2KY9A

Solution nmr structure of ydhk c-terminal domain from b.subtilis, northeast structural genomics consortium target target sr518
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
MKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMVDYTSTTSGEKVKNHKWVTEDELSAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of ydhK C-terminal Domain from B.subtilis, Northeast Structural Genomics Consortium Target Target SR518
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein ydhK
total genus 26
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1130 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ky9A01
3.10.330.60 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2ky9A02
4FIBA 2KY9A
chains in the Genus database with same CATH superfamily
4PJNA 3CC4T 4BDZA 3TEEA 1E6HA 4RTVA 2K3YA 3EG2A 1Q82R 3U23A 1N6AA 2YUQA 3AHUA 2QQRA 2RK2A 2LQNA 5GAN4 1KC8C 3VS0A 5HK0A 4M7AF 1M90C 3FC3A 4ARCA 1SSFA 2D8HA 1K8AR 4BUGA 4M77F 2R5MA 2DZCA 4RG2A 3FPRA 2KRMA 1YITT 1T0JA 1BK2A 3TSZA 4MMKA 2MAMA 3EFRA 1OULA 1M27C 5GANf 1M2OA 2Q1CX 2YHTA 1HYOA 4IURA 5GAN2 1NPPA 1IHWA 3QZ5B 4LNPA 3L1AA 1X69A 3EAEA 5GJVB 1WHGA 1M1FA 3KBGA 4KRTA 3CXCP 4JLGA 2RQRA 2QEXA 1K1ZA 3CC2T 2DBMA 3OYDA 2KVQG 4M75F 1QVGA 1OEBA 1WJSA 2EVRA 2KNBB 5GJWB 1M3AA 4J9DA 5CD1A 2C0TA 1AWWA 4JPBW 4OMFB 1Y57A 3OA6A 2K2MA 5FWCA 4CC3A 1KHIA 3G71Q 2ZPHB 4M7AD 2RK1A 3QC8A 2E5KA 3G6EA 4XTUA 2JTMA 4FT2A 4J6XA 3OYJA 1UGQB 1KQSS 4PJOE 1MV0B 3CPWA 2QQBA 2FB7A 4C8QB 4DOWA 3JCMJ 4DBFA 3ASKA 8ATCB 4M7AA 3PGGA 1Y7XA 2DKGA 4A4EA 4GLMA 3X24B 1VQOT 1I1JA 4JJCA 2K6DA 4C8QD 2QEXQ 3H0IA 4HT9A 4ELYC 4JRPA 1WLPB 1MMDA 5IT9E 2YXYA 2RJDA 2J05A 2KDSA 3V8LA 5LL6S 3KXTA 5LJ5f 3VUZA 3LLRA 1FXXA 2X35A 1BIBA 3HRUA 4BE0A 1K73R 4DQ2A 2LTOA 4QVDA 3OW2A 3UA6A 2JUFA 2PWYA 2CUBA 4M7DB 3A8OB 1KD1R 4AQ7A 4LDWA 2NUPB 2E64A 2W0ZA 4PLIA 3G7ZA 3CC7Q 2DLPA 2LP5A 1QMCA 3LGFA 3QWYA 1C6VX 5C6SA 3JCMV 5FROA 1YITA 1EFNA 3WXMB 1TUGB 2HSPA 1K73C 2ROLA 2HKNA 1N9SA 3LW5E 3MPUB 4LUDA 3V7CA 3CPWS 2YWWA 1OOTA 2E6NA 1M30A 2K79A 2HBPA 4XU0A 5FWBA 4YTLA 1WHJA 2CDTA 3BQBA 4E7ZA 3V7RA 1VQ7T 3OYBA 2LNHB 3META 4F7UA 4LD6A 1K76A 4KH1B 1QKXA 3VYHB 1M9SA 1VQKT 