2KY9A

Solution nmr structure of ydhk c-terminal domain from b.subtilis, northeast structural genomics consortium target target sr518
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
b'MKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMVDYTSTTSGEKVKNHKWVTEDELSAKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ydhK
publication title Solution NMR Structure of ydhK C-terminal Domain from B.subtilis, Northeast Structural Genomics Consortium Target Target SR518
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 26
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1130 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ky9A01
3.10.330.60 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2ky9A02
2KY9A 4FIBA
chains in the Genus database with same CATH superfamily
1UB4A 4GLKA 4Y91A 2HEQA 1WHLA 1X6GA 3THKA 2GFUA 4RTTA 1G3WA 1S72Q 4D6WA 4EMKB 1IO6A 2WACA 2CZ1B 1GBQA 2OTJQ 2VKNA 1MMNA 2FYKA 3VRZA 1YJWQ 1QVGA 2HQHA 1M1FA 5GMKh 2MK5A 2NUTA 2LNVA 4X9DA 5GAMd 4QT7A 2CP7A 4M77C 2L8DA 2M16A 1VOMA 1LCKA 4OMMA 1GCQC 4M78F 3RKYA 4B9WA 2VB6A 4ESRA 4DQ2A 4KDLA 3OYEA 1NEGA 3OYNA 2GGRA 3PVLA 5DYIA 5A0DA 1NJIC 1IB8A 5IT9E 3V7CA 1EFNA 4CI0C 2DERA 2CDTA 2DX1A 3M58A 3QIIA 4F7UB 4C92D 2EQMA 3JCMg 4JJCA 4ZGEB 1D09B 3U23A 4M75G 1S72T 5ERGB 3AT1B 1SSFA 3OYYA 3E1SA 2DIQA 2E41A 4M7AG 2DFUA 3JB9G 2QQSA 2JOYA 2V8KA 4C8QB 2DJZA 2DXTA 2OTJT 5CIUA 1NJIR 1BIAA 2YLBA 1IGQA 2DXUA 1D0YA 1YJWT 2I0NA 2GQVA 3MCAB 2DJQA 3M4GA 2DA9A 5FWCA 3NPFA 3CC2Q 1RADB 3TVTA 2EJFA 3NFCA 4KUIA 3JCMV 4R0KA 4J6WA 4XTVA 2RF0A 3DB3A 1YI2A 2OTLA 1BKBA 4NOYA 3KFVA 4OB1B 4A4KA 2K9GA 1MNDA 3OBWA 2F69A 3UA7A 1UGQB 3JB9H 1SHFA 1JJ2A 4F7UG 1HYOA 2BIVA 2RHYA 1KSWA 5IXBA 1W70A 2EQIA 1PRLC 1TWBA 4ZN3A 1UGRB 1GBRA 1D1BA 3QKJA 5KYYB 1AEYA 1M5Q1 2MOXA 5KYXB 2Q1DX 4HVUA 2YRCA 2VYTA 2O4XA 2J7IA 1IRXA 4KGZB 2OAUA 2V1QA 1QWFA 4IUQA 1PD1A 2QA4A 2KK4A 3MEUA 1NEBA 3CC7A 2COYA 3G4SQ 1RAEB 2EYZA 4FW1A 5A0GA 3BFMA 2YWWA 1NE8A 4BY6B 2LQKA 1Q7YR 1MV3A 4M75E 2F1LA 1NYFA 4C5GA 4M7AE 2EAYA 3L2QA 1YJNQ 1VUBA 1N27A 4YTLA 4MDXA 2RJFA 3TIWA 2PVDB 2HQXA 4M7DF 1TOVA 3PTAA 4R55A 3CCEA 3CD6A 5GAOq 5LJ3f 1YBYA 4XTUA 3CMAA 1CR5A 3MJXA 1QWEA 2ZAEA 4DBQA 1NJIU 3FIFA 1KHCA 2KXDA 1VYVA 5LJ3j 2DBMA 2DTHA 1M1KC 3JB9I 2O9SA 1WHMA 2OTLT 4RTZA 1G83A 3GP8A 3VS7A 4E7SA 3CCRQ 3M0RA 2Q1CX 3LYIA 4FSXA 2QDYB 3TU4K 2MM0A 2RK2A 3UWNA 5GANf 4EPCA 3CMAQ 1WHJA 3EH2A 2E65A 2O01E 3X24B 3OSSC 1WA7A 1G5VA 4HT9A 3NTIA 4DOVA 4F7UE 1SF9A 2Z0WA 4KGXB 5GANj 1I4K1 4M77B 3NTKA 3OS0A 5GAN5 1PWTA 5LL6S 3CMEQ 2YUJA 1YJNT 3I56A 1FMVA 3EGDA 1KD1R 3CPFA 1I5LA 2M9UA 2K5FA 3TCJA 3VS0A 3C4SA 1OU8A 4JJDA 1OOTA 4RTXA 1I81A 2DLPA 3L2UA 1UUEA 2QA4T 1HSQA 4BI3A 3A8LB 4C92C 3CC7T 4JS5A 1LNXA 5EQJB 2I2LA 5GAN2 2LCCA 2RHUA 2DL5A 1X69A 2MPXC 3KUFA 3A1PA 3I56Q 3CCRT 1HXDA 4J7FA 1OQKA 3TQ7P 1Q7YU 2R57A 1I07A 2YRDA 2K2MA 3CMAT 2RQRA 1E32A 2K79A 4C8QD 4FSSA 1SSHA 4D8KA 3EFOB 3OS1A 2B25A 4F04B 4N4HA 2VUBA 4F17A 4KO8A 1VQ4Q 1VIEA 3I9QA 2B8AA 4E7HA 1MV0B 3SB2A 5HK3A 4M77G 5I21A 5GAN7 2VGNA 5KYWA 2OJ2A 2QAZA 1KG1A 1XOVA 5GAN4 5GANh 1V29B 1TUCA 1UDLA 1UJ0A 2JT4A 3M0UA 3CC4Q 4DBRA 4BI8B 1WJRA 1NG2A 4PK4A 2C06A 2CH4A 5EC7A 3R6NA 4FCYA 2P0QA 2YHTA 3JB9J 2DPPB 3GNGA 1UECA 1D1CA 4MMLA 1YITA 3QSUA 3UDCA 3RR6A 4P5NA 4ANJA 3I56T 1ZSZC 1X27A 3EG0A 2ESWA 3DLMA 4LUDA 5C18A 1M4ZA 5CAIA 1M1KU 1BBZA 3OYGA 4N0AA 3HU2A 1H8KA 2PUOB 2K3XA 1KD1U 4LNPA 5FW9A 2QYZA 1TH7A 2GFAA 1N6AA 2CSIA 3LH0A 3LGAA 3OA6A 1CKAA 3QC8A 2HKNA 1N5ZA 2JNGA 1YITQ 2JM9A 1WX6A 2O88A 5FTNA 2XICA 4XTXA 1VQMA 1JEGA 4XK8E 1WGSA 3KBGA 3WXMB 1K9AA 1M2VB 2KNBB 2JMCA 3CBPA 3FPTA 4OB3B 1VQ7A 2ZPBB 4M75A 1ACMB 3ULRB 6AT1B 3CC4T 2DVJA 1Y0MA 3V8LA 4PJOF 4M7AA 1XNIA 4O5VA 2RQVA 3H0HA 3G6EA 1MUZA 2D1XA 5M9OA 4HT8A 1CZ4A 2EGAA 3ZJTA 1VQMQ 4OB2B 3V8KA 3QPHA 3LWHA 1KQ2A 4XU3A 3I35A 4QVZA 3CXCA 5LJ5e 3EG2A 3QYGB 3M0QA 1J3TA 4EMKC 3C12A 4JZ4A 3QG1A 3EGUA 3L1AA 2MF2A 3META 3ER0A 2DRMA 3FDRA 1X01A 2D0QB 4OB0B 2RHXA 4MZMA 2X35A 1R0CB 2DAQA 1YITT 3ZEHA 2E10A 2X4YA 2RQTA 2LCSA 1CSKA 3LLRA 8ATCB 1C6VX 3FJ5A 3WVEB 3CCUQ 4JUVA 1QKXA 1ZLMA 3EG9A 3HTRA 3MPUB 2JS2A 1WZOA 2EYYA 2DL3A 5DYGA 5KYUB 2VXEA 3A8HB 4NS5A 1M90R 3QUIA 2L3RA 1VQMT 2RI5A 4CRIA 2P0PA 2XDPA 1FMWA 2DYIA 3QQ8A 4HCZA 1VQNA 3HPWA 4DOWA 1VQOA 2FZGB 5CKFA 3VUZA 1JB0E 3DKMA 4ATOA 4C8QC 1M3CA 2X4XA 3CCQA 4RCBA 1FMKA 3PMTA 4JPBW 4AFSC 5LJ5g 3L2RA 4C0GA 2HQEA 4C92F 2IVWA 2ROLA 2QI2A 1OX8A 2YUPA 4X1VA 1WFWA 2CP3A 1JXOA 2A37A 3KXTA 1VQNQ 3CCUT 1W2BS 1RI0A 5KCHA 1WHKA 4OF1A 4RTUA 5I11A 1HD3A 1OX9A 3CCQQ 1QCFA 5AT1B 1W6XA 4JRPA 3X25B 4PJOE 2KVQG 4M7DA 1M2OA 1AHJB 4C92G 1N9SA 5KYYA 4V2SA 1K73R 1QVFS 1AWXA 2JZ2A 4M4ZA 1OPLA 5J39A 3OYJA 3LX7A 1ZSZB 2WSEE 2GCXA 4DA4A 4L6V5 4OMNA 4A4EA 4J9HA 4C0FA 2K7AA 2RQWA 2J6KA 1JRIA 5GAMe 1DJ7B 2QTVA 3INZA 5CD1A 3HL8A 1X2KA 3CPWS 2AKKA 4AG1C 2RO0A 3ZBDA 1ABOA 2O31A 5KH6A 4R56A 1M27C 2MIOA 4BY6C 1VQNT 3HP9A 3S3MA 2H3JA 4IUPA 2DZCA 4J6XA 1M3BA 4KT0E 1VQPQ 4E2FB 3JCMe 4PLLA 5GAN8 3GLXA 3CCQT 2X9HA 3EGXB 5LJ3d 1SRMA 4J9FA 2FG0A 4DBFA 1Z9QA 2DRKA 3R6OA 1T0JA 3JCMb 2JN0A 1E6HA 1VQ6A 1JBMA 1RAAB 1VQLA 3MB5A 1GCPA 1AWJA 2B86A 4E7JA 1SEMA 2P4TA 2IPOB 4XTZA 2NUPA 1C1AA 1H3ZA 2KAFA 1M8MA 4LD9K 4IKFA 3FPRA 4AS1A 2COZA 1VYTA 4LXCA 4L5GA 1SPKA 2XHCA 4LE9A 2DL8A 3ZFJA 2CREA 5GANd 2LT4A 3OQ5A 1G2BA 1GCQA 3CPWP 1PRMC 1VQ6Q 5KCOA 4C92E 3S3OA 1VQLQ 4LDVA 4M78B 2E6ZA 2O9VA 3VYHB 4BDZA 1O75A 2JM8A 5GLFA 2ZCFB 2J06A 1Z9ZA 3VV0A 5GAMg 2RNAA 3G71Q 1K73U 2DILA 3C95A 4M75F 2JJ9A 4WCIA 2NUZA 1GXIE 1V1CA 4M7AF 1WQ7A 3JB9F 3WVDB 3F70A 4IUUA 3VS5A 4JJBA 3RMQA 2LW6A 3N5BB 2M0YA 2V26A 3VU3C 1H92A 5GAOl 3CC2A 3OYCA 2JMAA 3MEVA 4FM4B 2K3YA 4X9CA 5AYFA 1B34B 1SG5A 1VQ9A 2G6FX 1ZUKA 2LJ0A 2JXBA 5DLOA 5GJWB 2D8JA 2HBWA 2ZZDA 3G1JA 1HJDA 4XTWA 2PQWA 2YLCA 2EJ9A 1UGSB 3GPLA 3H9NA 4AT1B 5GAOr 2DYBA 1CZ5A 1VQ6T 2L0AA 3H41A 1VQLT 1M3AA 2HL5C 4BE1A 2DTOA 2RM4A 1F1BB 4JRKA 4F7UF 2FPDA 3G71T 4UC4A 1RAGB 3CQTA 3UT1A 3ZGZA 1B3QA 1VQ9Q 2G3RA 1ZX6A 2HDAA 2F5KA 5C1BA 2HD0A 3JCMP 4C8QF 4PL6A 2Y4YA 3OY9A 1IZ6A 3JAME 1W2BA 4Z8AA 4KLNA 2BZ8A 1PSFA 5ECAA 3G4SA 4PJOA 1RL2A 2HL3A 2EWNA 2EKHA 1YFNA 3VS4A 2LTOA 1Q7YC 2YT6A 3RNJA 5C6SA 3OYKA 4PFZA 4IUTA 1JXMA 1QVFA 5CQYA 1YJNA 4C8QG 5I22A 2K6DA 2NLUA 3EG3A 2AKLA 3ASKA 2KROA 2PZ1A 1SKUB 1GFCA 4Z89A 4J83A 3CC2T 3SWNB 2X3XD 3I5RA 1VQ9T 4II1A 3BQBA 3FJPA 1IHVA 2A7YA 1KQSP 1TUGB 2RI2A 5L23A 4DBHA 2M51A 2DE0X 3CCRA 3L2ZA 5GAOp 3G7ZA 4XU1A 2LC4A 1BI3A 