXA 3VPYA 1U7FB 3V80A 1J4PA 5EJHA 4V24A 2JPEA 2KKLA 4A4YA 2I2FA 4JIWD 4WRRA 3UNNA 5DHTA 3POAA 3ELVA 2PIEA 2JGRA 1J4KA 1ZOQA 2KFUA 1Z0UA 1YJMA 2XT9B 3S40A 2LC1A 2I1WA 2P1RA 1J4OA 3DITA 5BVIA 4WERA 1WV3A 2I29A 1K3NA 3FM8A 1R21A 3UV0A 4G2SA 1MR1A 1DD1A 3I0MA 5DHQA 2BRFA 1UJXA
chains in the Genus database with same CATH topology
1YGSA 5JEJA 3GMJA 1UHTA 1WLNA 5C4VA 2CSWA 2JQLA 1MZKA 3OUNA 2JQJA 4D9VA 5JERA 1J4QA 3GQSA 3UMZA 1G3GA 2QVLA 2QV7A 3I0NA 1FHRA 4L02A 3T5PA 5JEOA 5A8IA 1J4LA 2KB4A 3HX1A 4H87A 1K2NA 3A77A 3HUEA 1MJSA 2AFFA 4KU0D 4EGXA 3ELSA 5DJOA 3UNMA 3VZDA 4A0EA 3I6UA 3VA4A 3PO8A 4R9PA 1K3JA 1K3QA 1QWTA 2EH0A 5E50A 2A0TA 1LGPA 2XXSA 2BONA 3VZCA 4QCJA 3DSHA 1U7FA 3HUFA 1QU5A 3KT9A 3UOTA 1U7VA 1J2FA 1FHQA 1YJ5C 2JKDA 4JIVD 2W3OA 4JONA 3UN0A 2KB3A 1DMZA 2FF4A 1U7VB 3VA1A 1G88A 1KHUA 3MDBA 5JEKA 1MK2A 3I6WA 1GXCA 2FEZA 1LGQA 1G6GA 5JELA 4EJQA 1K2MA 3VZBA 1DEVA 5JEMA 2JQIA 2G1LA 1KHXA 3VPYA 1U7FB 1J4PA 4V24A 2JPEA 2KKLA 4A4YA 4JIWD 4WRRA 3UNNA 3POAA 3ELVA 2PIEA 2JGRA 1J4KA 1ZOQA 2KFUA 1YJMA 2XT9B 3S40A 2LC1A 2P1RA 1J4OA 3DITA 5BVIA 4WERA 1WV3A 1K3NA 3FM8A 1R21A 3UV0A 4G2SA 1MR1A 1DD1A 3I0MA 2BRFA 1UJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHT A;  1WLN A;  2CSW A;  2JQL A;  1MZK A;  3OUN A;  2JQJ A;  4D9V A;  1J4Q A;  3GQS A;  3UMZ A;  1G3G A;  3I0N A;  1FHR A;  5A8I A;  1J4L A;  2KB4 A;  3HX1 A;  4H87 A;  1K2N A;  3HUE A;  2AFF A;  4EGX A;  3ELS A;  5DJO A;  3UNM A;  4A0E A;  3I6U A;  3VA4 A;  3PO8 A;  1K3J A;  1K3Q A;  5E50 A;  2EH0 A;  2A0T A;  1LGP A;  4QCJ A;  3HUF A;  1QU5 A;  3KT9 A;  3UOT A;  1FHQ A;  1YJ5 C;  2JKD A;  2W3O A;  3UN0 A;  4JON A;  2KB3 A;  1DMZ A;  2FF4 A;  3VA1 A;  3MDB A;  3I6W A;  1GXC A;  2FEZ A;  1LGQ A;  1G6G A;  4EJQ A;  1K2M A;  2JQI A;  2G1L A;  3VPY A;  1J4P A;  2JPE A;  2KKL A;  3UNN A;  3POA A;  3ELV A;  2PIE A;  1J4K A;  2KFU A;  1YJM A;  2XT9 B;  2LC1 A;  1J4O A;  1WV3 A;  1K3N A;  3FM8 A;  1R21 A;  3UV0 A;  4G2S A;  3I0M A;  2BRF A;  1UJX A; 
#chains in the Genus database with same CATH topology
 4HAO A;  1YGS A;  5JEJ A;  3GMJ A;  1UHT A;  1WLN A;  5C4V A;  2CSW A;  2JQL A;  1MZK A;  3OUN A;  2JQJ A;  4D9V A;  5JER A;  1J4Q A;  3GQS A;  3UMZ A;  3V8R A;  2I2C A;  1G3G A;  2QVL A;  2QV7 A;  3I0N A;  1FHR A;  3V7Y A;  4L02 A;  1U0R A;  3T5P A;  3V8M A;  5JEO A;  5A8I A;  1J4L A;  2KB4 A;  3HX1 A;  4H87 A;  1K2N A;  3A77 A;  3HUE A;  2I2D A;  1MJS A;  2AFF A;  4KU0 D;  3V7W A;  4EGX A;  3ELS A;  5DJO A;  3UNM A;  2AN1 A;  5EJG