3MHXA 3TQ7P 2G6FX 5CCAA 2JTFA 1YITQ 1UJ0A 2RHXA 3QO3A 3G6EQ 2H8HA 2X3XD 1KD1C 3FLGA 4DBHA 3RKWA 2QTVA 1ZSZB 3M5AA 2BZYA 4ELZC 2A36A 2DYBA 3OYGA 1G3SA 1TS9A 3M59A 5D6YA 2RQTA 2RB6A 2K2VA 4E7LA 4Y28E 1CZ5A 3CC4A 2DYIA 2V8JA 2P0QA 2LZ6B 2Q18X 3CMAA 2LX7A 1EIFA 3M55A 3HRSA 4MZTA 2B25A 1WJQA 3BY7A 2E6ZA 2VC8A 5GAMd 1I9GA 1YHQA 1RL2A 4F7UG 3QJ6A 3ZJUA 4LN2A 1I07A 3OS5A 4NL2A 4PJOF 4AS1A 1OYXA 1VQ8Q 1HK9A 3M0QA 2RQUA 2A08A 2NYSA 3FPUA 8AT1B 4FW1A 2QQ9A 2YT6A 3OSVA 2XI9A 1G3TA 1SG5A 5EPPA 1M2VB 4J7FA 2KT8A 2LVMA 5A0GA 3QYHB 1JU5C 4C0DC 4P5NA 2LT1A 1YP5A 2A3LA 3CBOA 5KE2A 3GPLA 4RCBA 2L8DA 3ZEHA 3CD6T 4ARIA 2V8IA 1AWXA 1TH7A 1XJWB 3LWHA 3ZJTA 1N8RC 1G8XA 4OGEA 2HQXA 1W1FA 3CD6Q 1VQ4A 3OYAA 3A98A 2DD4A 1ZA2B 3FIFA 3SWNB 1T0HA 4HVUA 3LH5A 3HU3A 4BE1A 1W2BP 1PD1A 2X3WD 1PSFA 1M1KR 3OSSC 3TCJA 2K7AA 2EW3A 4VUBA 4M7DD 1Z9QA 1TUCA 3HSBA 3JRZA 1Q7YC 4IUPA 4JZ3A 1LPLA 2DXUA 4QW2A 3CQTA 1I4K1 2X4YA 3MEWA 2D1XA 1UECA 3CCJQ 5FU6C 3CCSQ 2KRNA 1W70A 4XK8E 1OU9A 2DA9A 5DM7R 1NJIC 2JM9A 1QVFS 1XTDA 1H8KA 4JUVA 1RAGB 4OMLA 5FU7B 1Q7YR 2BTTA 2QA4A 3QIIA 2JS2A 1QVFA 1XQHA 2XMFA 2ZPGB 2OTJQ 3JCMW 5CKDA 2BE7D 4PJOB 2RI5A 4IIMA 3TU4K 3I56T 2EGCA 4L59A 1WYXA 5LJ5h 1HD3A 3CCET 5CQXA 1CKBA 5ERGB 3CCRQ 1VQMT 2GF7A 1I0CA 2PZ1A 2DL8A 2QG9B 3Q1JA 4PNOA 2EBPA 5A0DA 4Y91A 3CXCA 2HQHA 2W10A 4QT7A 9ATCB 4NOYA 4XU3A 1NE8A 1WXBA 4ZGDB 3MP8A 2V1QA 1WA7A 1ABOA 3H8ZA 1BB9A 4GBQA 4ZNXA 1VQ9A 4PKCC 1EX4A 5J39A 4KGXB 2E65A 2PTKA 3MB5A 3MEAA 2L0AA 4FU6A 3CCQT 5GAOm 4M7DG 3MCAB 1EZZB 1BKBA 3OYMA 1WHLA 2LC4A 1UUEA 4J7IA 5GLFA 4EDUA 4AFUC 1D1CA 2P4TA 2E12A 2O4XA 1S72T 1K9MU 1XOVA 1YJ9T 4J9HA 3OMGA 1A0NB 4C8QF 2CZ6B 3G71A 3CBPA 2D9TA 4BD3A 2AZVA 1S72Q 1IGQA 4F16A 1YJ9Q 2CSQA 1SHFA 3QZ9B 1KD1U 1E32A 2FL7A 2JMAA 2DERA 1PRMC 1ZLMA 1LCKA 5M9OA 2EAYA 3IQLA 1Y96A 3GF5A 2X4XA 2KEAA 1RADB 3NTHA 2CGHA 2PU9B 4B9WA 4PFZA 1RAFB 2Q1AX 2HCKA 4HA8A 2EFIA 4XAXB 2CZ0B 3PE0A 3JCMX 5KYUA 1X6OA 3L2QA 3PT9A 1CKAA 4A4GA 4RCCA 2ZPIB 4M7AC 1E7OA 1R0BG 1W4SA 4HCKA 2HQEA 3MKDA 1M90U 4HCCA 1OI1A 3CCRA 2DM1A 2KXCA 1D0ZA 3LGLA 2YUJA 2Y90A 3MP6A 2X4WA 1SKUB 3CCST 3P8BB 1Z9ZA 1BYMA 1Q95G 1AZGB 4OMOA 3M0UA 2XIDA 2K3BA 3VKIA 