2YUQA 1Q86R 2VASA 5GMKl 4MDWA 5CKBA 5FU7B 4JLGA 1KIKA 2DVEA 2VWFA 2KYBA 2Q18X 1N8RC 1WJSA 2DETA 3V8JA 4RV0A 1VQ8A 2A0FB 3O5ZA 1WYXA 5A2QE 1G3TA 5CVIA 5FU6B 3CMEA 3JCMJ 3GNFB 4OMQA 1KD1C 2EKOA 2F5TX 3P8DA 4J9DA 1AD5A 2ENMA 2EGEA 4Z88A 5CK9A 2BZYA 2CP5A 4PFPA 3VS1A 3G4ST 3RESA 1N8RR 2W10A 3HSBA 2H8HA 4LDWA 1VQ8Q 5IN1A 4M78D 1TS9A 4C92A 4ZGJB 4Y28E 1ZUYA 2RJCA 4PLIA 2Y4XA 2QQBA 3QYHB 3LW5E 4OGCA 4C8QE 5GMKe 4JLIA 4C0DC 1FYNA 5FTMA 4QQ6A 1TUDA 3CEYA 1TSFA 1VQ4A 2KT8A 3SEMA 5CCXA 2PNIA 2LX7A 2EJGA 4LD6A 3QXEB 1BYMA 3ME9A 1PHTA 1Y96A 2NUTB 4FYXB 4E7KA 4LN2A 4M77F 3E9FA 2FZCB 1VQ5A 2RJDA 2F2VA 2GF7A 5LJ3h 3QHSA 4AG2C 3REBB 3C94A 5GMKm 1GFDA 3OMCA 2Q1AX 3CC4A 2J05A 2BE9B 2XK0A 4OGEA 2YUNA 1Q86U 3JCMQ 1VQ8T 3GF5A 4BE2A 1NPPA 1AZEA 2HCKA 2CS7A 2L5QA 4AFQC 2HNIA 3PNWC 1R0BG 3CMET 3NTHA 4AFUC 4XU2A 1VQ5Q 1ZHIA 1U5SA 4ELZC 4HCKA 1YHQQ 1IREB 2KQWA 3V7RA 4XQ3A 3SFMA 3RUXA 3PT9A 4GLMA 1BCOA 3LGFA 2RA2A 2EGCA 1PG5B 1MMGA 5C0MA 4ZGDB 7AT1B 2RH2A 3OW2S 2KBTA 1QCNA 1U8RA 1WDXA 4E7LA 3JCMW 2DL7A 1MGQA 2VXFA 2DMOA 1BU1A 1OZ3A 3NGPA 4J9GA 1N8RU 2XKOC 1AT1B 2RHZA 4WF2A 1D3BA 2YSQA 4KULA 3CBMA 1EZZB 1YCYA 1ZBXA 2KT1A 2C0IA 2CUBA 1VQ4T 2H3EB 4VUBA 2QASA 1B7TA 5GMKi 2LQ8A 2LT1A 4PJNA 4X34A 4QVDA 1BIBA 2KGTA 2VC8A 1NBEB 3EGXA 1M30A 2L3PA 4B6MA 4M7DD 1VQ5T 3I55Q 4KRTA 3DLLA 2KRNA 4A63B 5A0LA 2FRWA 4J9IA 1YHQT 1G8XA 4RKUE 4JRIA 4HCCA 4O6JA 1FXXA 2E1HA 1QMCA 4EMKA 3OBYA 1LPLA 3IQLA 3NHNA 2O4XB 2LX9A 4JDSA 2NYSA 1QP2A 3M56A 1WIEA 4MMKA 1EX4A 4NL2A 2WSFE 3OW2P 3QJYA 2KR3A 1Q81R 1UGPB 2ZPFB 1TXQA 2MWOA 4GBQA 4C5IA 5IHKA 3H0IA 2OX7A 3M0TA 4M77E 2HAXA 3CCUA 4FL6A 3NMZC 3SD4A 1YP5A 1QLYA 2QTXA 3VJPA 2AK5A 2DO3A 1KFZA 2EBPA 1Y71A 3X28B 3HFOA 3CCJQ 2DKGA 1LJOA 2CP0A 4J6YA 2DXCA 3HHTB 2E6NA 4PKCC 4M78C 4TVRA 3CCLA 4J5YA 1SRLA 1M90C 1QVGS 2X4JA 2K5LA 2E64A 2LZ6B 3I55T 1WXBA 5L8RE 4F7UA 2ECZA 2ZGWA 2LRQA 4JJNK 2KRMA 3M55A 3LHDA 2MYSA 3OS2A 4C0DB 2P84A 1K4US 1JQQA 4FYVB 4C8QA 3CCLQ 5HKCA 1Y07A 4BD3A 3VS3A 4XTYA 1PM3A 4EMGA 3QWYA 1YIJA 1YJ9A 1WLFA 2P0KA 1Y57A 2X4WA 3FPUA 2A28A 1UE9A 2JTMA 1RI9A 2DZ9A 2RMOA 2F2XA 2M02A 1BI2A 2SRCA 4KGVB 3MEAA 3P8BB 2R5MA 4EDUA 1C0MA 3M57A 2Q19X 2X51A 4OMFB 3QWZA 1MHNA 1RACB 2O2OA 3MP1A 2JW4A 3ZJVA 3VS2A 1P92A 2KYMA 2EPDA 1YCSB 1ZA1B 3OYMA 4BUGA 1PD0A 1K73C 4HVWA 2ZPHB 3BDLA 2DK3A 3EG1A 1YIJQ 1YJ9Q 2A3LA 4WTOB 1QVGP 2MMPA 4QKUA 1UGVA 1NLPC 4BI4A 1K8AR 4JS4A 2KEAA 1KQ1A 3CF2A 2M1HA 2LCLA 1Q81U 1Q82R 1OULA 4IUVA 1VQKA 1QDNA 3TSWA 2BZXA 2HMAA 4Z02A 2OI3A 4L59A 2KI7A 4XU0A 1RUWA 4CC3A 2FHDA 3CCLT 5KYXA 2QG9B 3M53A 3M4YA 4KODA 4KH0B 1NLOC 3CCSA 3HU1A 1JJ2S 5GANe 2LQWA 3UATA 2XG8D 2DM1A 5CKHA 3RMSA 3VYGA 1VQPA 1RAIB 1VQKQ 4K11A 1OI1A 2P4RA 3OYBA 2A36A 1PNJA 2CZ0B 3MHXA 5KYWB 1BI0A 2XDBA 4EMHA 3QDRB 2CT4A 2DEUA 3RKWA 1YIJT 1YJ9T 2HSEB 3CCSQ 3SWNC 1I8FA 2D9TA 2LJ1A 4MZPA 4M7DC 4ZTJA 5I2MA 1U06A 1K0XA 3GOXA 5CO7A 1M90U 4D8DA 3QZ5B 2SEMA 5IXFA 2QEXA 1X43A 1QW1A 3PE0A 4F14A 2JTFA 2QGGA 3M0PA 2EQKA 3SDZA 5LJ3g 4E6RA 1EIFA 3D7SB 5FU7C 5I2SA 2JS0A 2QQ9A 2V1RA 3JRZA 5D6XA 2E5KA 2EYQA 4LDYA 2RQUA 1JJ2P 3G71A 1IGUA 1KJWA 1SHGA 2QEXQ 4JRQA 1YWPA 1VQKT 5FU6C 1QCSA 4HKEA 4F16A 5DM7R 4ARCA 3A5ZB 4M77A 2BKDN 1KC8R 3REAB 5GANg 1Q82U 4HXJA 2AZSA 3UF4A 4M75B 2DF6A 2BE7D 5HY6A 2RPNA 3CCST 4M7AB 1PKSA 2ROTA 4FIBA 3L2WA 3AHUA 4OVAA 2A08A 3M5AA 3CCMA 1VQPT 3TEEA 5FRNA 1T0HA 3OYFA 4RUGA 4IURA 1UFFA 3MO8A 1X75C 3QWXX 5HK0A 3DB4A 2JUFA 1AZGB 2HBPA 4RTWA 3OYDA 2XMFA 1XTDA 5CQXA 2LMJA 2CUDA 2KRSA 1M9SA 1B07A 1BI1A 4FT4A 1X2QA 1TG0A 2QEXT 3EFOA 4DEYA 4Y92A 1W4SA 3CCMQ 2ED1A 2L3QA 2WSCE 5GJVB 4HCBA 1JU5C 2K57A 1WJQA 2EW3A 1OU9A 2K3BA 1R8OB 3JCMd 5FLXE 2C0OA 2EQUA 2MM2A 2OAWA 3L42A 3EG9B 2PTKA 1M8VA 1JO8A 1ZUUA 4ZNXA 5GAN3 4M78G 4RG2A 1YNZA 8AT1B 3FLGA 4IIOA 1K0SA 3LH5A 5FWBA 4PJMA 1UEBA 2ED0A 3L2VA 1I9GA 1KQSS 2LJ3A 5LJ5f 1XJWB 4PNOA 4ME7A 2COWA 2RK1A 3VRYA 2XD0A 3BW1A 4N4IA 5GAOn 2W0ZA 3MKDA 2PU9B 1QKWA 2F2WA 5LJ5j 2GBQA 1KC8U 1YN8A 1E6GA 3S6WA 1ZA2B 2RJEA 2XDDA 3CCMT 4PJJA 1UTIA 3OYLA 3FC3A 4CQNA 1WXUA 2DD4A 4Q5WA 3P8HA 2XIDA 4A4HA 4B9XA 2JV2A 1Q86C 1M2VA 3FB9A 4NL3A 1D0XA 3HRUA 1ZSGA 1FX7A 2KY9A 5GAOm 5B6CA 3BY7A 2RD1A 2J6FA 4M7DB 3TSZA 1YI2Q 1PCXA 4AFZC 4J8OA 2OTLQ 3OMGA 4ARIA 1NM7A 4RTVA 3CPWA 4PJOC 2CKKA 2EIFA 1U1TA 2KDSA 1I5OB 1NZ9A 2GNCA 1QVPA 5CCAA 2L89A 1GL5A 3LWIA 2LP5A 2J6OA 3A8MB 2D6FA 4QW2A 3EFSA 2K4YA 1W1FA 3RERA 2FL7A 2DXBA 4FYWB 3UPUA 2V8IA 2YDLA 4M78E 1WQWA 2BTTA 1RAHB 5LJ5h 1R7RA 3HU3A 2LNHB 3CXCS 2QA4Q 2CGHA 2E70A 2VGMA 2M0OA 3CC7Q 4OMLA 2K2VA 3QDFA 4J9BA 5FROA 2D0NA 2FZKB 1D0ZA 2CZ6B 3M54A 3RKXA 1YI2T 5J26A 4M75D 1OV3A 2YRVA 4ORZA 4M7DG 1HK9A 2FB7A 3JSCA 2EVRA 5KYUA 4M7AD 2FPFA 3CCEQ 3CD6Q 4OMOA 3JB9D 3JV3A 2JTEA 3H0FA 2ZPIB 3RIRA 4OMPA 1UHCA 3JCMc 2NUPB 4CC4B 2E3HA 1CKBA 4BE0A 3VS6A 4QVCA 4HA8A 5GAMf 4BACA 1AWWA 4ZTFA 1M1KR 1E7OA 1S1NA 1T3LA 4J9EA 2MCNA 2QQRA 4E7ZA 2ZPEB 4FU6A 1WHGA 1N9RA 2YVLA 5EG2A 5GAMj 1VA7A 3CCVA 1H641 2EYWA 3CXCP 2QK0A 1YHQA 2NWMA 2CYZB 2KXCA 2DIGA 3JCMf 3SHWA 2YXYA 3PIPA 1X6BA 2MAMA 1I0CA 2D8HA 2XI9A 3FEOA 1U3OA 3EAEA 1MMDA 4A54A 3PMIA 2GQIA 1VYUA 1QP3A 3E2UA 3CCET 3CD6T 4LDUA 1WNLA 3CCVQ 2EQJA 1PKTA 2KSSA 3UA6A 3J80E 1R77A 3OSVA 2RHIA 3OB9A 3OYHA 3PVQA 4LUEA 3HKSA 1ZSZA 2FEIA 2YUOA 1RLQC 3PFSA 4XAXB 1KQSA 1U1SA 2Y90A 1K9MC 1X6OA 1ZQ1A 4DEXA 2X3WD 4CC7A 3MP8A 4ZN1A 2HZYA 1O9SA 4RMOA 4M7DE 1OZ2A 1UHFA 4HVVA 3QO3A 1FWZA 1BB9A 4QQGA 2HSPA 2L2PA 3I55A 2R58A 2FO0A 4IIMA 1KHIA 2DEQA 1GRIA 4C5HA 1OPKA 1OYXA 1K76A 1TU0B 2RI3A 5GAMh 3BE3A 3H6ZA 3H8ZA 3ZL7C 3QQ7A 1PSEA 4MZTA 1K9MR 2HKQB 2DTIA 2EFIA 4E47A 5CR2A 1Q81C 3CCVT 1D1AA 4PJOB 3HRTA 3JCMh 2AHJB 3O8VA 1IXDA 1YWOA 3CBOA 2VVKA 3JCMX 1QCOA 1S3SA 1RLPC 4J7IA 1RABB 5IHNA 2PWYA 2IG0A 2E12A 4N0AC 2FPEA 3CCJA 1O54A 3EHQA 4AMCA 2RB6A 2FRYA 3EH1A 4QQDA 4A4GA 2ZPGB 4M78A 5DLQE 3OS5A 5HCKA 2DNUA 2LDMA 1WHHA 1AWOA 1Q95G 3MEWA 4FYYB 2KMTA 2CH4W 5CKEA 1BK2A 3LGLA 5FTKA 2CT3A 3FRNA 2GTOA 4M75C 2AT1B 4GY5A 4M7AC 2L3SA 1KK7A 1I1JA 1VQ7Q 2PUKB 1MNEA 4PJOG 1UG1A 4N4GA 3S3NA 3QBYA 3X26B 1VIFA 3J7AF 3G6EQ 3VKIA 5KE2A 1ZC1A 2R5AA 1H3HA 4FW2A 1B34A 4AQ7A 3GBQA 1QQJA 5DY9A 1ARKA 1LOJA 3C0CA 1NYGA 1TTHB 2CP2A 2CP6A 2JVVA 4M77D 3QJ6A 1K9MU 3E19A 3V7SA 1K8AC 3QZ9B 4C92B 3TREA 1Q82C 2MWPA 3M9QA 1WXTA 3RDVA 3EGDB 4LDXA 1NPRA 1OEBA 3CCJT 2GTJA 4KBMB 4FT2A 3J81E 2KE9A 2LVMA 2EYXA 2QQAA 5KYNA 2E5QA 4CC2A 3PIOA 1VQ7T 3GIBA 5LJ3e 3RBBB 5GAN6 2LQNA 5LJ5d 1Y96B 5D7UA 3G6ET 2QGFB 3URGA 4KDIA 2V8JA 1ZBJA 1V76A 4BDYA 2BUDA 5FTJA 1VQOQ 5CCBA 2ATCB 1LVKA 1PC0A 5IHIA 4KH1B 3MP6A 2E3IA 3OYIA 3M59A 4C0ZA 5IH2A 5FTLA 4J9CA 2E4HA 2DBKA 2DD5A 1UJYA 4A4FA 9ATCB 2RN8A 4RCCA 3SWNA 5IAYA 2FVUA 1Y7XA 4A53A 3OW2A 4PJLA 4KUDK 1M1GA 1RAFB 1IHWA 5D6WA 1WPYA 2AIRB 2MI6A 4C5EA 2PJHB 1WLPB 1G3YA 1AOJA 2CZ7B 2XU8A 4E7IA 4EIKA 3HFNA 5CKDA 1G3SA 1A0NB 5D6YA 3I5SA 1MMAA 1ABQA 2PVGB 2CSQA 5GMKj 4ELYC 3E9GA 4RG8A 5J3BA 1BCMA 4PJOD 3A8GB 2PVOB 3OYAA 3PGGA 1D3BB 3VUBA 5EPPA 3A8OB 3M0SA 3BDUA 1KC8C 5KE3A 1K1ZA 1T3SA 5FRMA 2C0TA 2K5IA 3EFRA 1VQOT 1S72A 3HRSA 1W2BP 1AVZC 3X20B 3A98A 2QXFA 2AZVA 2OTJA 3ZJUA 3Q1JA 4OP0A 4BB7A 1XQHA 3EHRA 3T9NA 2VV5A 4PFOA 1WI7A 1K8AU 1YJWA 2QDLA 1QVFP 4JZ3A 2ABLA 2DL4A 4RTYA 2IIMA
