2LW6A

Solution structure of an avirulence protein avrpiz-t from pathogen magnaportheoryzae
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
b'SFVQCNHHLLYNGRHWGTIRKKAGWAVRFYEEKPGQPKRLVAICKNASPVHCNYLKCTNLAAGFSAGTSTDVLSSGTVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvrPiz-t protein
publication title Solution structure of the Magnaporthe oryzae avirulence protein AvrPiz-t.
pubmed doi rcsb
source organism Magnaporthe oryzae
molecule tags Apoptosis
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.80 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2lw6A00
2LW6A
chains in the Genus database with same CATH superfamily
5D6YA 4KODA 4AQ7A 3ZJUA 4KO8A 3HU2A 2YVLA 5GLFA 2Q1CX 5FTKA 3HU3A 5DYIA 1S3SA 1QCSA 3ZJTA 1ZC1A 2GF7A 1WLFA 1CZ4A 3QQ8A 3TIWA 5EPPA 2Q1DX 2XDPA 4KLNA 2B25A 1R7RA 4UC4A 1O54A 3FPUA 5EQJB 2GFAA 1E32A 5ERGB 5FTMA 2MM2A 3FPRA 5B6CA 5CCBA 2QQSA 3MB5A 4KDLA 3ZJVA 4ARIA 5C18A 5FTNA 1QDNA 3HU1A 3QC8A 3QQ7A 2PWYA 4AS1A 5C1BA 2Q18X 5FTJA 5D6WA 4RV0A 2KY9A 3ZGZA 3QWZA 4FIBA 5CCXA 2YUJA 3CF2A 2Q19X 1I9GA 5CD1A 3BQBA 3LHDA 5FTLA 2PJHB 3LGAA 2LW6A 4KDIA 3FPTA 4ARCA 2JV2A 1CZ5A 2MM0A 2Q1AX 4CQNA 5D6XA 5DYGA 2QQRA 1CR5A
chains in the Genus database with same CATH topology
5D6YA 4KODA 4AQ7A 3ZJUA 4KO8A 3HU2A 2YVLA 5GLFA 2Q1CX 5FTKA 3HU3A 5DYIA 1S3SA 1QCSA 3ZJTA 1ZC1A 2GF7A 1WLFA 1CZ4A 3QQ8A 3TIWA 5EPPA 2Q1DX 2XDPA 4KLNA 2B25A 1R7RA 4UC4A 1O54A 3FPUA 5EQJB 2GFAA 1E32A 5ERGB 5FTMA 2MM2A 3FPRA 5B6CA 5CCBA 2QQSA 3MB5A 4KDLA 3ZJVA 4ARIA 5C18A 5FTNA 1QDNA 3HU1A 3QC8A 3QQ7A 2PWYA 4AS1A 5C1BA 2Q18X 5FTJA 5D6WA 4RV0A 2KY9A 3ZGZA 3QWZA 4FIBA 5CCXA 2YUJA 3CF2A 2Q19X 1I9GA 5CD1A 3BQBA 3LHDA 5FTLA 2PJHB 3LGAA 2LW6A 4KDIA 3FPTA 4ARCA 2JV2A 1CZ5A 2MM0A 2Q1AX 4CQNA 5D6XA 5DYGA 2QQRA 1CR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW6 A; 
#chains in the Genus database with same CATH topology
 5D6Y A;  4KOD A;  4AQ7 A;  3ZJU A;  4KO8 A;  3HU2 A;  2YVL A;  5GLF A;  2Q1C X;  5FTK A;  3HU3 A;  5DYI A;  1S3S A;  1QCS A;  3ZJT A;  1ZC1 A;  2GF7 A;  1WLF A;  1CZ4 A;  3QQ8 A;  3TIW A;  5EPP A;  2Q1D X;  2XDP A;  4KLN A;  2B25 A;  1R7R A;  4UC4 A;  1O54 A;  3FPU A;  5EQJ B;  2GFA A;  1E32 A;  5ERG B;  5FTM A;  2MM2 A;  3FPR A;  5B6C A;  5CCB A;  2QQS A;  3MB5 A;  4KDL A;  3ZJV A;  4ARI A;  5C18 A;  5FTN A;  1QDN A;  3HU1 A;  3QC8 A;  3QQ7 A;  2PWY A;  4AS1 A;  5C1B A;  2Q18 X;  5FTJ A;  5D6W A;  4RV0 A;  2KY9 A;  3ZGZ A;  3QWZ A;  4FIB A;  5CCX A;  2YUJ A;  3CF2 A;  2Q19 X;  1I9G A;  5CD1 A;  3BQB A;  3LHD A;  5FTL A;  2PJH B;  3LGA A;  2LW6 A;  4KDI A;  3FPT A;  4ARC A;  2JV2 A;  1CZ5 A;  2MM0 A;  2Q1A X;  4CQN A;  5D6X A;  5DYG A;  2QQR A;  1CR5 A; 
#chains in the Genus database with same CATH homology
 5D6Y A;  4KOD A;  4AQ7 A;  3ZJU A;  4KO8 A;  3HU2 A;  2YVL A;  5GLF A;  2Q1C X;  5FTK A;  3HU3 A;  5DYI A;  1S3S A;  1QCS A;  3ZJT A;  1ZC1 A;  2GF7 A;  1WLF A;  1CZ4 A;  3QQ8 A;  3TIW A;  5EPP A;  2Q1D X;  2XDP A;  4KLN A;  2B25 A;  1R7R A;  4UC4 A;  1O54 A;  3FPU A;  5EQJ B;  2GFA A;  1E32 A;  5ERG B;  5FTM A;  2MM2 A;  3FPR A;  5B6C A;  5CCB A;  2QQS A;  3MB5 A;  4KDL A;  3ZJV A;  4ARI A;  5C18 A;  5FTN A;  1QDN A;  3HU1 A;  3QC8 A;  3QQ7 A;  2PWY A;  4AS1 A;  5C1B A;  2Q18 X;  5FTJ A;  5D6W A;  4RV0 A;  2KY9 A;  3ZGZ A;  3QWZ A;  4FIB A;  5CCX A;  2YUJ A;  3CF2 A;  2Q19 X;  1I9G A;  5CD1 A;  3BQB A;  3LHD A;  5FTL A;  2PJH B;  3LGA A;  2LW6 A;  4KDI A;  3FPT A;  4ARC A;  2JV2 A;  1CZ5 A;  2MM0 A;  2Q1A X;  4CQN A;  5D6X A;  5DYG A;  2QQR A;  1CR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...