1OU8A 1JJ2P 3VU3C 1FMKA 1VQPA 4XTXA 2EJGA 1BIAA 4N4IA 5LJ5e 4IIOA 5HK3A 1DJ7B 3QWZA 1PG5B 1VQ5T 1JJ2S 2I2LA 5AYFA 4M78F 2M0YA 3CCJA 1YFNA 1RI0A 3TVTA 4L5GA 4PJOG 3CCVQ 2EGEA 1TSFA 1VQ5Q 4FM4B 5GAMf 3JCMQ 1PC0A 2FEIA 3SEMA 1PD0A 1UJYA 2EQUA 1NBEB 2DBKA 3MP1A 5HKCA 2GFUA 2BE9B 3RMSA 3VJPA 4C92E 1K9MC 5D6WA 1N9RA 4M78A 2EQJA 2RPNA 3V7SA 3UT1A 3R6NA 4BI8B 1D1BA 2JTEA 3GP8A 2V8KA 2QA4T 3QKJA 4BDYA 1QP2A 3SFMA 4GY5A 2FPDA 3HL8A 2KYMA 3OYEA 1Q86R 2QA4Q 2EYWA 1NZ9A 5GAMh 1ZHIA 1YIJT 3A1PA 2DRMA 2XDDA 3HU1A 5IXFA 3CCLT 3P8DA 2HSEB 3GNGA 1UHCA 3EGXA 3VV0A 4JRQA 1ZUYA 3NTIA 1H3HA 3ME9A 4EMKB 2FO0A 4OB0B 1JJ2A 1I8FA 4QQGA 1R0CB 3EFSA 4C0GA 5GANh 4M77A 4QVZA 3EG9A 2CUDA 3F70A 1GCQA 3UDCA 1KQSA 2ENMA 4AG2C 2QEXT 1VYUA 5LJ3e 1OX8A 1WHHA 2WSFE 2GNCA 3CMEQ 1PSEA 5IN1A 2ED1A 2COWA 2J06A 1WZOA 3CEYA 3S3NA 4HKEA 3C95A 4LDXA 1V76A 2FZKB 4A53A 4KUIA 3CPFA 1JXOA 3X20B 4E7IA 2MYSA 4JRKA 2YUNA 1KSWA 3RDVA 4DOVA 1OV3A 2JXBA 3PTAA 3A5ZB 3E9FA 2KBTA 1VQ7A 1M4ZA 2KK4A 2RJCA 2XG8D 1LVKA 3BFMA 5GMKi 3CC7A 5D6XA 4FIBA 1D3BB 2X9HA 1SF9A 5KH6A 3I55Q 1OZ2A 3CPWP 2DRKA 2FHDA 4IUTA 1X6BA 1TXQA 5ECAA 2GCXA 1AHJB 5I22A 1WXTA 3E1SA 2VVKA 1BI2A 1X6GA 1VQ6A 2X51A 4PK4A 1GFDA 5EQJB 3ZL7C 1TG0A 2MMPA 3CCUT 4FT4A 2LJ1A 4R56A 2P0PA 4II1A 2IIMA 3EGUA 2OI3A 2CZ7B 2E10A 1VUBA 2L3RA 3HHTB 1K9AA 2DK3A 2KGTA 1MNDA 4ME7A 5GMKm 2DXTA 2MIOA 5L8RE 2AT1B 1K8AU 4ZN3A 2LJ3A 2O2OA 3ER0A 4BB7A 2MPXC 2A7YA 1MUZA 2IPOB 4KT0E 2DMOA 4PLLA 1QCFA 3JAME 4M7AG 4KULA 1PKTA 3EH1A 2E4HA 5L23A 4C0FA 2J6OA 1VQLT 5I2SA 4OVAA 3X28B 2C0IA 3VS1A 2OTLQ 5KYXA 4D8KA 2DIGA 1KQ1A 1Q81C 1X01A 4D8DA 4K11A 1ZQ1A 4OMPA 3I56A 1NJIU 3T9NA 2ROTA 3UA7A 4PL6A 4J6YA 4OB1B 3MEUA 5AT1B 5IH2A 2QDYB 7AT1B 1KFZA 3M56A 5CKEA 5I11A 2MWOA 3JCMg 3G1JA 2DX1A 1N8RR 1GCQC 3L2WA 3BE3A 1MMGA 1UEBA 2I0NA 1WLFA 2XK0A 4LD9K 2KT1A 5C18A 1VQ4Q 3UPUA 3NMZC 2LCSA 1Q81R 1X2QA 2BKDN 2E5QA 3PMIA 5GMKe 1GBQA 2JN0A 3L42A 3SHWA 4FSXA 1WGSA 1RACB 4M78C 4HT8A 5CKBA 2KROA 3OYIA 4F04B 1RLPC 4FW2A 4OB3B 2QK0A 1CR5A 3CMAT 3FDRA 4X34A 5CKFA 4ZTFA 1Q86U 2PQWA 1ZX6A 2L3SA 5GMKh 2HZYA 5FLXE 1QKWA 3QDFA 5GANj 4M77B 1ZBXA 2DETA 3QQ8A 2RD1A 5FTJA 1FYNA 3CCUA 2PVOB 1AWJA 3A8LB 