chains in the Genus database with same CATH topology
1UB4A 4GLKA 4Y91A 4ELZC 4J8OA 5DYGA 2VXEA 3A8HB 3OMGA 4NS5A 2GFUA 1G3WA 1IREB 2KQWA 3V7RA 4ARIA 4XQ3A 3SFMA 3CPWA 3RUXA 4D6WA 3PT9A 4EMKB 4PJOC 2CKKA 3QUIA 2EIFA 2L3RA 3LGFA 1VQMT 2RI5A 2RA2A 2WACA 1U1TA 2KDSA 1NZ9A 2CZ1B 2P0PA 4CRIA 2XDPA 1QVPA 3QQ8A 5C0MA 5CCAA 4ZGDB 2L89A 2RH2A 4HCZA 3OW2S 1VQNA 3HPWA 2FYKA 3A8MB 4DOWA 3LWIA 1VQOA 1U8RA 2D6FA 5CKFA 3VUZA 1JB0E 3DKMA 4QW2A 4E7LA 3EFSA 3JCMW 4ATOA 2K4YA 1MGQA 2VXFA 1QVGA 4C8QC 3RERA 2FL7A 1M1FA 1OZ3A 5GMKh 2DXBA 2X4XA 3UPUA 1N8RU 2LNVA 2V8IA 4X9DA 3CCQA 4M78E 2XKOC 4WF2A 2RHZA 1D3BA 4RCBA 1WQWA 5GAMd 4KULA 3PMTA 3CBMA 5LJ5g 3L2RA 1YCYA 4C0GA 2HQEA 5LJ5h 4C92F 4M77C 1ZBXA 2L8DA 2M16A 1R7RA 3HU3A 2IVWA 4M78F 3RKYA 3CXCS 2QI2A 4B9WA 4DQ2A 1VQ4T 4KDLA 2CGHA 3OYEA 4VUBA 2E70A 5GMKi 2VGMA 2M0OA 3OYNA 2LQ8A 2LT1A 3KXTA 3CCUT 2K2VA 4X34A 4QVDA 1BIBA 1W2BS 5DYIA 5A0DA 1NJIC 5IT9E 5FROA 1RI0A 2VC8A 5KCHA 3V7CA 4OF1A 4CI0C 2CZ6B 3M58A 3QIIA 4M7DD 4F7UB 1VQ5T 3M54A 3RKXA 1YI2T 3DLLA 4JRPA 3X25B 4C92D 5A0LA 4PJOE 2EQMA 2KVQG 4M75D 5J26A 2YRVA 3JCMg 4M7DG 4ZGEB 1YHQT 4M7DA 1HK9A 2FB7A 1AHJB 3JSCA 1N9SA 4C92G 4V2SA 4M75G 4RKUE 1S72T 4M7AD 1QVFS 3JB9D 4JRIA 5ERGB 4HCCA 4O6JA 1SSFA 1FXXA 2JZ2A 2E1HA 2DIQA 2ZPIB 2E41A 3E1SA 3OYYA 3RIRA 4M7AG 4EMKA 3JB9G 2QQSA 3JCMc 5J39A 2JOYA 2V8KA 3OBYA 4C8QB 2DJZA 2DXTA 2OTJT 2O4XB 2LX9A 5CIUA 3OYJA 4JDSA 3LX7A 1BIAA 4BE0A 1QP2A 2WSEE 3M56A 4MMKA 2YLBA 4NL2A 2DXUA 2WSFE 4QVCA 3QJYA 2GCXA 4DA4A 4HA8A 4L6V5 5GAMf 4BACA 4ZTFA 1UGPB 2ZPFB 1YJWT 4A4EA 2MWOA 2GQVA 3MCAB 4C0FA 4C5IA 1JRIA 5GAMe 2QQRA 1DJ7B 3M4GA 4M77E 2HAXA 2ZPEB 3INZA 5CD1A 3HL8A 4FL6A 3SD4A 3CCUA 3CPWS 4FU6A 1N9RA 2QTXA 3VJPA 2RO0A 2DO3A 2YVLA 3ZBDA 5EG2A 5GAMj 1Y71A 2EJFA 3NFCA 4KUIA 3JCMV 3X28B 5KH6A 3CCVA 4R56A 4J6WA 1H641 4XTVA 3DB3A 1YI2A 3HFOA 2DKGA 1LJOA 1BKBA 4NOYA 4BY6C 2OTLA 4J6YA 1YHQA 4A4KA 2DXCA 3HHTB 3HP9A 4OB1B 2CYZB 3S3MA 2E6NA 2H3JA 2DIGA 4IUPA 3JCMf 4PKCC 4M78C 2DZCA 4TVRA 3CCLA 4J6XA 4J5YA 3PIPA 1M90C 1QVGS 2X4JA 4KT0E 2MAMA 2K5LA 2XI9A 3OBWA 2E64A 2F69A 4PLLA 3JCMe 5GAN8 3FEOA 3GLXA 1UGQB 3EAEA 3CCQT 3I55T 3JB9H 1JJ2A 5L8RE 5LJ3d 3PMIA 4A54A 4F7UG 4F7UA 1QP3A 4XU2A 2BIVA 2ZGWA 2RHYA 3R6OA 2LRQA 4JJNK 3CCET 3M55A 2JN0A 4LDUA 3JCMb 1WNLA 3OS2A 1VQ6A 3CD6T 2EQJA 1JBMA 4ZN3A 1VQLA 4C0DB 1UGRB 3MB5A 3QKJA 1M5Q1 2KSSA 4E7JA 3J80E 2Q1DX 2P4TA 3OSVA 2RHIA 3OB9A 4XTZA 3OYHA 2VYTA 4C8QA 5HKCA 1Y07A 2O4XA 4BD3A 3HKSA 4XTYA 4EMGA 1H3ZA 2KAFA 1YIJA 1YJ9A 4LD9K 2P0KA 4IKFA 2OAUA 1WLFA 3FPRA 2X4WA 3PFSA 4IUQA 3FPUA 4AS1A 2JTMA 4XAXB 2QA4A 2KK4A 2DZ9A 1KQSA 3MEUA 1K73C 4L5GA 2XHCA 3CC7A 1U1SA 2Y90A 3ZFJA 1K9MC 5GANd 1BI2A 2LT4A 1X6OA 3OQ5A 1ZQ1A 3MEAA 5A0GA 3P8BB 3BFMA 3MP8A 2R5MA 4ZN1A 1NE8A 4BY6B 2LQKA 4M7DE 1O9SA 4RMOA 5KCOA 1OZ2A 4EDUA 4C92E 3QO3A 3S3OA 4M75E 3M57A 4LDVA 1FWZA 4M78B 4OMFB 2E6ZA 4QQGA 2Q19X 3QWZA 3VYHB 3I55A 2R58A 1O75A 4C5GA 4BDZA 1MHNA 5GLFA 4M7AE 2EAYA 1KHIA 2ZCFB 1VUBA 1N27A 3MP1A 4YTLA 3L2QA 4MDXA 2RJFA 3VV0A 2PVDB 2HQXA 2DEQA 5GAMg 4M7DF 3PTAA 1K73U 3TIWA 1P92A 3ZJVA 4C5HA 3OYMA 2RI3A 1OYXA 3C95A 4M75F 4BUGA 5GAMh 4R55A 5GAOq 2ZPHB 3BDLA 5LJ3f 3CCEA 3CD6A 2DK3A 1YBYA 4XTUA 2A3LA 3H6ZA 3H8ZA 3CMAA 1GXIE 1CR5A 2MMPA 4M7AF 1WQ7A 3JB9F 3QQ7A 1PSEA 4MZTA 3WVDB 4BI4A 1NJIU 3F70A 4IUUA 2DTIA 4JS4A 3CF2A 1KQ1A 2M1HA 2LCLA 2EFIA 3RMQA 3FIFA 1KHCA 4E47A 1Q81U 2LW6A 5CR2A 1Q81C 4IUVA 5LJ3j 2DTHA 3N5BB 3CCVT 1M1KC 1VQKA 1QDNA 4PJOB 4Z02A 3JB9I 4L59A 2OTLT 3HRTA 4XU0A 3VU3C 3GP8A 5GAOl 3JCMh 3CC2A 2AHJB 3O8VA 3LYIA 4FSXA 3OYCA 2Q1CX 3CBOA 2FHDA 3CCLT 2QDYB 3MEVA 3JCMX 4FM4B 3TU4K 2MM0A 2K3YA 2RK2A 4X9CA 5AYFA 1B34B 1S3SA 3M53A 3M4YA 4J7IA 3UWNA 4EPCA 5GANf 1VQ9A 4KODA 2E65A 3CCSA 3HU1A 2O01E 1JJ2S 5DLOA 2IG0A 2E12A 4N0AC 2PWYA 3X24B 5GANe 2ZZDA 3CCJA 3OSSC 1O54A 2XG8D 2PQWA 4XTWA 1G5VA 4HT9A 2YLCA 3NTIA 2EJ9A 1UGSB 2RB6A 4DOVA 3GPLA 5GAOr 5CKHA 3RMSA 4F7UE 1CZ5A 3VYGA 1VQPA 1VQ6T 4QQDA 1OI1A 5GANj 3OYBA 1VQLT 1I4K1 4A4GA 4M77B 3NTKA 3OS0A 2ZPGB 2CZ0B 3MHXA 4BE1A 5GAN5 2DTOA 2RM4A 5LL6S 1BI0A 4M78A 5DLQE 1YJNT 4EMHA 2XDBA 2YUJA 3I56A 3OS5A 4JRKA 4F7UF 3CPFA 1I5LA 2M9UA 3G71T 4UC4A 2K5FA 2LDMA 3TCJA 3QDRB 3ZGZA 3UT1A 3C4SA 3MEWA 3RKWA 2G3RA 1YIJT 2KMTA 1I81A 1YJ9T 3L2UA 2F5KA 5CKEA 3SWNC 1I8FA 2D9TA 3LGLA 4MZPA 2QA4T 4M7DC 5FTKA 5C1BA 4BI3A 4ZTJA 3A8LB 5I2MA 4C92C 4JS5A 1LNXA 3CC7T 3FRNA 4M75C 5EQJB 2I2LA 5GAN2 3GOXA 2HD0A 5CO7A 3JCMP 1M90U 3QZ5B 4C8QF 4PL6A 4GY5A 2LCCA 2Y4YA 2QEXA 4M7AC 3OY9A 2RHUA 1IZ6A 1QW1A 3JAME 1W2BA 4KLNA 2PUKB 2JTFA 3KUFA 4PJOG 1PSFA 3G4SA 4PJOA 4N4GA 3S3NA 1RL2A 2EQKA 3SDZA 3CCRT 3QBYA 5LJ3g 3X26B 2EWNA 1HXDA 4J7FA 1EIFA 1Q7YU 1VIFA 2LTOA 2R57A 3J7AF 5FU7C 1Q7YC 5I2SA 3CMAT 3VKIA 5KE2A 1ZC1A 2QQ9A 2R5AA 1E32A 5C6SA 3JRZA 3OYKA 1B34A 4IUTA 4C8QD 4AQ7A 5D6XA 1QVFA 5DY9A 5CQYA 1YJNA 2EYQA 4LDYA 2B25A 3OS1A 1LOJA 4N4HA 2VUBA 4KO8A 4C8QG 3G71A 1VIEA 4JRQA 2JVVA 1VQKT 2NLUA 2B8AA 5FU6C 4E7HA 1QCSA 4M77D 3ASKA 4HKEA 3QJ6A 5DM7R 3SB2A 4J83A 1K9MU 3E19A 5HK3A 4ARCA 3A5ZB 4M77G 5I21A 4M77A 5GAN7 3V7SA 2BKDN 1K8AC 3CC2T 2VGNA 3SWNB 5GANg 1Q82U 3QZ9B 1XOVA 1KG1A 4C92B 3TREA 5GAN4 4M75B 5GANh 2MWPA 1Q82C 1V29B 3M9QA 5HY6A 1VQ9T 4II1A 3CCST 4M7AB 4LDXA 3BQBA 1NPRA 4FIBA 3FJPA 4BI8B 3CCJT 2A7YA 1WJRA 3L2WA 4KBMB 4FT2A 2RI2A 3J81E 2LVMA 3CCRA 3AHUA 3L2ZA 4OVAA 2QQAA 5GAOp 2C06A 3G7ZA 4XU1A 2LC4A 3M5AA 3CCMA 1VQPT 1BI3A 3TEEA 2P0QA 2YHTA 3OYFA 2E5QA 5FRNA 3JB9J 2DPPB 4IURA 5GMKl 3GNGA 3PIOA 4MDWA 1VQ7T 4MMLA 5CKBA 5LJ3e 1YITA 5FU7B 3GIBA 3QSUA 4JLGA 3MO8A 3UDCA 1X75C 4P5NA 5HK0A 5GAN6 3I56T 2DVEA 3DB4A 2JUFA 2HBPA 5C18A 3DLMA 1N8RC 2Q18X 1M4ZA 5CAIA 5LJ5d 1M1KU 1Y96B 1WJSA 3V8JA 3OYGA 4RV0A 3G6ET 1VQ8A 3OYDA 4N0AA 3HU2A 1XTDA 2PUOB 