2LW6A

Solution structure of an avirulence protein avrpiz-t from pathogen magnaportheoryzae
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
SFVQCNHHLLYNGRHWGTIRKKAGWAVRFYEEKPGQPKRLVAICKNASPVHCNYLKCTNLAAGFSAGTSTDVLSSGTVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvrPiz-t protein
publication title Solution structure of the Magnaporthe oryzae avirulence protein AvrPiz-t.
pubmed doi rcsb
source organism Magnaporthe oryzae
molecule tags Apoptosis
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.80 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2lw6A00
2LW6A
chains in the Genus database with same CATH superfamily
3ZJVA 3BQBA 4AQ7A 5EQJB 3FPUA 1WLFA 2GFAA 5DYIA 3ZJUA 3MB5A 5CCXA 3LHDA 5CCBA 1I9GA 4RV0A 5FTJA 5FTNA 5GLFA 5C1BA 1QDNA 5FTMA 1E32A 4FIBA 3HU1A 5C18A 3QQ7A 2Q1AX 5FTKA 2YUJA 2QQRA 2YVLA 2PWYA 5FTLA 1CZ4A 3HU2A 1CZ5A 1ZC1A 1CR5A 3ZJTA 4KDIA 2LW6A 4KO8A 4KODA 4ARCA 2GF7A 5D6YA 1O54A 3CF2A 2XDPA 3ZGZA 3QQ8A 4AS1A 5EPPA 1R7RA 3TIWA 3QC8A 2KY9A 5CD1A 5B6CA 2Q19X 2JV2A 2B25A 5ERGB 2MM0A 2MM2A 4CQNA 4KLNA 4UC4A 2Q18X 4KDLA 2Q1CX 5DYGA 5D6WA 1QCSA 5D6XA 2QQSA 4ARIA 3LGAA 2Q1DX 3HU3A 3FPRA 3QWZA 1S3SA 3FPTA 2PJHB
chains in the Genus database with same CATH topology
3ZJVA 3BQBA 4AQ7A 5EQJB 3FPUA 1WLFA 2GFAA 5DYIA 3ZJUA 3MB5A 5CCXA 3LHDA 5CCBA 1I9GA 4RV0A 5FTJA 5FTNA 5GLFA 5C1BA 1QDNA 5FTMA 1E32A 4FIBA 3HU1A 5C18A 3QQ7A 2Q1AX 5FTKA 2YUJA 2QQRA 2YVLA 2PWYA 5FTLA 1CZ4A 3HU2A 1CZ5A 1ZC1A 1CR5A 3ZJTA 4KDIA 2LW6A 4KO8A 4KODA 4ARCA 2GF7A 5D6YA 1O54A 3CF2A 2XDPA 3ZGZA 3QQ8A 4AS1A 5EPPA 1R7RA 3TIWA 3QC8A 2KY9A 5CD1A 5B6CA 2Q19X 2JV2A 2B25A 5ERGB 2MM0A 2MM2A 4CQNA 4KLNA 4UC4A 2Q18X 4KDLA 2Q1CX 5DYGA 5D6WA 1QCSA 5D6XA 2QQSA 4ARIA 3LGAA 2Q1DX 3HU3A 3FPRA 3QWZA 1S3SA 3FPTA 2PJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW6 A; 
#chains in the Genus database with same CATH topology
 3ZJV A;  3BQB A;  4AQ7 A;  5EQJ B;  3FPU A;  1WLF A;  2GFA A;  5DYI A;  3ZJU A;  3MB5 A;  5CCX A;  3LHD A;  5CCB A;  1I9G A;  4RV0 A;  5FTJ A;  5FTN A;  5GLF A;  5C1B A;  1QDN A;  5FTM A;  1E32 A;  4FIB A;  3HU1 A;  5C18 A;  3QQ7 A;  2Q1A X;  5FTK A;  2YUJ A;  2QQR A;  2YVL A;  2PWY A;  5FTL A;  1CZ4 A;  3HU2 A;  1CZ5 A;  1ZC1 A;  1CR5 A;  3ZJT A;  4KDI A;  2LW6 A;  4KO8 A;  4KOD A;  4ARC A;  2GF7 A;  5D6Y A;  1O54 A;  3CF2 A;  2XDP A;  3ZGZ A;  3QQ8 A;  4AS1 A;  5EPP A;  1R7R A;  3TIW A;  3QC8 A;  2KY9 A;  5CD1 A;  5B6C A;  2Q19 X;  2JV2 A;  2B25 A;  5ERG B;  2MM0 A;  2MM2 A;  4CQN A;  4KLN A;  4UC4 A;  2Q18 X;  4KDL A;  2Q1C X;  5DYG A;  5D6W A;  1QCS A;  5D6X A;  2QQS A;  4ARI A;  3LGA A;  2Q1D X;  3HU3 A;  3FPR A;  3QWZ A;  1S3S A;  3FPT A;  2PJH B; 
#chains in the Genus database with same CATH homology
 3ZJV A;  3BQB A;  4AQ7 A;  5EQJ B;  3FPU A;  1WLF A;  2GFA A;  5DYI A;  3ZJU A;  3MB5 A;  5CCX A;  3LHD A;  5CCB A;  1I9G A;  4RV0 A;  5FTJ A;  5FTN A;  5GLF A;  5C1B A;  1QDN A;  5FTM A;  1E32 A;  4FIB A;  3HU1 A;  5C18 A;  3QQ7 A;  2Q1A X;  5FTK A;  2YUJ A;  2QQR A;  2YVL A;  2PWY A;  5FTL A;  1CZ4 A;  3HU2 A;  1CZ5 A;  1ZC1 A;  1CR5 A;  3ZJT A;  4KDI A;  2LW6 A;  4KO8 A;  4KOD A;  4ARC A;  2GF7 A;  5D6Y A;  1O54 A;  3CF2 A;  2XDP A;  3ZGZ A;  3QQ8 A;  4AS1 A;  5EPP A;  1R7R A;  3TIW A;  3QC8 A;  2KY9 A;  5CD1 A;  5B6C A;  2Q19 X;  2JV2 A;  2B25 A;  5ERG B;  2MM0 A;  2MM2 A;  4CQN A;  4KLN A;  4UC4 A;  2Q18 X;  4KDL A;  2Q1C X;  5DYG A;  5D6W A;  1QCS A;  5D6X A;  2QQS A;  4ARI A;  3LGA A;  2Q1D X;  3HU3 A;  3FPR A;  3QWZ A;  1S3S A;  3FPT A;  2PJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...