3TSWA 5IHNA 4M75D 1YHQQ 5LJ3h 5FU6B 3EG9B 4JZ4A 1VA7A 2MM0A 2DIQA 1JO8A 1VQNA 2OX7A 2DILA 2EGAA 3X26B 2AIRB 4DBQA 2RMOA 3JCMe 2RA2A 1CSKA 3QSUA 1Q81U 1O75A 6AT1B 2RHZA 3CCUQ 3QYGB 2GTJA 2EYXA 4J9BA 2DEQA 1U1SA 5CR2A 2JJ9A 1KJWA 3SWNC 1M8MA 3I9QA 4ZN1A 3CCMT 4AFSC 2YDLA 2YUOA 2O31A 4RTUA 3JCMh 1UG1A 3OYNA 5FRNA 5LJ3j 4J6WA 2K3XA 1NPRA 2DTOA 1TOVA 3HFNA 2ED0A 3CC7T 1X43A 3O8VA 2DD5A 3LHDA 4C92C 5FRMA 4R0KA 3ZJVA 4C0DB 2J6KA 2PUOB 3RIRA 4FYXB 1G2BA 3L2ZA 2DL3A 1ZUKA 2BZ8A 3UF4A 4M7DA 2GTOA 1PNJA 3CCJT 1VQOA 5CKHA 1K0SA 4HVWA 2RQVA 4A54A 2OAWA 2DVEA 3M58A 1X75C 4F14A 3NFCA 4IKFA 3C94A 3EHQA 4LDUA 3FB9A 3A8GB 3OW2P 2KY9A 2NUTA 5I2MA 1YN8A 4PJOD 3UATA 1UGSB 3EG0A 2RJEA 1IREB 2JVVA 4BE2A 1M1GA 2QAZA 2RI3A 4RTTA 1X2KA 2BIVA 1K9MR 4AMCA 4MDWA 4PJOC 2FRWA 1ACMB 3CCRT 3WVEB 1ARKA 4C5EA 4V2SA 3NPFA 4J9GA 5KCHA 5GAOl 2L2PA 3ULRB 1W6XA 1OX9A 1YIJA 2MCNA 5FU7C 3NGPA 1CZ4A 2B86A 1UE9A 1JEGA 3CMET 2DNUA 4C5HA 1QWFA 1Q82C 5GAMe 1VOMA 1ZSZC 2AHJB 5J3BA 3JB9G 1Y71A 1BCOA 3JCMP 4FYWB 1LJOA 4M75B 2D6FA 3CCQA 2HL5C 4EMKA 2F5TX 2WSCE 2LMJA 4A63B 3OBWA 2KE9A 4WF2A 2YRCA 1VQPT 3JSCA 2DJZA 1VQ9Q 4C8QA 1ZA1B 2JMCA 1PKSA 1D09B 2MWPA 3MJXA 5GAN3 2EQMA 3TIWA 5KYUB 1VQ5A 4TVRA 2VKNA 1QQJA 4JS4A 5DYIA 4C92D 3QJYA 1N5ZA 4ORZA 1BU1A 2LNVA 5GAOp 2FZCB 2D0NA 2K5FA 5FTKA 3J80E 1B34B 5A0LA 3L2RA 1VQ8T 4M7DC 1KQ2A 2JT4A 5FTMA 3OBYA 3VS3A 1U06A 2BUDA 5KYWB 1UB4A 2P84A 3H0FA 4WTOB 2J7IA 3CCLA 3DLLA 4M77E 5GAN7 5KYNA 3VS2A 2ESWA 1W2BS 2VB6A 2RF0A 1PM3A 1WNLA 4F17A 1QVFP 1ZC1A 4M4ZA 2V1RA 3JB9D 1K0XA 2VUBA 1QVGP 2A0FB 2RM4A 3CCSA 5FTNA 1TTHB 3HP9A 4XTYA 2MI6A 5LJ5d 3J81E 5FW9A 2CS7A 4ANJA 3OMCA 1KQSP 1KIKA 4KDLA 3QUIA 1WJRA 1UTIA 4XTVA 3CCEA 1NEGA 2E1HA 4DA4A 1U5SA 4KUDK 3PIPA 1VQ4T 3C12A 1I5OB 1ZSZA 3EG3A 4FL6A 2Q19X 1M3CA 2EYYA 2LQWA 5GANe 2GGRA 1UGVA 1YI2Q 1IRXA 1UGPB 2LX9A 2RQWA 2DL5A 2EKOA 2YUPA 4MMLA 4IUQA 1MGQA 2AZSA 4C92F 4EPCA 1HJDA 2HEQA 4F7UF 2E70A 2MF2A 3CCVA 4FYYB 2XD0A 2K57A 4QKUA 5GANg 1VIFA 4N0AA 4M7AE 4BACA 2F2XA 2R5AA 3VS7A 2JV2A 4M7DE 2O9VA 3RKYA 2EKHA 3PNWC 3G6ET 3DB4A 3R6OA 4Y92A 5KYYB 5CVIA 1SRLA 4NS5A 4C8QG 2F1LA 4PJOA 2OTLA 1RUWA 4Z8AA 1QCOA 3CCLQ 2RHYA 3INZA 2FYKA 