2K3XA 3URGA 5A2QE 5CQXA 1G3TA 5CVIA 5FU6B 3CMEA 3JCMJ 3GNFB 1KD1U 1M9SA 1BI1A 4FT4A 2V8JA 1KD1C 2EKOA 2F5TX 4KDIA 1TH7A 2GFAA 1N6AA 3P8DA 4BDYA 2BUDA 3LH0A 2QEXT 1W4SA 3LGAA 3OA6A 5FTJA 3QC8A 2WSCE 5CCBA 4HCBA 2JNGA 5CK9A 2K57A 3MP6A 5FTNA 1WJQA 3OYIA 2XICA 3M59A 4XTXA 4C0ZA 1VQMA 5FTLA 4XK8E 3G4ST 1WGSA 1R8OB 3RESA 3KBGA 3JCMd 5FLXE 3WXMB 2EQUA 3HSBA 2DD5A 4A4FA 2MM2A 3CBPA 3L42A 4RCCA 4LDWA 3SWNA 5IAYA 2FVUA 1Y7XA 4A53A 5IN1A 4M78D 3OW2A 1M8VA 3FPTA 4C92A 3LHDA 4OB3B 1VQ7A 2ZPBB 4M75A 4Y28E 4ZGJB 5GAN3 4KUDK 1M1GA 3CC4T 4M78G 4RG2A 1WPYA 5D6WA 2RJCA 2MI6A 3V8LA 4C5EA 2PJHB 4PJOF 4PLIA 4M7AA 3FLGA 2Y4XA 1XNIA 1G3YA 2QQBA 3QYHB 3LW5E 4O5VA 1UEBA 4OGCA 2CZ7B 4C8QE 3G6EA 5GMKe 2XU8A 3L2VA 5M9OA 4HT8A 4E7IA 1CZ4A 1I9GA 4JLIA 4C0DC 3HFNA 5CKDA 1G3SA 1KQSS 5FTMA 4QQ6A 5LJ5f 5D6YA 4PNOA 3ZJTA 4ME7A 4OB2B 3V8KA 3CEYA 3QPHA 3LWHA 1KQ2A 2PVGB 4XU3A 4QVZA 2RK1A 3CXCA 1VQ4A 3BW1A 5GMKj 5LJ5e 4N4IA 5GAOn 3QYGB 2XD0A 5CCXA 4ELYC 4EMKC 3E9GA 4RG8A 2EJGA 5J3BA 4LD6A 3C12A 3QXEB 1BYMA 3ME9A 3QG1A 2PU9B 4PJOD 3A8GB 2PVOB 3L1AA 1Y96A 3OYAA 5LJ5j 3PGGA 2MF2A 1D3BB 3META 3ER0A 3VUBA 4E7KA 1KC8U 5EPPA 4M77F 3E9FA 3A8OB 3FDRA 1KC8C 3BDUA 1VQ5A 5KE3A 2RJDA 3S6WA 1X01A 2D0QB 2GF7A 4OB0B 5LJ3h 3QHSA 2RHXA 2RJEA 2XDDA 3CCMT 5FRMA 1VQNT 2K5IA 3EFRA 1VQOT 3C94A 4MZMA 3OYLA 5GMKm 2X35A 3HRSA 3OMCA 3FC3A 1S72A 2Q1AX 2DAQA 1YITT 3CC4A 4CQNA 3ZEHA 2DD4A 2E10A 2X4YA 3X20B 4Q5WA 3LLRA 2XK0A 2QXFA 4OGEA 2OTJA 3ZJUA 3WVEB 3P8HA 2XIDA 4A4HA 4B9XA 1Q86U 2JV2A 3Q1JA 3JCMQ 1VQ8T 1Q86C 3GF5A 3FB9A 4BE2A 4JUVA 4OP0A 1NPPA 4BB7A 1XQHA 3T9NA 4NL3A 2VV5A 3HRUA 2CS7A 2L5QA 2HNIA 3PNWC 1YJWA 1K8AU 3CMET 1FX7A 2KY9A 5GAOm 3NTHA 5B6CA 3BY7A 2RD1A 1ZHIA 4M7DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KY9 A;  4FIB A; 
#chains in the Genus database with same CATH topology
 1UB4 A;  4GLK A;  4Y91 A;  2HEQ A;  1WHL A;  1X6G A;  3THK A;  2GFU A;  4RTT A;  1G3W A;  1S72 Q;  4D6W A;  4EMK B;  1IO6 A;  2WAC A;  2CZ1 B;  1GBQ A;  2OTJ Q;  2VKN A;  1MMN A;  2FYK A;  3VRZ A;  1YJW Q;  1QVG A;  2HQH A;  1M1F A;  5GMK h;  2MK5 A;  2NUT A;  2LNV A;  4X9D A;  5GAM d;  4QT7 A;  2CP7 A;  4M77 C;  2L8D A;  2M16 A;  1VOM A;  1LCK A;  4OMM A;  1GCQ C;  4M78 F;  3RKY A;  4B9W A;  2VB6 A;  4ESR A;  4DQ2 A;  4KDL A;  3OYE A;  1NEG A;  3OYN A;  2GGR A;  3PVL A;  5DYI A;  5A0D A;  1NJI C;  1IB8 A;  5IT9 E;  3V7C A;  1EFN A;  4CI0 C;  2DER A;  2CDT A;  2DX1 A;  3M58 A;  3QII A;  4F7U B;  4C92 D;  2EQM A;  3JCM g;  4JJC A;  4ZGE B;  1D09 B;  3U23 A;  4M75 G;  1S72 T;  5ERG B;  3AT1 B;  1SSF A;  3OYY A;  3E1S A;  2DIQ A;  2E41 A;  4M7A G;  2DFU A;  3JB9 G;  2QQS A;  2JOY A;  2V8K A;  4C8Q B;  2DJZ A;  2DXT A;  2OTJ T;  5CIU A;  1NJI R;  1BIA A;  2YLB A;  1IGQ A;  2DXU A;  1D0Y A;  1YJW T;  2I0N A;  2GQV A;  3MCA B;  2DJQ A;  3M4G A;  2DA9 A;  5FWC A;  3NPF A;  3CC2 Q;  1RAD B;  3TVT A;  2EJF A;  3NFC A;  4KUI A;  3JCM V;  4R0K A;  4J6W A;  4XTV A;  2RF0 A;  3DB3 A;  1YI2 A;  2OTL A;  1BKB A;  4NOY A;  3KFV A;  4OB1 B;  4A4K A;  2K9G A;  1MND A;  3OBW A;  2F69 A;  3UA7 A;  1UGQ B;  3JB9 H;  1SHF A;  1JJ2 A;  4F7U G;  1HYO A;  2BIV A;  2RHY A;  1KSW A;  5IXB A;  1W70 A;  2EQI A;  1PRL C;  1TWB A;  4ZN3 A;  1UGR B;  1GBR A;  1D1B A;  3QKJ A;  5KYY B;  1AEY A;  1M5Q 1;  2MOX A;  5KYX B;  2Q1D X;  4HVU A;  2YRC A;  2VYT A;  2O4X A;  2J7I A;  1IRX A;  4KGZ B;  2OAU A;  2V1Q A;  1QWF A;  4IUQ A;  1PD1 A;  2QA4 A;  2KK4 A;  3MEU A;  1NEB A;  3CC7 A;  2COY A;  3G4S Q;  1RAE B;  2EYZ A;  4FW1 A;  5A0G A;  3BFM A;  2YWW A;  1NE8 A;  4BY6 B;  2LQK A;  1Q7Y R;  1MV3 A;  4M75 E;  2F1L A;  1NYF A;  4C5G A;  4M7A E;  2EAY A;  3L2Q A;  1YJN Q;  1VUB A;  1N27 A;  4YTL A;  4MDX A;  2RJF A;  3TIW A;  2PVD B;  2HQX A;  4M7D F;  1TOV A;  3PTA A;  4R55 A;  3CCE A;  3CD6 A;  5GAO q;  5LJ3 f;  1YBY A;  4XTU A;  3CMA A;  1CR5 A;  3MJX A;  1QWE A;  2ZAE A;  4DBQ A;  1NJI U;  3FIF A;  1KHC A;  2KXD A;  1VYV A;  5LJ3 j;  2DBM A;  2DTH A;  1M1K C;  3JB9 I;  2O9S A;  1WHM A;  2OTL T;  4RTZ A;  1G83 A;  3GP8 A;  3VS7 A;  4E7S A;  3CCR Q;  3M0R A;  2Q1C X;  3LYI A;  4FSX A;  2QDY B;  3TU4 K;  2MM0 A;  2RK2 A;  3UWN A;  5GAN f;  4EPC A;  3CMA Q;  1WHJ A;  3EH2 A;  2E65 A;  2O01 E;  3X24 B;  3OSS C;  1WA7 A;  1G5V A;  4HT9 A;  3NTI A;  4DOV A;  4F7U E;  1SF9 A;  2Z0W A;  4KGX B;  5GAN j;  1I4K 1;  4M77 B;  3NTK A;  3OS0 A;  5GAN 5;  1PWT A;  5LL6 S;  3CME Q;  2YUJ A;  1YJN T;  3I56 A;  1FMV A;  3EGD A;  1KD1 R;  3CPF A;  1I5L A;  2M9U A;  2K5F A;  3TCJ A;  3VS0 A;  3C4S A;  1OU8 A;  4JJD A;  1OOT A;  4RTX A;  1I81 A;  2DLP A;  3L2U A;  1UUE A;  2QA4 T;  1HSQ A;  4BI3 A;  3A8L B;  4C92 C;  3CC7 T;  4JS5 A;  1LNX A;  5EQJ B;  2I2L A;  5GAN 2;  2LCC A;  2RHU A;  2DL5 A;  1X69 A;  2MPX C;  3KUF A;  3A1P A;  3I56 Q;  3CCR T;  1HXD A;  4J7F A;  1OQK A;  3TQ7 P;  1Q7Y U;  2R57 A;  1I07 A;  2YRD A;  2K2M A;  3CMA T;  2RQR A;  1E32 A;  2K79 A;  4C8Q D;  4FSS A;  1SSH A;  4D8K A;  3EFO B;  3OS1 A;  2B25 A;  4F04 B;  4N4H A;  2VUB A;  4F17 A;  4KO8 A;  1VQ4 Q;  1VIE A;  3I9Q A;  2B8A A;  4E7H A;  1MV0 B;  3SB2 A;  5HK3 A;  4M77 G;  5I21 A;  5GAN 7;  2VGN A;  5KYW A;  2OJ2 A;  2QAZ A;  1KG1 A;  1XOV A;  5GAN 4;  5GAN h;  1V29 B;  1TUC A;  1UDL A;  1UJ0 A;  2JT4 A;  3M0U A;  3CC4 Q;  4DBR A;  4BI8 B;  1WJR A;  1NG2 A;  4PK4 A;  2C06 A;  2CH4 A;  5EC7 A;  3R6N A;  4FCY A;  2P0Q A;  2YHT A;  3JB9 J;  2DPP B;  3GNG A;  1UEC A;  1D1C A;  4MML A;  1YIT A;  3QSU A;  3UDC A;  3RR6 A;  4P5N A;  4ANJ A;  3I56 T;  1ZSZ C;  1X27 A;  3EG0 A;  2ESW A;  3DLM A;  4LUD A;  5C18 A;  1M4Z A;  5CAI A;  1M1K U;  1BBZ A;  3OYG A;  4N0A A;  3HU2 A;  1H8K A;  2PUO B;  2K3X A;  1KD1 U;  4LNP A;  5FW9 A;  2QYZ A;  1TH7 A;  2GFA A;  1N6A A;  2CSI A;  3LH0 A;  3LGA A;  3OA6 A;  1CKA A;  3QC8 A;  2HKN A;  1N5Z A;  2JNG A;  1YIT Q;  2JM9 A;  1WX6 A;  2O88 A;  5FTN A;  2XIC A;  4XTX A;  1VQM A;  1JEG A;  4XK8 E;  1WGS A;  3KBG A;  3WXM B;  1K9A A;  1M2V B;  2KNB B;  2JMC A;  3CBP A;  3FPT A;  4OB3 B;  1VQ7 A;  2ZPB B;  4M75 A;  1ACM B;  3ULR B;  6AT1 B;  3CC4 T;  2DVJ A;  1Y0M A;  3V8L A;  4PJO F;  4M7A A;  1XNI A;  4O5V A;  2RQV A;  3H0H A;  3G6E A;  1MUZ A;  2D1X A;  5M9O A;  4HT8 A;  1CZ4 A;  2EGA A;  3ZJT A;  1VQM Q;  4OB2 B;  3V8K A;  3QPH A;  3LWH A;  1KQ2 A;  4XU3 A;  3I35 A;  4QVZ A;  3CXC A;  5LJ5 e;  3EG2 A;  3QYG B;  3M0Q A;  1J3T A;  4EMK C;  