2LW6A

Solution structure of an avirulence protein avrpiz-t from pathogen magnaportheoryzae
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
SFVQCNHHLLYNGRHWGTIRKKAGWAVRFYEEKPGQPKRLVAICKNASPVHCNYLKCTNLAAGFSAGTSTDVLSSGTVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Magnaporthe oryzae avirulence protein AvrPiz-t.
pubmed doi rcsb
source organism Magnaporthe oryzae
molecule tags Apoptosis
molecule keywords AvrPiz-t protein
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.80 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2lw6A00
2LW6A
chains in the Genus database with same CATH superfamily
2QQRA 2JV2A 3LHDA 5CCBA 3ZJVA 2PJHB 3HU3A 3MB5A 1CZ4A 2PWYA 1WLFA 2LW6A 1CZ5A 1CR5A 5D6XA 2MM0A 4UC4A 2Q19X 2YUJA 3TIWA 4FIBA 2YVLA 5ERGB 3QQ8A 5EQJB 5D6YA 4ARIA 1O54A 5DYGA 5FTLA 5FTMA 4KLNA 3LGAA 5CD1A 2Q1AX 5C18A 5FTKA 3CF2A 2MM2A 2GFAA 4KDIA 1S3SA 1R7RA 4KDLA 5DYIA 5B6CA 1ZC1A 2XDPA 2B25A 1E32A 3HU1A 4AQ7A 3FPUA 2QQSA 2Q1DX 5FTNA 3FPRA 2Q1CX 5EPPA 3ZJUA 2GF7A 3HU2A 4RV0A 4KO8A 3QQ7A 4CQNA 1QDNA 5D6WA 5FTJA 2Q18X 4AS1A 3QC8A 3FPTA 1I9GA 5GLFA 5C1BA 3ZJTA 2KY9A 1QCSA 3ZGZA 5CCXA 3BQBA 4KODA 4ARCA 3QWZA
chains in the Genus database with same CATH topology
2QQRA 2JV2A 3LHDA 5CCBA 3ZJVA 2PJHB 3HU3A 3MB5A 1CZ4A 2PWYA 1WLFA 2LW6A 1CZ5A 1CR5A 5D6XA 2MM0A 4UC4A 2Q19X 2YUJA 3TIWA 4FIBA 2YVLA 5ERGB 3QQ8A 5EQJB 5D6YA 4ARIA 1O54A 5DYGA 5FTLA 5FTMA 4KLNA 3LGAA 5CD1A 2Q1AX 5C18A 5FTKA 3CF2A 2MM2A 2GFAA 4KDIA 1S3SA 1R7RA 4KDLA 5DYIA 5B6CA 1ZC1A 2XDPA 2B25A 1E32A 3HU1A 4AQ7A 3FPUA 2QQSA 2Q1DX 5FTNA 3FPRA 2Q1CX 5EPPA 3ZJUA 2GF7A 3HU2A 4RV0A 4KO8A 3QQ7A 4CQNA 1QDNA 5D6WA 5FTJA 2Q18X 4AS1A 3QC8A 3FPTA 1I9GA 5GLFA 5C1BA 3ZJTA 2KY9A 1QCSA 3ZGZA 5CCXA 3BQBA 4KODA 4ARCA 3QWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW6 A; 
#chains in the Genus database with same CATH topology
 2QQR A;  2JV2 A;  3LHD A;  5CCB A;  3ZJV A;  2PJH B;  3HU3 A;  3MB5 A;  1CZ4 A;  2PWY A;  1WLF A;  2LW6 A;  1CZ5 A;  1CR5 A;  5D6X A;  2MM0 A;  4UC4 A;  2Q19 X;  2YUJ A;  3TIW A;  4FIB A;  2YVL A;  5ERG B;  3QQ8 A;  5EQJ B;  5D6Y A;  4ARI A;  1O54 A;  5DYG A;  5FTL A;  5FTM A;  4KLN A;  3LGA A;  5CD1 A;  2Q1A X;  5C18 A;  5FTK A;  3CF2 A;  2MM2 A;  2GFA A;  4KDI A;  1S3S A;  1R7R A;  4KDL A;  5DYI A;  5B6C A;  1ZC1 A;  2XDP A;  2B25 A;  1E32 A;  3HU1 A;  4AQ7 A;  3FPU A;  2QQS A;  2Q1D X;  5FTN A;  3FPR A;  2Q1C X;  5EPP A;  3ZJU A;  2GF7 A;  3HU2 A;  4RV0 A;  4KO8 A;  3QQ7 A;  4CQN A;  1QDN A;  5D6W A;  5FTJ A;  2Q18 X;  4AS1 A;  3QC8 A;  3FPT A;  1I9G A;  5GLF A;  5C1B A;  3ZJT A;  2KY9 A;  1QCS A;  3ZGZ A;  5CCX A;  3BQB A;  4KOD A;  4ARC A;  3QWZ A; 
#chains in the Genus database with same CATH homology
 2QQR A;  2JV2 A;  3LHD A;  5CCB A;  3ZJV A;  2PJH B;  3HU3 A;  3MB5 A;  1CZ4 A;  2PWY A;  1WLF A;  2LW6 A;  1CZ5 A;  1CR5 A;  5D6X A;  2MM0 A;  4UC4 A;  2Q19 X;  2YUJ A;  3TIW A;  4FIB A;  2YVL A;  5ERG B;  3QQ8 A;  5EQJ B;  5D6Y A;  4ARI A;  1O54 A;  5DYG A;  5FTL A;  5FTM A;  4KLN A;  3LGA A;  5CD1 A;  2Q1A X;  5C18 A;  5FTK A;  3CF2 A;  2MM2 A;  2GFA A;  4KDI A;  1S3S A;  1R7R A;  4KDL A;  5DYI A;  5B6C A;  1ZC1 A;  2XDP A;  2B25 A;  1E32 A;  3HU1 A;  4AQ7 A;  3FPU A;  2QQS A;  2Q1D X;  5FTN A;  3FPR A;  2Q1C X;  5EPP A;  3ZJU A;  2GF7 A;  3HU2 A;  4RV0 A;  4KO8 A;  3QQ7 A;  4CQN A;  1QDN A;  5D6W A;  5FTJ A;  2Q18 X;  4AS1 A;  3QC8 A;  3FPT A;  1I9G A;  5GLF A;  5C1B A;  3ZJT A;  2KY9 A;  1QCS A;  3ZGZ A;  5CCX A;  3BQB A;  4KOD A;  4ARC A;  3QWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...