3G71T 1KG1A 3V8KA 1WDXA 2OJ2A 3VS6A 2Y4YA 4X1VA 3X25B 2EQIA 2QQAA 5LJ3f 4GLKA 4RUGA 2HAXA 1WIEA 2L3QA 3BW1A 2HBWA 1GRIA 1QW1A 1WI7A 5LJ3d 1YJNQ 2K4YA 4XTWA 3I55T 3CC2Q 2L5QA 5IXBA 4B9XA 3GBQA 3O5ZA 5IHKA 4KGVB 2QI2A 3LX7A 1M1KC 1YJNT 1RAHB 2R57A 2QASA 3PMTA 1KK7A 4RV0A 2D0QB 3THKA 4X9CA 3PFSA 4O5VA 1YJWT 4EMGA 3JB9I 2DXCA 5GMKj 1HSQA 4MZPA 4C8QC 5GAOn 1YJWQ 1BBZA 2VASA 3M9QA 2EJFA 2CP3A 2CT4A 3M57A 3J7AF 1K4US 4MZMA 4BI3A 3PIOA 2FPEA 3LH0A 1UHFA 1VQOQ 3JB9F 4KBMB 1JXMA 3FJ5A 2DL4A 1YJ9A 4JJBA 4LE9A 1VYTA 4A4HA 3C0CA 1X27A 2QGFB 3EHRA 3DLMA 4JS5A 2DL7A 2H3EB 1JQQA 4LUEA 1PWTA 4M75C 5IHIA 1BI0A 3GIBA 1AT1B 4XTZA 2CREA 3QWXX 2JM8A 5CCXA 4E47A 1VQ6Q 3E2UA 2LW6A 4M7DF 2LRQA 1NLPC 4L6V5 5EG2A 3C4SA 4KH0B 1C0MA 2K9GA 1YWPA 3RR6A 2OTLT 4J5YA 1VQLA 4C92G 4M77C 1G5VA 5I21A 2LDMA 1AEYA 2IVWA 1JRIA 1UDLA 2HDAA 3OB9A 2KXDA 2COZA 2MM2A 4Z02A 3H6ZA 2QYZA 2EYQA 4UC4A 1YBYA 2BZXA 1VQKQ 1IO6A 3EGDB 3QXEB 2LCLA 2C0OA 1SHGA 2EJ9A 1OQKA 3CCMA 1QVGS 2L3PA 3URGA 5D7UA 3OYCA 3H9NA 1YJNA 1G3WA 4M78B 4QVCA 4JDSA 3HKSA 4E7SA 3CMEA 3CCQQ 2VXFA 2JS0A 1WPYA 2GQVA 3BDLA 3RNJA 4Q5WA 1AOJA 2KYBA 2VXEA 1VQMQ 1B3QA 3LGAA 5J26A 2PJHB 4RG8A 1M5Q1 4N0AC 1M8VA 1NG2A 1OZ3A 1VIEA 2M9UA 4C92B 4CI0C 3M53A 3OYYA 2VGMA 1WFWA 1U8RA 5CO7A 2DJQA 2JZ2A 1GL5A 2CH4A 3QBYA 3DB3A 2YVLA 4BY6B 2DFUA 3GNFB 1YIJQ 4PFOA 1IB8A 2FG0A 2DTIA 3M4GA 4XQ3A 2M02A 4OMNA 5KYWA 2YLBA 2RO0A 1U3OA 2VYTA 1AWOA 2ATCB 4M78G 2DZ9A 2P4RA 4M78E 4OMMA 4O6JA 4N4GA 4D6WA 3RESA 3PVLA 2O88A 3OW2S 4CC2A 2LT4A 1E6GA 2MK5A 2YRDA 3I55A 3LWIA 2KQWA 3D7SB 1B07A 1I81A 4B6MA 4CC4B 1VYVA 2E3IA 1MMNA 2CP2A 5KCOA 1R77A 1SRMA 4XU1A 3G4ST 2C06A 4AFQC 2D8JA 1IZ6A 2JOYA 4J9EA 2PVDB 1U1TA 3N5BB 2DO3A 5HCKA 3S3OA 4HXJA 1BI3A 1YWOA 1QLYA 3CCMQ 1ZBJA 3HFOA 2EWNA 5FTLA 1RAEB 3RKXA 2RHIA 4EMHA 2AKKA 2COYA 1NM7A 2RJFA 2RHUA 3SDZA 2VGNA 1WX6A 5DLOA 4CQNA 4IUVA 1WXUA 4M77G 1R7RA 1Y07A 1QCSA 5KE3A 1H641 4OB2B 1KHCA 2JW4A 3H0HA 3VS4A 1VQMA 1PCXA 1FWZA 2HNIA 3A8HB 5GAMj 2DF6A 4KO8A 4HVVA 1QCNA 3EFOA 2DVJA 1H3ZA 3HPWA 2CH4W 3CCEQ 2KMTA 1RAIB 3QPHA 1IGUA 4KLNA 4M75A 1G83A 2JNGA 1J3TA 4PJMA 2GBQA 1T3LA 3M4YA 1VQ7Q 2ZPFB 5DYGA 4PJLA 4C5GA 3VYGA 4WCIA 4LXCA 