3C12 A;  4JZ4 A;  3QG1 A;  3EGU A;  3L1A A;  2MF2 A;  3MET A;  3ER0 A;  2DRM A;  3FDR A;  1X01 A;  2D0Q B;  4OB0 B;  2RHX A;  4MZM A;  2X35 A;  1R0C B;  2DAQ A;  1YIT T;  3ZEH A;  2E10 A;  2X4Y A;  2RQT A;  2LCS A;  1CSK A;  3LLR A;  8ATC B;  1C6V X;  3FJ5 A;  3WVE B;  3CCU Q;  4JUV A;  1QKX A;  1ZLM A;  3EG9 A;  3HTR A;  3MPU B;  2JS2 A;  1WZO A;  2EYY A;  2DL3 A;  5DYG A;  5KYU B;  2VXE A;  3A8H B;  4NS5 A;  1M90 R;  3QUI A;  2L3R A;  1VQM T;  2RI5 A;  4CRI A;  2P0P A;  2XDP A;  1FMW A;  2DYI A;  3QQ8 A;  4HCZ A;  1VQN A;  3HPW A;  4DOW A;  1VQO A;  2FZG B;  5CKF A;  3VUZ A;  1JB0 E;  3DKM A;  4ATO A;  4C8Q C;  1M3C A;  2X4X A;  3CCQ A;  4RCB A;  1FMK A;  3PMT A;  4JPB W;  4AFS C;  5LJ5 g;  3L2R A;  4C0G A;  2HQE A;  4C92 F;  2IVW A;  2ROL A;  2QI2 A;  1OX8 A;  2YUP A;  4X1V A;  1WFW A;  2CP3 A;  1JXO A;  2A37 A;  3KXT A;  1VQN Q;  3CCU T;  1W2B S;  1RI0 A;  5KCH A;  1WHK A;  4OF1 A;  4RTU A;  5I11 A;  1HD3 A;  1OX9 A;  3CCQ Q;  1QCF A;  5AT1 B;  1W6X A;  4JRP A;  3X25 B;  4PJO E;  2KVQ G;  4M7D A;  1M2O A;  1AHJ B;  4C92 G;  1N9S A;  5KYY A;  4V2S A;  1K73 R;  1QVF S;  1AWX A;  2JZ2 A;  4M4Z A;  1OPL A;  5J39 A;  3OYJ A;  3LX7 A;  1ZSZ B;  2WSE E;  2GCX A;  4DA4 A;  4L6V 5;  4OMN A;  4A4E A;  4J9H A;  4C0F A;  2K7A A;  2RQW A;  2J6K A;  1JRI A;  5GAM e;  1DJ7 B;  2QTV A;  3INZ A;  5CD1 A;  3HL8 A;  1X2K A;  3CPW S;  2AKK A;  4AG1 C;  2RO0 A;  3ZBD A;  1ABO A;  2O31 A;  5KH6 A;  4R56 A;  1M27 C;  2MIO A;  4BY6 C;  1VQN T;  3HP9 A;  3S3M A;  2H3J A;  4IUP A;  2DZC A;  4J6X A;  1M3B A;  4KT0 E;  1VQP Q;  4E2F B;  3JCM e;  4PLL A;  5GAN 8;  3GLX A;  3CCQ T;  2X9H A;  3EGX B;  5LJ3 d;  1SRM A;  4J9F A;  2FG0 A;  4DBF A;  1Z9Q A;  2DRK A;  3R6O A;  1T0J A;  3JCM b;  2JN0 A;  1E6H A;  1VQ6 A;  1JBM A;  1RAA B;  1VQL A;  3MB5 A;  1GCP A;  1AWJ A;  2B86 A;  4E7J A;  1SEM A;  2P4T A;  2IPO B;  4XTZ A;  2NUP A;  1C1A A;  1H3Z A;  2KAF A;  1M8M A;  4LD9 K;  4IKF A;  3FPR A;  4AS1 A;  2COZ A;  1VYT A;  4LXC A;  4L5G A;  1SPK A;  2XHC A;  4LE9 A;  2DL8 A;  3ZFJ A;  2CRE A;  5GAN d;  2LT4 A;  3OQ5 A;  1G2B A;  1GCQ A;  3CPW P;  1PRM C;  1VQ6 Q;  5KCO A;  4C92 E;  3S3O A;  1VQL Q;  4LDV A;  4M78 B;  2E6Z A;  2O9V A;  3VYH B;  4BDZ A;  1O75 A;  2JM8 A;  5GLF A;  2ZCF B;  2J06 A;  1Z9Z A;  3VV0 A;  5GAM g;  2RNA A;  3G71 Q;  1K73 U;  2DIL A;  3C95 A;  4M75 F;  2JJ9 A;  4WCI A;  2NUZ A;  1GXI E;  1V1C A;  4M7A F;  1WQ7 A;  3JB9 F;  3WVD B;  3F70 A;  4IUU A;  3VS5 A;  4JJB A;  3RMQ A;  2LW6 A;  3N5B B;  2M0Y A;  2V26 A;  3VU3 C;  1H92 A;  5GAO l;  3CC2 A;  3OYC A;  2JMA A;  3MEV A;  4FM4 B;  2K3Y A;  4X9C A;  5AYF A;  1B34 B;  1SG5 A;  1VQ9 A;  2G6F X;  1ZUK A;  2LJ0 A;  2JXB A;  5DLO A;  5GJW B;  2D8J A;  2HBW A;  2ZZD A;  3G1J A;  1HJD A;  4XTW A;  2PQW A;  2YLC A;  2EJ9 A;  1UGS B;  3GPL A;  3H9N A;  4AT1 B;  5GAO r;  2DYB A;  1CZ5 A;  1VQ6 T;  2L0A A;  3H41 A;  1VQL T;  1M3A A;  2HL5 C;  4BE1 A;  2DTO A;  2RM4 A;  1F1B B;  4JRK A;  4F7U F;  2FPD A;  3G71 T;  4UC4 A;  1RAG B;  3CQT A;  3UT1 A;  3ZGZ A;  1B3Q A;  1VQ9 Q;  2G3R A;  1ZX6 A;  2HDA A;  2F5K A;  5C1B A;  2HD0 A;  3JCM P;  4C8Q F;  4PL6 A;  2Y4Y A;  3OY9 A;  1IZ6 A;  3JAM E;  1W2B A;  4Z8A A;  4KLN A;  2BZ8 A;  1PSF A;  5ECA A;  3G4S A;  4PJO A;  1RL2 A;  2HL3 A;  2EWN A;  2EKH A;  1YFN A;  3VS4 A;  2LTO A;  1Q7Y C;  2YT6 A;  3RNJ A;  5C6S A;  3OYK A;  4PFZ A;  4IUT A;  1JXM A;  1QVF A;  5CQY A;  1YJN A;  4C8Q G;  5I22 A;  2K6D A;  2NLU A;  3EG3 A;  2AKL A;  3ASK A;  2KRO A;  2PZ1 A;  1SKU B;  1GFC A;  4Z89 A;  4J83 A;  3CC2 T;  3SWN B;  2X3X D;  3I5R A;  1VQ9 T;  4II1 A;  3BQB A;  3FJP A;  1IHV A;  2A7Y A;  1KQS P;  1TUG B;  2RI2 A;  5L23 A;  4DBH A;  2M51 A;  2DE0 X;  3CCR A;  3L2Z A;  5GAO p;  3G7Z A;  4XU1 A;  2LC4 A;  1BI3 A;  2YUQ A;  1Q86 R;  2VAS A;  5GMK l;  4MDW A;  5CKB A;  5FU7 B;  4JLG A;  1KIK A;  2DVE A;  2VWF A;  2KYB A;  2Q18 X;  1N8R C;  1WJS A;  2DET A;  3V8J A;  4RV0 A;  1VQ8 A;  2A0F B;  3O5Z A;  1WYX A;  5A2Q E;  1G3T A;  5CVI A;  5FU6 B;  3CME A;  3JCM J;  3GNF B;  4OMQ A;  1KD1 C;  2EKO A;  2F5T X;  3P8D A;  4J9D A;  1AD5 A;  2ENM A;  2EGE A;  4Z88 A;  5CK9 A;  2BZY A;  2CP5 A;  4PFP A;  3VS1 A;  3G4S T;  3RES A;  1N8R R;  2W10 A;  3HSB A;  2H8H A;  4LDW A;  1VQ8 Q;  5IN1 A;  4M78 D;  1TS9 A;  4C92 A;  4ZGJ B;  4Y28 E;  1ZUY A;  2RJC A;  4PLI A;  2Y4X A;  2QQB A;  3QYH B;  3LW5 E;  4OGC A;  4C8Q E;  5GMK e;  4JLI A;  4C0D C;  1FYN A;  5FTM A;  4QQ6 A;  1TUD A;  3CEY A;  1TSF A;  1VQ4 A;  2KT8 A;  3SEM A;  5CCX A;  2PNI A;  2LX7 A;  2EJG A;  4LD6 A;  3QXE B;  1BYM A;  3ME9 A;  1PHT A;  1Y96 A;  2NUT B;  4FYX B;  4E7K A;  4LN2 A;  4M77 F;  3E9F A;  2FZC B;  1VQ5 A;  2RJD A;  2F2V A;  2GF7 A;  5LJ3 h;  3QHS A;  4AG2 C;  3REB B;  3C94 A;  5GMK m;  1GFD A;  3OMC A;  2Q1A X;  3CC4 A;  2J05 A;  2BE9 B;  2XK0 A;  4OGE A;  2YUN A;  1Q86 U;  3JCM Q;  1VQ8 T;  3GF5 A;  4BE2 A;  1NPP A;  1AZE A;  2HCK A;  2CS7 A;  2L5Q A;  4AFQ C;  2HNI A;  3PNW C;  1R0B G;  3CME T;  3NTH A;  4AFU C;  4XU2 A;  1VQ5 Q;  1ZHI A;  1U5S A;  4ELZ C;  4HCK A;  1YHQ Q;  1IRE B;  2KQW A;  3V7R A;  4XQ3 A;  3SFM A;  3RUX A;  3PT9 A;  4GLM A;  1BCO A;  3LGF A;  2RA2 A;  2EGC A;  1PG5 B;  1MMG A;  5C0M A;  4ZGD B;  7AT1 B;  2RH2 A;  3OW2 S;  2KBT A;  1QCN A;  1U8R A;  1WDX A;  4E7L A;  3JCM W;  2DL7 A;  1MGQ A;  2VXF A;  2DMO A;  1BU1 A;  1OZ3 A;  3NGP A;  4J9G A;  1N8R U;  2XKO C;  1AT1 B;  2RHZ A;  4WF2 A;  1D3B A;  2YSQ A;  4KUL A;  3CBM A;  1EZZ B;  1YCY A;  1ZBX A;  2KT1 A;  2C0I A;  2CUB A;  1VQ4 T;  2H3E B;  4VUB A;  2QAS A;  1B7T A;  5GMK i;  2LQ8 A;  2LT1 A;  4PJN A;  4X34 A;  4QVD A;  1BIB A;  2KGT A;  2VC8 A;  1NBE B;  3EGX A;  1M30 A;  2L3P A;  4B6M A;  4M7D D;  1VQ5 T;  3I55 Q;  4KRT A;  3DLL A;  2KRN A;  4A63 B;  5A0L A;  2FRW A;  4J9I A;  1YHQ T;  1G8X A;  4RKU E;  4JRI A;  4HCC A;  4O6J A;  1FXX A;  2E1H A;  1QMC A;  4EMK A;  3OBY A;  1LPL A;  3IQL A;  3NHN A;  2O4X B;  2LX9 A;  4JDS A;  2NYS A;  1QP2 A;  3M56 A;  1WIE A;  4MMK A;  1EX4 A;  4NL2 A;  2WSF E;  3OW2 P;  3QJY A;  2KR3 A;  1Q81 R;  1UGP B;  2ZPF B;  1TXQ A;  2MWO A;  4GBQ A;  4C5I A;  5IHK A;  3H0I A;  2OX7 A;  3M0T A;  4M77 E;  2HAX A;  3CCU A;  4FL6 A;  3NMZ C;  3SD4 A;  1YP5 A;  1QLY A;  2QTX A;  3VJP A;  2AK5 A;  2DO3 A;  1KFZ A;  2EBP A;  1Y71 A;  3X28 B;  3HFO A;  3CCJ Q;  2DKG A;  1LJO A;  2CP0 A;  