A;  3VZD A;  4A0E A;  3I6U A;  3VA4 A;  1Z0Z A;  3PO8 A;  4R9P A;  5EJF A;  1K3J A;  1K3Q A;  1Z0S A;  1QWT A;  2EH0 A;  5E50 A;  2A0T A;  1LGP A;  2XXS A;  2BON A;  5DHP A;  3VZC A;  4QCJ A;  3DSH A;  1U7F A;  3HUF A;  1QU5 A;  3KT9 A;  3UOT A;  1U7V A;  1J2F A;  1FHQ A;  1YT5 A;  1YJ5 C;  2JKD A;  4DY6 A;  4JIV D;  2W3O A;  4JON A;  3UN0 A;  2KB3 A;  1SUW A;  1DMZ A;  2FF4 A;  5DHR A;  1U7V B;  3VA1 A;  1G88 A;  1KHU A;  3MDB A;  5EJI A;  5JEK A;  1MK2 A;  1Y3I A;  3I6W A;  1GXC A;  2FEZ A;  5DHS A;  2I2A A;  3V8N A;  1LGQ A;  1Y3H A;  1G6G A;  3V8Q A;  3V8P A;  5JEL A;  4EJQ A;  1K2M A;  3VZB A;  3PFN A;  2Q5F A;  5DHU A;  1DEV A;  5JEM A;  2I2B A;  2JQI A;  3V7U A;  1U0T A;  3AFO A;  2G1L A;  1KHX A;  3VPY A;  1U7F B;  3V80 A;  1J4P A;  5EJH A;  4V24 A;  2JPE A;  2KKL A;  4A4Y A;  2I2F A;  4JIW D;  4WRR A;  3UNN A;  5DHT A;  3POA A;  3ELV A;  2PIE A;  2JGR A;  1J4K A;  1ZOQ A;  2KFU A;  1Z0U A;  1YJM A;  2XT9 B;  3S40 A;  2LC1 A;  2I1W A;  2P1R A;  1J4O A;  3DIT A;  5BVI A;  4WER A;  1WV3 A;  2I29 A;  1K3N A;  3FM8 A;  1R21 A;  3UV0 A;  4G2S A;  1MR1 A;  1DD1 A;  3I0M A;  5DHQ A;  2BRF A;  1UJX A; 
#chains in the Genus database with same CATH homology
 1YGS A;  5JEJ A;  3GMJ A;  1UHT A;  1WLN A;  5C4V A;  2CSW A;  2JQL A;  1MZK A;  3OUN A;  2JQJ A;  4D9V A;  5JER A;  1J4Q A;  3GQS A;  3UMZ A;  1G3G A;  2QVL A;  2QV7 A;  3I0N A;  1FHR A;  4L02 A;  3T5P A;  5JEO A;  5A8I A;  1J4L A;  2KB4 A;  3HX1 A;  4H87 A;  1K2N A;  3A77 A;  3HUE A;  1MJS A;  2AFF A;  4KU0 D;  4EGX A;  3ELS A;  5DJO A;  3UNM A;  3VZD A;  4A0E A;  3I6U A;  3VA4 A;  3PO8 A;  4R9P A;  1K3J A;  1K3Q A;  1QWT A;  2EH0 A;  5E50 A;  2A0T A;  1LGP A;  2XXS A;  2BON A;  3VZC A;  4QCJ A;  3DSH A;  1U7F A;  3HUF A;  1QU5 A;  3KT9 A;  3UOT A;  1U7V A;  1J2F A;  1FHQ A;  1YJ5 C;  2JKD A;  4JIV D;  2W3O A;  4JON A;  3UN0 A;  2KB3 A;  1DMZ A;  2FF4 A;  1U7V B;  3VA1 A;  1G88 A;  1KHU A;  3MDB A;  5JEK A;  1MK2 A;  3I6W A;  1GXC A;  2FEZ A;  1LGQ A;  1G6G A;  5JEL A;  4EJQ A;  1K2M A;  3VZB A;  1DEV A;  5JEM A;  2JQI A;  2G1L A;  1KHX A;  3VPY A;  1U7F B;  1J4P A;  4V24 A;  2JPE A;  2KKL A;  4A4Y A;  4JIW D;  4WRR A;  3UNN A;  3POA A;  3ELV A;  2PIE A;  2JGR A;  1J4K A;  1ZOQ A;  2KFU A;  1YJM A;  2XT9 B;  3S40 A;  2LC1 A;  2P1R A;  1J4O A;  3DIT A;  5BVI A;  4WER A;  1WV3 A;  1K3N A;  3FM8 A;  1R21 A;  3UV0 A;  4G2S A;  1MR1 A;  1DD1 A;  3I0M A;  2BRF A;  1UJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...