3M54A 4M78D 1YI2A 2B8AA 2K5IA 1ZSGA 2CSIA 4EMKC 3QDRB 3E9GA 1OPKA 2A37A 2NUPA 5LJ5j 2XHCA 1Y96B 1OPLA 3EFOB 2QXFA 4DBRA 1Y0MA 2XU8A 2NUZA 1QP3A 3KUFA 5CAIA 3CF2A 5HY6A 4R55A 4ZGEB 2Q1DX 2CP0A 3ZBDA 3CC4Q 1MMAA 1NYFA 4E7HA 4RKUE 2WACA 1TWBA 4RTZA 2L89A 3MO8A 4MDXA 3E19A 3SWNA 3RERA 3OS2A 3CBMA 1F1BB 4QQ6A 2SEMA 2YRVA 4X9DA 2J6FA 2M1HA 1NYGA 5GMKl 3CXCS 2R58A 3FEOA 4PFPA 3CC2A 2DXBA 2KRSA 4JJNK 3RBBB 2ZAEA 3OYKA 2E41A 2NUTB 4E7JA 1VQ9T 4C92A 4QQDA 5GAN6 2ZPBB 1D0YA 1WHMA 4KODA 2HMAA 1M1KU 2VV5A 2HKQB 3OS0A 4PJJA 5LJ3g 5CK9A 1N27A 3G4SQ 3JCMd 3EG1A 3FPTA 2XICA 2RN8A 2V26A 4E6RA 1P92A 2XDPA 2OTJA 1LOJA 2M16A 2E3HA 1FX7A 4JLIA 3ZFJA 3OYHA 4RTXA 2GQIA 5B6CA 4BI4A 4FSSA 1TUDA 5C1BA 2DAQA 5IAYA 4ATOA 4KGZB 1XNIA 3HRTA 1MV3A 1H92A 4CRIA 4F7UE 1Q82U 3M0TA 1QVPA 1M90R 1G3YA 2LJ0A 3SD4A 3UWNA 3REBB 1T3SA 2YLCA 2HD0A 3S3MA 1I5LA 1VQNQ 2Y4XA 1JB0E 4C8QE 1O9SA 2VWFA 5CQYA 3QQ7A 1VQNT 5KYYA 4N4HA 4A4KA 5DLQE 2FPFA 4RTYA 2QTXA 2O9SA 4J9FA 1QDNA 3EGDA 1JBMA 3OY9A 3JB9H 1RAAB 4AT1B 2ABLA 1Q7YU 2F5KA 4ZGJB 1IHVA 2KAFA 1GXIE 1R8OB 3M0PA 4OMQA 1YCSB 2PVGB 2XKOC 2WSEE 4M75G 3WVDB 4BY6C 1V29B 3FJPA 4DEYA 3PVQA 2QQSA 3L2UA 3VRZA 3OS1A 1K73U 5GANd 1KC8R 2EQKA 4J9CA 3AT1B 2LQ8A 2DEUA 2QDLA 2LCCA 2ZCFB 3EGXB 3JCMc 3MEVA 1VQKA 1SEMA 1NEBA 1RI9A 2ZZDA 2FVUA 4LDVA 2GFAA 1QWEA 1D1AA 4IUUA 5CCBA 4NL3A 1MHNA 4J8OA 2EYZA 3SB2A 2PNIA 3HTRA 4RTWA 2RI2A 5EC7A 1YCYA 2K5LA 2DTHA 4E2FB 5GAMg 2PUKB 5GAN8 1K8AC 3FRNA 2CP7A 1D0XA 5GAOq 1NLOC 2A28A 1O54A 2F2WA 3JV3A 4M77D 2OTJT 2MOXA 5CIUA 1N8RU 3I56Q 1D3BA 2F2VA 3V8JA 2CZ1B 5LJ5g 2KSSA 1BCMA 2RH2A 3KFVA 4CC7A 2O01E 5GAOr 1VQPQ 1UGRB 2CT3A 4HCBA 1YHQT 1WQ7A 1AZEA 1IXDA 2YSQA 1NJIR 1HXDA 3CMAQ 4ZTJA 3REAB 1S3SA 4JRIA 2DE0X 2ZGWA 4M7AB 1KC8U 1AD5A 2FZGB 2F69A 4Z89A 2M0OA 4M75E 3H41A 1WQWA 1PHTA 1YNZA 4Z88A 4OP0A 3HU2A 4J9IA 5C0MA 3OYFA 1YJWA 4XU2A 1FMWA 3G4SA 2DPPB 1GCPA 2RNAA 3I5RA 2AKLA 2CYZB 2G3RA 1Q86C 1AVZC 2KI7A 1FMVA 1SSHA 1RABB 3ZGZA 3CD6A 2Z0WA 3A8MB 4OF1A 1C1AA 3VUBA 2X4JA 1M2VA 1LNXA 4AFZC 4LDYA 2EIFA 2ZPEB 4FYVB 3BDUA 5DY9A 1V1CA 4J83A 3NTKA 2ECZA 3JB9J 4FCYA 3RUXA 4C5IA 5KYXB 1PRLC 1VQLQ 2P0KA 3L2VA 2XDBA 2SRCA 5A2QE 3M0SA 