4J6Y A;  2DXC A;  3HHT B;  2E6N A;  4PKC C;  4M78 C;  4TVR A;  3CCL A;  4J5Y A;  1SRL A;  1M90 C;  1QVG S;  2X4J A;  2K5L A;  2E64 A;  2LZ6 B;  3I55 T;  1WXB A;  5L8R E;  4F7U A;  2ECZ A;  2ZGW A;  2LRQ A;  4JJN K;  2KRM A;  3M55 A;  3LHD A;  2MYS A;  3OS2 A;  4C0D B;  2P84 A;  1K4U S;  1JQQ A;  4FYV B;  4C8Q A;  3CCL Q;  5HKC A;  1Y07 A;  4BD3 A;  3VS3 A;  4XTY A;  1PM3 A;  4EMG A;  3QWY A;  1YIJ A;  1YJ9 A;  1WLF A;  2P0K A;  1Y57 A;  2X4W A;  3FPU A;  2A28 A;  1UE9 A;  2JTM A;  1RI9 A;  2DZ9 A;  2RMO A;  2F2X A;  2M02 A;  1BI2 A;  2SRC A;  4KGV B;  3MEA A;  3P8B B;  2R5M A;  4EDU A;  1C0M A;  3M57 A;  2Q19 X;  2X51 A;  4OMF B;  3QWZ A;  1MHN A;  1RAC B;  2O2O A;  3MP1 A;  2JW4 A;  3ZJV A;  3VS2 A;  1P92 A;  2KYM A;  2EPD A;  1YCS B;  1ZA1 B;  3OYM A;  4BUG A;  1PD0 A;  1K73 C;  4HVW A;  2ZPH B;  3BDL A;  2DK3 A;  3EG1 A;  1YIJ Q;  1YJ9 Q;  2A3L A;  4WTO B;  1QVG P;  2MMP A;  4QKU A;  1UGV A;  1NLP C;  4BI4 A;  1K8A R;  4JS4 A;  2KEA A;  1KQ1 A;  3CF2 A;  2M1H A;  2LCL A;  1Q81 U;  1Q82 R;  1OUL A;  4IUV A;  1VQK A;  1QDN A;  3TSW A;  2BZX A;  2HMA A;  4Z02 A;  2OI3 A;  4L59 A;  2KI7 A;  4XU0 A;  1RUW A;  4CC3 A;  2FHD A;  3CCL T;  5KYX A;  2QG9 B;  3M53 A;  3M4Y A;  4KOD A;  4KH0 B;  1NLO C;  3CCS A;  3HU1 A;  1JJ2 S;  5GAN e;  2LQW A;  3UAT A;  2XG8 D;  2DM1 A;  5CKH A;  3RMS A;  3VYG A;  1VQP A;  1RAI B;  1VQK Q;  4K11 A;  1OI1 A;  2P4R A;  3OYB A;  2A36 A;  1PNJ A;  2CZ0 B;  3MHX A;  5KYW B;  1BI0 A;  2XDB A;  4EMH A;  3QDR B;  2CT4 A;  2DEU A;  3RKW A;  1YIJ T;  1YJ9 T;  2HSE B;  3CCS Q;  3SWN C;  1I8F A;  2D9T A;  2LJ1 A;  4MZP A;  4M7D C;  4ZTJ A;  5I2M A;  1U06 A;  1K0X A;  3GOX A;  5CO7 A;  1M90 U;  4D8D A;  3QZ5 B;  2SEM A;  5IXF A;  2QEX A;  1X43 A;  1QW1 A;  3PE0 A;  4F14 A;  2JTF A;  2QGG A;  3M0P A;  2EQK A;  3SDZ A;  5LJ3 g;  4E6R A;  1EIF A;  3D7S B;  5FU7 C;  5I2S A;  2JS0 A;  2QQ9 A;  2V1R A;  3JRZ A;  5D6X A;  2E5K A;  2EYQ A;  4LDY A;  2RQU A;  1JJ2 P;  3G71 A;  1IGU A;  1KJW A;  1SHG A;  2QEX Q;  4JRQ A;  1YWP A;  1VQK T;  5FU6 C;  1QCS A;  4HKE A;  4F16 A;  5DM7 R;  4ARC A;  3A5Z B;  4M77 A;  2BKD N;  1KC8 R;  3REA B;  5GAN g;  1Q82 U;  4HXJ A;  2AZS A;  3UF4 A;  4M75 B;  2DF6 A;  2BE7 D;  5HY6 A;  2RPN A;  3CCS T;  4M7A B;  1PKS A;  2ROT A;  4FIB A;  3L2W A;  3AHU A;  4OVA A;  2A08 A;  3M5A A;  3CCM A;  1VQP T;  3TEE A;  5FRN A;  1T0H A;  3OYF A;  4RUG A;  4IUR A;  1UFF A;  3MO8 A;  1X75 C;  3QWX X;  5HK0 A;  3DB4 A;  2JUF A;  1AZG B;  2HBP A;  4RTW A;  3OYD A;  2XMF A;  1XTD A;  5CQX A;  2LMJ A;  2CUD A;  2KRS A;  1M9S A;  1B07 A;  1BI1 A;  4FT4 A;  1X2Q A;  1TG0 A;  2QEX T;  3EFO A;  4DEY A;  4Y92 A;  1W4S A;  3CCM Q;  2ED1 A;  2L3Q A;  2WSC E;  5GJV B;  4HCB A;  1JU5 C;  2K57 A;  1WJQ A;  2EW3 A;  1OU9 A;  2K3B A;  1R8O B;  3JCM d;  5FLX E;  2C0O A;  2EQU A;  2MM2 A;  2OAW A;  3L42 A;  3EG9 B;  2PTK A;  1M8V A;  1JO8 A;  1ZUU A;  4ZNX A;  5GAN 3;  4M78 G;  4RG2 A;  1YNZ A;  8AT1 B;  3FLG A;  4IIO A;  1K0S A;  3LH5 A;  5FWB A;  4PJM A;  1UEB A;  2ED0 A;  3L2V A;  1I9G A;  1KQS S;  2LJ3 A;  5LJ5 f;  1XJW B;  4PNO A;  4ME7 A;  2COW A;  2RK1 A;  3VRY A;  2XD0 A;  3BW1 A;  4N4I A;  5GAO n;  2W0Z A;  3MKD A;  2PU9 B;  1QKW A;  2F2W A;  5LJ5 j;  2GBQ A;  1KC8 U;  1YN8 A;  1E6G A;  3S6W A;  1ZA2 B;  2RJE A;  2XDD A;  3CCM T;  4PJJ A;  1UTI A;  3OYL A;  3FC3 A;  4CQN A;  1WXU A;  2DD4 A;  4Q5W A;  3P8H A;  2XID A;  4A4H A;  4B9X A;  2JV2 A;  1Q86 C;  1M2V A;  3FB9 A;  4NL3 A;  1D0X A;  3HRU A;  1ZSG A;  1FX7 A;  2KY9 A;  5GAO m;  5B6C A;  3BY7 A;  2RD1 A;  2J6F A;  4M7D B;  3TSZ A;  1YI2 Q;  1PCX A;  4AFZ C;  4J8O A;  2OTL Q;  3OMG A;  4ARI A;  1NM7 A;  4RTV A;  3CPW A;  4PJO C;  2CKK A;  2EIF A;  1U1T A;  2KDS A;  1I5O B;  1NZ9 A;  2GNC A;  1QVP A;  5CCA A;  2L89 A;  1GL5 A;  3LWI A;  2LP5 A;  2J6O A;  3A8M B;  2D6F A;  4QW2 A;  3EFS A;  2K4Y A;  1W1F A;  3RER A;  2FL7 A;  2DXB A;  4FYW B;  3UPU A;  2V8I A;  2YDL A;  4M78 E;  1WQW A;  2BTT A;  1RAH B;  5LJ5 h;  1R7R A;  3HU3 A;  2LNH B;  3CXC S;  2QA4 Q;  2CGH A;  2E70 A;  2VGM A;  2M0O A;  3CC7 Q;  4OML A;  2K2V A;  3QDF A;  4J9B A;  5FRO A;  2D0N A;  2FZK B;  1D0Z A;  2CZ6 B;  3M54 A;  3RKX A;  1YI2 T;  5J26 A;  4M75 D;  1OV3 A;  2YRV A;  4ORZ A;  4M7D G;  1HK9 A;  2FB7 A;  3JSC A;  2EVR A;  5KYU A;  4M7A D;  2FPF A;  3CCE Q;  3CD6 Q;  4OMO A;  3JB9 D;  3JV3 A;  2JTE A;  3H0F A;  2ZPI B;  3RIR A;  4OMP A;  1UHC A;  3JCM c;  2NUP B;  4CC4 B;  2E3H A;  1CKB A;  4BE0 A;  3VS6 A;  4QVC A;  4HA8 A;  5GAM f;  4BAC A;  1AWW A;  4ZTF A;  1M1K R;  1E7O A;  1S1N A;  1T3L A;  4J9E A;  2MCN A;  2QQR A;  4E7Z A;  2ZPE B;  4FU6 A;  1WHG A;  1N9R A;  2YVL A;  5EG2 A;  5GAM j;  1VA7 A;  3CCV A;  1H64 1;  2EYW A;  3CXC P;  2QK0 A;  1YHQ A;  2NWM A;  2CYZ B;  2KXC A;  2DIG A;  3JCM f;  3SHW A;  2YXY A;  3PIP A;  1X6B A;  2MAM A;  1I0C A;  2D8H A;  2XI9 A;  3FEO A;  1U3O A;  3EAE A;  1MMD A;  4A54 A;  3PMI A;  2GQI A;  1VYU A;  1QP3 A;  3E2U A;  3CCE T;  3CD6 T;  4LDU A;  1WNL A;  3CCV Q;  2EQJ A;  1PKT A;  2KSS A;  3UA6 A;  3J80 E;  1R77 A;  3OSV A;  2RHI A;  3OB9 A;  3OYH A;  3PVQ A;  4LUE A;  3HKS A;  1ZSZ A;  2FEI A;  2YUO A;  1RLQ C;  3PFS A;  4XAX B;  1KQS A;  1U1S A;  2Y90 A;  1K9M C;  1X6O A;  1ZQ1 A;  4DEX A;  2X3W D;  4CC7 A;  3MP8 A;  4ZN1 A;  2HZY A;  1O9S A;  4RMO A;  4M7D E;  1OZ2 A;  1UHF A;  4HVV A;  3QO3 A;  1FWZ A;  1BB9 A;  4QQG A;  2HSP A;  2L2P A;  3I55 A;  2R58 A;  2FO0 A;  4IIM A;  1KHI A;  2DEQ A;  1GRI A;  4C5H A;  1OPK A;  1OYX A;  1K76 A;  1TU0 B;  2RI3 A;  5GAM h;  3BE3 A;  3H6Z A;  3H8Z A;  3ZL7 C;  3QQ7 A;  1PSE A;  4MZT A;  1K9M R;  2HKQ B;  2DTI A;  2EFI A;  4E47 A;  5CR2 A;  1Q81 C;  3CCV T;  1D1A A;  4PJO B;  3HRT A;  3JCM h;  2AHJ B;  3O8V A;  1IXD A;  1YWO A;  3CBO A;  2VVK A;  3JCM X;  1QCO A;  1S3S A;  1RLP C;  4J7I A;  1RAB B;  5IHN A;  2PWY A;  2IG0 A;  2E12 A;  4N0A C;  2FPE A;  3CCJ A;  1O54 A;  3EHQ A;  4AMC A;  2RB6 A;  2FRY A;  3EH1 A;  4QQD A;  4A4G A;  2ZPG B;  4M78 A;  5DLQ E;  3OS5 A;  5HCK A;  2DNU A;  2LDM A;  1WHH A;  1AWO A;  1Q95 G;  3MEW A;  4FYY B;  2KMT A;  2CH4 W;  5CKE A;  1BK2 A;  3LGL A;  5FTK A;  2CT3 A;  3FRN A;  2GTO A;  4M75 C;  2AT1 B;  4GY5 A;  4M7A C;  2L3S A;  1KK7 A;  1I1J A;  1VQ7 Q;  2PUK B;  1MNE A;  4PJO G;  1UG1 A;  4N4G A;  3S3N A;  3QBY A;  3X26 B;  1VIF A;  3J7A F;  3G6E Q;  3VKI A;  