The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
110
|
structure length |
110
|
Chain Sequence |
MIGMSEKRGEIMILIQNAEFELVHNFKDGFNEEAFKARYSDILNKYDYIVGDWGYGQLRLKGFFDDQNQKATFETKISTLDEYIYEYCNFGCAYFVLKRIRKLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution NMR Structure of protein yutD from B.subtilis, Northeast Structural Genomics Consortium Target Target SR232
rcsb |
| molecule keywords |
Uncharacterized protein yutD
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bacillus subtilis
|
| total genus |
19
|
| structure length |
110
|
| sequence length |
110
|
| ec nomenclature | |
| pdb deposition date | 2009-06-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06265 | DUF1027 | Protein of unknown function (DUF1027) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(bba) Sandwich | Hepatocyte Growth Factor | Hepatocyte Growth Factor |
#chains in the Genus database with same CATH superfamily 2KL5 A; #chains in the Genus database with same CATH topology 5CP9 A; 5CS1 A; 2QJ2 A; 1HKY A; 2KL5 A; 2X2Z A; 5CS9 A; 5EOK A; 3ZWZ A; 5CT1 A; 2YIO A; 3SRI A; 4R19 A; 3HMS A; 2LL4 M; 1GMN A; 2YIP A; 1YXE A; 1W8K A; 5I25 A; 2QJ4 A; 5COE A; 3SRJ A; 2HGF A; 4Z0F A; 1GMO A; 4R1C A; 2J8J A; 4UV6 A; 3HMR A; 4YIZ A; 4A5T S; 3ZLE A; 2Z8V A; 4DUR A; 4R1B A; 5CT3 A; 1BHT A; 5CT2 A; 4R1A A; 2J8L A; 2Q8A A; 5EOD A; 4Z0E A; 2LL3 A; 5CSQ A; 2K13 X; 2Z8W A; 3HN4 A; 4APM A; 1I8N A; 5CS5 A; 1NK1 A; 4IUA A; 2YIL A; 4Z0D A; 3SP8 A; 2Y8R A; 1GP9 A; 1Z40 A; 4UAO A; 4APL A; 2Q8B A; 4YIV A; 3MKP A; 2F83 A; 1W81 A; 3HMT A; 5CS3 A; 4Z09 A; #chains in the Genus database with same CATH homology 5CP9 A; 5CS1 A; 2QJ2 A; 1HKY A; 2KL5 A; 2X2Z A; 5CS9 A; 5EOK A; 3ZWZ A; 5CT1 A; 2YIO A; 3SRI A; 4R19 A; 3HMS A; 2LL4 M; 1GMN A; 2YIP A; 1YXE A; 1W8K A; 5I25 A; 2QJ4 A; 5COE A; 3SRJ A; 2HGF A; 4Z0F A; 1GMO A; 4R1C A; 2J8J A; 4UV6 A; 3HMR A; 4YIZ A; 4A5T S; 3ZLE A; 2Z8V A; 4DUR A; 4R1B A; 5CT3 A; 1BHT A; 5CT2 A; 4R1A A; 2J8L A; 2Q8A A; 5EOD A; 4Z0E A; 2LL3 A; 5CSQ A; 2K13 X; 2Z8W A; 3HN4 A; 4APM A; 1I8N A; 5CS5 A; 1NK1 A; 4IUA A; 2YIL A; 4Z0D A; 3SP8 A; 2Y8R A; 1GP9 A; 1Z40 A; 4UAO A; 4APL A; 2Q8B A; 4YIV A; 3MKP A; 2F83 A; 1W81 A; 3HMT A; 5CS3 A; 4Z09 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...