3VS5A 2EPDA 4A4FA 2LQKA 2M51A 3JCMb 3LYIA 1B34A 2AK5A 3DKMA 2H3JA 4AG1C 1W2BA 2NWMA 3EH2A 3I35A 3S6WA 3QG1A 2OAUA 3GOXA 3M0RA 4JJDA 2IG0A 2FRYA 1S1NA 4KDIA 4DEXA 2CP5A 1VQ6T 1M3BA 4ESRA 4E7KA 2CKKA 1VQ8A 1B7TA 2O4XB 1TU0B 1WHKA 2KR3A 3NHNA 3CCVT 1GFCA 3GLXA 1GBRA 1ABQA 3P8HA 1MNEA 1UFFA 3RMQA 4OGCA 1SPKA 2NLUA 3I5SA 4F7UB 1YI2T 4RMOA 3JCMf 1S72A 5GAN5 3QHSA 3VRYA 3OYLA 2QGGA 4HCZA 1ZUUA 3OQ5A 1BI1A 2HL3A 4EIKA 1RLQC 4C0ZA 3TREA 2CP6A
chains in the Genus database with same CATH topology
1Y96A 3GF5A 2X4XA 3CC4T 4BDZA 3NTHA 1UGSB 3TEEA 2CGHA 3OW2S 2PU9B 4B9WA 2RJEA 2LT4A 2K3YA 3LWIA 2Q1AX 3I55A 1IREB 2JVVA 2KQWA 1M1GA 4BE2A 1N6AA 3AHUA 1I81A 2QQRA 2RI3A 2RK2A 2BIVA 5GAN4 1KC8C 4MDWA 4PJOC 4HA8A 2EFIA 5KCOA 5HK0A 4M7AF 1M90C 4XAXB 3CCRT 2CZ0B 4XU1A 3FC3A 4IKFA 4ARCA 3WVEB 3JCMX 3G4ST 2C06A 1SSFA 4C5EA 4V2SA 1IZ6A 1X6OA 2JOYA 4BUGA 4M77F 5KCHA 5GAOl 2R5MA 2DZCA 1U1TA 2PVDB 3N5BB 3PT9A 4RG2A 3FPRA 2DO3A 4A4GA 4RCCA 2ZPIB 4M7AC 1W4SA 1YIJA 1YITT 5FU7C 2HQEA 3S3OA 1CZ4A 1M90U 1BI3A 1OI1A 4HCCA 3CCRA 4MMKA 2MAMA 3EFRA 5FTLA 3HFOA 2EWNA 5GANf 2Q1CX 2YHTA 2RHIA 3RKXA 4EMHA 3CMET 4IURA 5GAN2 4C5HA 1NPPA 2RJFA 3LGLA 2YUJA 1Q82C 5GAMe 2Y90A 3MP6A 3QZ5B 2RHUA 2X4WA 2AHJB 3SDZA 3L1AA 2VGNA 3P8BB 3CCST 1BYMA 3EAEA 5DLOA 4CQNA 4IUVA 5J3BA 4M77G 1R7RA 2XIDA 3VKIA 1Y71A 3JCMP 3JB9G 1Y07A 1QCSA 1M1FA 3KBGA 1H641 5KE3A 1LJOA 4JLGA 4OB2B 1KHCA 3VU3C 1VQMA 1VQPA 4M75B 4XTXA 2QEXA 2EJGA 1BIAA 1FWZA 4N4IA 3CCQA 2HNIA 3A8HB 5GAMj 3OYDA 5LJ5e 2KVQG 4M75F 1QVGA 3CC2T 4KO8A 4EMKA 2F5TX 2WSCE 5HK3A 1DJ7B 1WJSA 3OBWA 3QWZA 4WF2A 1VQ5T 1JJ2S 3HPWA 1H3ZA 2I2LA 5AYFA 1VQPT 3JSCA 2DJZA 4M78F 2KMTA 3QPHA 3CCJA 5CD1A 4C8QA 1RI0A 4OMFB 4KLNA 4M75A 3OA6A 2JNGA 4L5GA 4PJOG 4FM4B 1KHIA 5GAMf 3JCMQ 2MWPA 5GAN3 3TIWA 2EQMA 2ZPHB 3M4YA 4M7AD 1VQ5A 2RK1A 4TVRA 3QC8A 2ZPFB 2EQUA 2D6FA 5DYGA 3G6EA 4XTUA 2JTMA 4FT2A 4C5GA 4J6XA 4JS4A 5DYIA 4C92D 3VYGA 3QJYA 3OYJA 3MP1A 5HKCA 1UGQB 2GFUA 1KQSS 3M54A 4M78D 1YI2A 2B8AA 3RMSA 3VJPA 2K5IA 4PJOE 4C92E 4EMKC 1K9MC 3QDRB 3E9GA 3CPWA 2QQBA 2FB7A 5D6WA 1N9RA 2LNVA 4C8QB 5GAOp 4DOWA 3JCMJ 4M78A 5LJ5j 3ASKA 2EQJA 2K5FA 3V7SA 2XHCA 3UT1A 3PGGA 3J80E 1Y7XA 