5KE2 A;  1ZC1 A;  2R5A A;  1H3H A;  4FW2 A;  1B34 A;  4AQ7 A;  3GBQ A;  1QQJ A;  5DY9 A;  1ARK A;  1LOJ A;  3C0C A;  1NYG A;  1TTH B;  2CP2 A;  2CP6 A;  2JVV A;  4M77 D;  3QJ6 A;  1K9M U;  3E19 A;  3V7S A;  1K8A C;  3QZ9 B;  4C92 B;  3TRE A;  1Q82 C;  2MWP A;  3M9Q A;  1WXT A;  3RDV A;  3EGD B;  4LDX A;  1NPR A;  1OEB A;  3CCJ T;  2GTJ A;  4KBM B;  4FT2 A;  3J81 E;  2KE9 A;  2LVM A;  2EYX A;  2QQA A;  5KYN A;  2E5Q A;  4CC2 A;  3PIO A;  1VQ7 T;  3GIB A;  5LJ3 e;  3RBB B;  5GAN 6;  2LQN A;  5LJ5 d;  1Y96 B;  5D7U A;  3G6E T;  2QGF B;  3URG A;  4KDI A;  2V8J A;  1ZBJ A;  1V76 A;  4BDY A;  2BUD A;  5FTJ A;  1VQO Q;  5CCB A;  2ATC B;  1LVK A;  1PC0 A;  5IHI A;  4KH1 B;  3MP6 A;  2E3I A;  3OYI A;  3M59 A;  4C0Z A;  5IH2 A;  5FTL A;  4J9C A;  2E4H A;  2DBK A;  2DD5 A;  1UJY A;  4A4F A;  9ATC B;  2RN8 A;  4RCC A;  3SWN A;  5IAY A;  2FVU A;  1Y7X A;  4A53 A;  3OW2 A;  4PJL A;  4KUD K;  1M1G A;  1RAF B;  1IHW A;  5D6W A;  1WPY A;  2AIR B;  2MI6 A;  4C5E A;  2PJH B;  1WLP B;  1G3Y A;  1AOJ A;  2CZ7 B;  2XU8 A;  4E7I A;  4EIK A;  3HFN A;  5CKD A;  1G3S A;  1A0N B;  5D6Y A;  3I5S A;  1MMA A;  1ABQ A;  2PVG B;  2CSQ A;  5GMK j;  4ELY C;  3E9G A;  4RG8 A;  5J3B A;  1BCM A;  4PJO D;  3A8G B;  2PVO B;  3OYA A;  3PGG A;  1D3B B;  3VUB A;  5EPP A;  3A8O B;  3M0S A;  3BDU A;  1KC8 C;  5KE3 A;  1K1Z A;  1T3S A;  5FRM A;  2C0T A;  2K5I A;  3EFR A;  1VQO T;  1S72 A;  3HRS A;  1W2B P;  1AVZ C;  3X20 B;  3A98 A;  2QXF A;  2AZV A;  2OTJ A;  3ZJU A;  3Q1J A;  4OP0 A;  4BB7 A;  1XQH A;  3EHR A;  3T9N A;  2VV5 A;  4PFO A;  1WI7 A;  1K8A U;  1YJW A;  2QDL A;  1QVF P;  4JZ3 A;  2ABL A;  2DL4 A;  4RTY A;  2IIM A; 
#chains in the Genus database with same CATH homology
 1UB4 A;  4GLK A;  4Y91 A;  4ELZ C;  4J8O A;  5DYG A;  2VXE A;  3A8H B;  3OMG A;  4NS5 A;  2GFU A;  1G3W A;  1IRE B;  2KQW A;  3V7R A;  4ARI A;  4XQ3 A;  3SFM A;  3CPW A;  3RUX A;  4D6W A;  3PT9 A;  4EMK B;  4PJO C;  2CKK A;  3QUI A;  2EIF A;  2L3R A;  3LGF A;  1VQM T;  2RI5 A;  2RA2 A;  2WAC A;  1U1T A;  2KDS A;  1NZ9 A;  2CZ1 B;  2P0P A;  4CRI A;  2XDP A;  1QVP A;  3QQ8 A;  5C0M A;  5CCA A;  4ZGD B;  2L89 A;  2RH2 A;  4HCZ A;  3OW2 S;  1VQN A;  3HPW A;  2FYK A;  3A8M B;  4DOW A;  3LWI A;  1VQO A;  1U8R A;  2D6F A;  5CKF A;  3VUZ A;  1JB0 E;  3DKM A;  4QW2 A;  4E7L A;  3EFS A;  3JCM W;  4ATO A;  2K4Y A;  1MGQ A;  2VXF A;  1QVG A;  4C8Q C;  3RER A;  2FL7 A;  1M1F A;  1OZ3 A;  5GMK h;  2DXB A;  2X4X A;  3UPU A;  1N8R U;  2LNV A;  2V8I A;  4X9D A;  3CCQ A;  4M78 E;  2XKO C;  4WF2 A;  2RHZ A;  1D3B A;  4RCB A;  1WQW A;  5GAM d;  4KUL A;  3PMT A;  3CBM A;  5LJ5 g;  3L2R A;  1YCY A;  4C0G A;  2HQE A;  5LJ5 h;  4C92 F;  4M77 C;  1ZBX A;  2L8D A;  2M16 A;  1R7R A;  3HU3 A;  2IVW A;  4M78 F;  3RKY A;  3CXC S;  2QI2 A;  4B9W A;  4DQ2 A;  1VQ4 T;  4KDL A;  2CGH A;  3OYE A;  4VUB A;  2E70 A;  5GMK i;  2VGM A;  2M0O A;  3OYN A;  2LQ8 A;  2LT1 A;  3KXT A;  3CCU T;  2K2V A;  4X34 A;  4QVD A;  1BIB A;  1W2B S;  5DYI A;  5A0D A;  1NJI C;  5IT9 E;  5FRO A;  1RI0 A;  2VC8 A;  5KCH A;  3V7C A;  4OF1 A;  4CI0 C;  2CZ6 B;  3M58 A;  3QII A;  4M7D D;  4F7U B;  1VQ5 T;  3M54 A;  3RKX A;  1YI2 T;  3DLL A;  4JRP A;  3X25 B;  4C92 D;  5A0L A;  4PJO E;  2EQM A;  2KVQ G;  4M75 D;  5J26 A;  2YRV A;  3JCM g;  4M7D G;  4ZGE B;  1YHQ T;  4M7D A;  1HK9 A;  2FB7 A;  1AHJ B;  3JSC A;  1N9S A;  4C92 G;  4V2S A;  4M75 G;  4RKU E;  1S72 T;  4M7A D;  1QVF S;  3JB9 D;  4JRI A;  5ERG B;  4HCC A;  4O6J A;  1SSF A;  1FXX A;  2JZ2 A;  2E1H A;  2DIQ A;  2ZPI B;  2E41 A;  3E1S A;  3OYY A;  3RIR A;  4M7A G;  4EMK A;  3JB9 G;  2QQS A;  3JCM c;  5J39 A;  2JOY A;  2V8K A;  3OBY A;  4C8Q B;  2DJZ A;  2DXT A;  2OTJ T;  2O4X B;  2LX9 A;  5CIU A;  3OYJ A;  4JDS A;  3LX7 A;  1BIA A;  4BE0 A;  1QP2 A;  2WSE E;  3M56 A;  4MMK A;  2YLB A;  4NL2 A;  2DXU A;  2WSF E;  4QVC A;  3QJY A;  2GCX A;  4DA4 A;  4HA8 A;  4L6V 5;  5GAM f;  4BAC A;  4ZTF A;  1UGP B;  2ZPF B;  1YJW T;  4A4E A;  2MWO A;  2GQV A;  3MCA B;  4C0F A;  4C5I A;  1JRI A;  5GAM e;  2QQR A;  1DJ7 B;  3M4G A;  4M77 E;  2HAX A;  2ZPE B;  3INZ A;  5CD1 A;  3HL8 A;  4FL6 A;  3SD4 A;  3CCU A;  3CPW S;  4FU6 A;  1N9R A;  2QTX A;  3VJP A;  2RO0 A;  2DO3 A;  2YVL A;  3ZBD A;  5EG2 A;  5GAM j;  1Y71 A;  2EJF A;  3NFC A;  4KUI A;  3JCM V;  3X28 B;  5KH6 A;  3CCV A;  4R56 A;  4J6W A;  1H64 1;  4XTV A;  3DB3 A;  1YI2 A;  3HFO A;  2DKG A;  1LJO A;  1BKB A;  4NOY A;  4BY6 C;  2OTL A;  4J6Y A;  1YHQ A;  4A4K A;  2DXC A;  3HHT B;  3HP9 A;  4OB1 B;  2CYZ B;  3S3M A;  2E6N A;  2H3J A;  2DIG A;  4IUP A;  3JCM f;  4PKC C;  4M78 C;  2DZC A;  4TVR A;  3CCL A;  4J6X A;  4J5Y A;  3PIP A;  1M90 C;  1QVG S;  2X4J A;  4KT0 E;  2MAM A;  2K5L A;  2XI9 A;  3OBW A;  2E64 A;  2F69 A;  4PLL A;  3JCM e;  5GAN 8;  3FEO A;  3GLX A;  1UGQ B;  3EAE A;  3CCQ T;  3I55 T;  3JB9 H;  1JJ2 A;  5L8R E;  5LJ3 d;  3PMI A;  4A54 A;  4F7U G;  4F7U A;  1QP3 A;  4XU2 A;  2BIV A;  2ZGW A;  2RHY A;  3R6O A;  2LRQ A;  4JJN K;  3CCE T;  3M55 A;  2JN0 A;  4LDU A;  3JCM b;  1WNL A;  3OS2 A;  1VQ6 A;  3CD6 T;  2EQJ A;  1JBM A;  4ZN3 A;  1VQL A;  4C0D B;  1UGR B;  3MB5 A;  3QKJ A;  1M5Q 1;  2KSS A;  4E7J A;  3J80 E;  2Q1D X;  2P4T A;  3OSV A;  2RHI A;  3OB9 A;  4XTZ A;  3OYH A;  2VYT A;  4C8Q A;  5HKC A;  1Y07 A;  2O4X A;  4BD3 A;  3HKS A;  4XTY A;  4EMG A;  1H3Z A;  2KAF A;  1YIJ A;  1YJ9 A;  4LD9 K;  2P0K A;  4IKF A;  2OAU A;  1WLF A;  3FPR A;  2X4W A;  3PFS A;  4IUQ A;  3FPU A;  4AS1 A;  2JTM A;  4XAX B;  2QA4 A;  2KK4 A;  2DZ9 A;  1KQS A;  3MEU A;  1K73 C;  4L5G A;  2XHC A;  3CC7 A;  1U1S A;  2Y90 A;  3ZFJ A;  1K9M C;  5GAN d;  1BI2 A;  2LT4 A;  1X6O A;  3OQ5 A;  1ZQ1 A;  3MEA A;  5A0G A;  3P8B B;  3BFM A;  3MP8 A;  2R5M A;  4ZN1 A;  1NE8 A;  4BY6 B;  2LQK A;  4M7D E;  1O9S A;  4RMO A;  5KCO A;  1OZ2 A;  4EDU A;  4C92 E;  3QO3 A;  3S3O A;  4M75 E;  3M57 A;  4LDV A;  1FWZ A;  4M78 B;  4OMF B;  2E6Z A;  4QQG A;  2Q19 X;  3QWZ A;  3VYH B;  3I55 A;  2R58 A;  1O75 A;  4C5G A;  4BDZ A;  1MHN A;  5GLF A;  4M7A E;  2EAY A;  1KHI A;  2ZCF B;  1VUB A;  1N27 A;  3MP1 A;  4YTL A;  3L2Q A;  4MDX A;  2RJF A;  3VV0 A;  2PVD B;  2HQX A;  2DEQ A;  5GAM g;  4M7D F;  3PTA A;  1K73 U;  3TIW A;  1P92 A;  3ZJV A;  4C5H A;  3OYM A;  2RI3 A;  1OYX A;  3C95 A;  4M75 F;  4BUG A;  5GAM h;  4R55 A;  5GAO q;  2ZPH B;  3BDL A;  5LJ3 f;  3CCE A;  3CD6 A;  2DK3 A;  1YBY A;  4XTU A;  2A3L A;  3H6Z A;  3H8Z A;  3CMA A;  1GXI E;  1CR5 A;  2MMP A;  4M7A F;  1WQ7 A;  3JB9 F;  3QQ7 A;  1PSE A;  4MZT A;  3WVD B;  4BI4 A;  1NJI U;  3F70 A;  4IUU A;  2DTI A;  4JS4 A;  3CF2 A;  1KQ1 A;  2M1H A;  2LCL A;  2EFI A;  3RMQ A;  3FIF A;  1KHC A;  4E47 A;  1Q81 U;  2LW6 A;  5CR2 A;  1Q81 C;  4IUV A;  5LJ3 j;  2DTH A;  3N5B B;  3CCV T;  1M1K C;  1VQK A;  1QDN A;  4PJO B;  4Z02 A;  3JB9 I;  4L59 A;  2OTL T;  3HRT A;  4XU0 A;  3VU3 C;  3GP8 A;  5GAO l;  3JCM h;  3CC2 A;  2AHJ B;  3O8V A;  3LYI A;  4FSX A;  3OYC A;  2Q1C X;  3CBO A;  2FHD A;  3CCL T;  2QDY B;  3MEV A;  3JCM X;  4FM4 B;  3TU4 K;  2MM0 A;  2K3Y A;  2RK2 A;  4X9C A;  5AYF A;  1B34 B;  1S3S A;  3M53 A;  3M4Y A;  4J7I A;  3UWN A;  4EPC A;  5GAN f;  1VQ9 A;  4KOD A;  2E65 A;  3CCS A;  3HU1 A;  2O01 E;  1JJ2 S;  5DLO A;  2IG0 A;  2E12 A;  4N0A C;  2PWY A;  3X24 B;  5GAN e;  2ZZD A;  3CCJ A;  3OSS C;  1O54 A;  2XG8 D;  2PQW A;  4XTW A;  1G5V A;  4HT9 A;  2YLC A;  3NTI A;  2EJ9 A;  1UGS B;  2RB6 A;  4DOV A;  3GPL A;  5GAO r;  5CKH A;  3RMS A;  4F7U E;  1CZ5 A;  3VYG A;  1VQP A;  1VQ6 T;  4QQD A;  1OI1 A;  5GAN j;  3OYB A;  1VQL T;  1I4K 1;  4A4G A;  4M77 B;  3NTK A;  3OS0 A;  2ZPG B;  2CZ0 B;  3MHX A;  4BE1 A;  5GAN 5;  2DTO A;  2RM4 A;  5LL6 S;  1BI0 A;  4M78 A;  5DLQ E;  1YJN T;  4EMH A;  2XDB A;  2YUJ A;  3I56 A;  3OS5 A;  4JRK A;  4F7U F;  3CPF A;  1I5L A;  2M9U A;  3G71 T;  4UC4 A;  2K5F A;  2LDM A;  3TCJ A;  3QDR B;  3ZGZ A;  3UT1 A;  3C4S A;  3MEW A;  3RKW A;  2G3R A;  1YIJ T;  2KMT A;  1I81 A;  1YJ9 T;  3L2U A;  2F5K A;  5CKE A;  3SWN C;  1I8F A;  2D9T A;  3LGL A;  4MZP A;  2QA4 T;  4M7D C;  5FTK A;  5C1B A;  4BI3 A;  4ZTJ A;  3A8L B;  5I2M A;  4C92 C;  4JS5 A;  1LNX A;  3CC7 T;  3FRN A;  4M75 C;  5EQJ B;  2I2L A;  5GAN 2;  3GOX A;  2HD0 A;  5CO7 A;  3JCM P;  1M90 U;  3QZ5 B;  4C8Q F;  4PL6 A;  4GY5 A;  2LCC A;  2Y4Y A;  2QEX A;  4M7A C;  3OY9 A;  2RHU A;  1IZ6 A;  1QW1 A;  3JAM E;  1W2B A;  4KLN A;  2PUK B;  2JTF A;  3KUF A;  4PJO G;  1PSF A;  3G4S A;  4PJO A;  4N4G A;  3S3N A;  1RL2 A;  2EQK A;  3SDZ A;  3CCR T;  3QBY A;  5LJ3 g;  3X26 B;  2EWN A;  1HXD A;  4J7F A;  1EIF A;  1Q7Y U;  1VIF A;  2LTO A;  2R57 A;  3J7A F;  5FU7 C;  1Q7Y C;  5I2S A;  3CMA T;  3VKI A;  5KE2 A;  1ZC1 A;  2QQ9 A;  2R5A A;  1E32 A;  5C6S A;  3JRZ A;  3OYK A;  1B34 A;  4IUT A;  4C8Q D;  4AQ7 A;  5D6X A;  1QVF A;  5DY9 A;  5CQY A;  1YJN A;  2EYQ A;  4LDY A;  2B25 A;  3OS1 A;  1LOJ A;  4N4H A;  2VUB A;  4KO8 A;  4C8Q G;  3G71 A;  1VIE A;  4JRQ A;  2JVV A;  1VQK T;  2NLU A;  2B8A A;  5FU6 C;  4E7H A;  1QCS A;  4M77 D;  3ASK A;  4HKE A;  3QJ6 A;  5DM7 R;  3SB2 A;  4J83 A;  1K9M U;  3E19 A;  5HK3 A;  4ARC A;  3A5Z B;  4M77 G;  5I21 A;  4M77 A;  5GAN 7;  3V7S A;  2BKD N;  1K8A C;  3CC2 T;  2VGN A;  3SWN B;  5GAN g;  1Q82 U;  3QZ9 B;  1XOV A;  1KG1 A;  4C92 B;  3TRE A;  5GAN 4;  4M75 B;  5GAN h;  2MWP A;  1Q82 C;  1V29 B;  3M9Q A;  5HY6 A;  1VQ9 T;  4II1 A;  3CCS T;  4M7A B;  4LDX A;  3BQB A;  1NPR A;  4FIB A;  3FJP A;  4BI8 B;  3CCJ T;  2A7Y A;  1WJR A;  3L2W A;  4KBM B;  4FT2 A;  2RI2 A;  3J81 E;  2LVM A;  3CCR A;  3AHU A;  3L2Z A;  4OVA A;  2QQA A;  5GAO p;  2C06 A;  3G7Z A;  4XU1 A;  2LC4 A;  3M5A A;  3CCM A;  1VQP T;  1BI3 A;  3TEE A;  2P0Q A;  2YHT A;  3OYF A;  2E5Q A;  5FRN A;  3JB9 J;  2DPP B;  4IUR A;  5GMK l;  3GNG A;  3PIO A;  4MDW A;  1VQ7 T;  4MML A;  5CKB A;  5LJ3 e;  1YIT A;  5FU7 B;  3GIB A;  3QSU A;  4JLG A;  3MO8 A;  3UDC A;  1X75 C;  4P5N A;  5HK0 A;  5GAN 6;  3I56 T;  2DVE A;  3DB4 A;  2JUF A;  2HBP A;  5C18 A;  3DLM A;  1N8R C;  2Q18 X;  1M4Z A;  5CAI A;  5LJ5 d;  1M1K U;  1Y96 B;  1WJS A;  3V8J A;  3OYG A;  4RV0 A;  3G6E T;  1VQ8 A;  3OYD A;  4N0A A;  3HU2 A;  1XTD A;  2PUO B;  2K3X A;  3URG A;  5A2Q E;  5CQX A;  1G3T A;  5CVI A;  5FU6 B;  3CME A;  3JCM J;  3GNF B;  1KD1 U;  1M9S A;  1BI1 A;  4FT4 A;  2V8J A;  1KD1 C;  2EKO A;  2F5T X;  4KDI A;  1TH7 A;  2GFA A;  1N6A A;  3P8D A;  4BDY A;  2BUD A;  3LH0 A;  2QEX T;  1W4S A;  3LGA A;  3OA6 A;  5FTJ A;  3QC8 A;  2WSC E;  5CCB A;  4HCB A;  2JNG A;  5CK9 A;  2K57 A;  3MP6 A;  5FTN A;  1WJQ A;  3OYI A;  2XIC A;  3M59 A;  4XTX A;  4C0Z A;  1VQM A;  5FTL A;  4XK8 E;  3G4S T;  1WGS A;  1R8O B;  3RES A;  3KBG A;  3JCM d;  5FLX E;  3WXM B;  2EQU A;  3HSB A;  2DD5 A;  4A4F A;  2MM2 A;  3CBP A;  3L42 A;  4RCC A;  4LDW A;  3SWN A;  5IAY A;  2FVU A;  1Y7X A;  4A53 A;  5IN1 A;  4M78 D;  3OW2 A;  1M8V A;  3FPT A;  4C92 A;  3LHD A;  4OB3 B;  1VQ7 A;  2ZPB B;  4M75 A;  4Y28 E;  4ZGJ B;  5GAN 3;  4KUD K;  1M1G A;  3CC4 T;  4M78 G;  4RG2 A;  1WPY A;  5D6W A;  2RJC A;  2MI6 A;  3V8L A;  4C5E A;  2PJH B;  4PJO F;  4PLI A;  4M7A A;  3FLG A;  2Y4X A;  1XNI A;  1G3Y A;  2QQB A;  3QYH B;  3LW5 E;  4O5V A;  1UEB A;  4OGC A;  2CZ7 B;  4C8Q E;  3G6E A;  5GMK e;  2XU8 A;  3L2V A;  5M9O A;  4HT8 A;  4E7I A;  1CZ4 A;  1I9G A;  4JLI A;  4C0D C;  3HFN A;  5CKD A;  1G3S A;  1KQS S;  5FTM A;  4QQ6 A;  5LJ5 f;  5D6Y A;  4PNO A;  3ZJT A;  4ME7 A;  4OB2 B;  3V8K A;  3CEY A;  3QPH A;  3LWH A;  1KQ2 A;  2PVG B;  4XU3 A;  4QVZ A;  2RK1 A;  3CXC A;  1VQ4 A;  3BW1 A;  5GMK j;  5LJ5 e;  4N4I A;  5GAO n;  3QYG B;  2XD0 A;  5CCX A;  4ELY C;  4EMK C;  3E9G A;  4RG8 A;  2EJG A;  5J3B A;  4LD6 A;  3C12 A;  3QXE B;  1BYM A;  3ME9 A;  3QG1 A;  2PU9 B;  4PJO D;  3A8G B;  2PVO B;  3L1A A;  1Y96 A;  3OYA A;  5LJ5 j;  3PGG A;  2MF2 A;  1D3B B;  3MET A;  3ER0 A;  3VUB A;  4E7K A;  1KC8 U;  5EPP A;  4M77 F;  3E9F A;  3A8O B;  3FDR A;  1KC8 C;  3BDU A;  1VQ5 A;  5KE3 A;  2RJD A;  3S6W A;  1X01 A;  2D0Q B;  2GF7 A;  4OB0 B;  5LJ3 h;  3QHS A;  2RHX A;  2RJE A;  2XDD A;  3CCM T;  5FRM A;  1VQN T;  2K5I A;  3EFR A;  1VQO T;  3C94 A;  4MZM A;  3OYL A;  5GMK m;  2X35 A;  3HRS A;  3OMC A;  3FC3 A;  1S72 A;  2Q1A X;  2DAQ A;  1YIT T;  3CC4 A;  4CQN A;  3ZEH A;  2DD4 A;  2E10 A;  2X4Y A;  3X20 B;  4Q5W A;  3LLR A;  2XK0 A;  2QXF A;  4OGE A;  2OTJ A;  3ZJU A;  3WVE B;  3P8H A;  2XID A;  4A4H A;  4B9X A;  1Q86 U;  2JV2 A;  3Q1J A;  3JCM Q;  1VQ8 T;  1Q86 C;  3GF5 A;  3FB9 A;  4BE2 A;  4JUV A;  4OP0 A;  1NPP A;  4BB7 A;  1XQH A;  3T9N A;  4NL3 A;  2VV5 A;  3HRU A;  2CS7 A;  2L5Q A;  2HNI A;  3PNW C;  1YJW A;  1K8A U;  3CME T;  1FX7 A;  2KY9 A;  5GAO m;  3NTH A;  5B6C A;  3BY7 A;  2RD1 A;  1ZHI A;  4M7D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...