1B34B 2DKGA 4A4EA 1Y96B 4BI8B 5A0LA 3L2RA 1VQ8T 4M7DC 3X24B 1KQ2A 1VQOT 4C8QD 5FTMA 4HT9A 2QXFA 3OBYA 4ELYC 4JRPA 2XU8A 3GP8A 2V8KA 2BUDA 2QA4T 1QP3A 5IT9E 3QKJA 3KUFA 2RJDA 1UB4A 5CAIA 3CF2A 5HY6A 2KDSA 3V8LA 5LL6S 1QP2A 4ZGEB 4R55A 5LJ5f 3SFMA 4GY5A 3VUZA 3KXTA 3DLLA 3CCLA 4M77E 5GAN7 3OYEA 3HL8A 3LLRA 1FXXA 2Q1DX 2X35A 1NZ9A 1BIBA 5GAMh 3HRUA 1ZHIA 4BE0A 3ZBDA 1YIJT 1W2BS 4DQ2A 2LTOA 4QVDA 4E7HA 3OW2A 4RKUE 2XDDA 3HU1A 2WACA 1WNLA 2JUFA 3CCLT 2PWYA 3P8DA 2L89A 3MO8A 3GNGA 4M7DB 1ZC1A 3VV0A 3A8OB 4JRQA 4MDXA 3E19A 3NTIA 3SWNA 3JB9D 4AQ7A 4LDWA 2VUBA 2RM4A 3OS2A 3CBMA 3RERA 3CCSA 2E64A 4QQ6A 5FTNA 4PLIA 2YRVA 3ME9A 4EMKB 3HP9A 4OB0B 3G7ZA 1JJ2A 4X9DA 1I8FA 4XTYA 2MI6A 3EFSA 4QQGA 4C0GA 2M1HA 3LGFA 5LJ5d 3J81E 5GANh 4M77A 2CS7A 4QVZA 5C6SA 5GMKl 3OMCA 3F70A 3JCMV 5FROA 3CXCS 1YITA 3UDCA 2R58A 3FEOA 3WXMB 2QEXT 1KQSA 5LJ3e 3CC2A 2DXBA 2WSFE 1K73C 4JJNK 4KDLA 1PSEA 1N9SA 1WJRA 3QUIA 3LW5E 4XTVA 5IN1A 3V7CA 3CPWS 3CCEA 3OYKA 2E6NA 2E1HA 2E41A 4E7JA 4DA4A 1VQ9T 3CEYA 4C92A 4KUDK 4QQDA 3PIPA 4HKEA 5GAN6 2HBPA 3C95A 2ZPBB 4XU0A 3S3NA 4YTLA 1VQ4T 4LDXA 4KODA 3C12A 3BQBA 1M1KU 2VV5A 3V7RA 4A53A 1VQ7T 4KUIA 3CPFA 4FL6A 3OS0A 3OYBA 3X20B 5CK9A 5LJ3g 4E7IA 1N27A 3META 2Q19X 4F7UA 4LD6A 3JCMd 5GANe 4JRKA 3FPTA 2XICA 3VYHB 1M9SA 1VQKT 3MHXA 4DOVA 1P92A 1UGPB 5CCAA 2LX9A 3PTAA 2JTFA 2EKOA 2XDPA 3A5ZB 3E9FA 4MMLA 2OTJA 4IUQA 1VQ7A 1MGQA 1M4ZA 2KK4A 2RHXA 3QO3A 1LOJA 4C92F 4EPCA 2M16A 1KD1C 2RJCA 3FLGA 2E70A 2XG8D 3BFMA 1FX7A 3RKWA 4F7UF 2MF2A 5GMKi 3CCVA 3CC7A 4JLIA 2K57A 2XD0A 3ZFJA 3M5AA 5GANg 5D6XA 3OYHA 4ELZC 4FIBA 1D3BB 1VIFA 4N0AA 4M7AE 5B6CA 5KH6A 4BI4A 4BACA 5C1BA 2DAQA 2R5AA 1OZ2A 5IAYA 3OYGA 1G3SA 4ATOA 1XNIA 3HRTA 2FHDA 4IUTA 2JV2A 3M59A 4M7DE 5D6YA 4CRIA 2GCXA 1AHJB 3RKYA 4F7UE 1Q82U 3PNWC 3G6ET 3DB4A 1QVPA 3E1SA 1G3YA 1BI2A 2K2VA 2RB6A 3R6OA 4E7LA 3SD4A 1VQ6A 4Y28E 1CZ5A 5CVIA 3CC4A 2V8JA 2P0QA 3UWNA 4NS5A 5EQJB 4C8QG 2MMPA 3CCUT 4FT4A 2Q18X 4PJOA 4R56A 3CMAA 2P0PA 4II1A 2OTLA 2YLCA 2HD0A 3S3MA 1EIFA 1I5LA 2CZ7B 2E10A 3M55A 2RHYA 1VUBA 2L3RA 3HHTB 2Y4XA 2FYKA 1WJQA 3HRSA 1JB0E 2DK3A 4MZTA 3BY7A 4C8QE 3G71T 3V8KA 1O9SA 2E6ZA 1KG1A 4ME7A 5CQYA 5GMKm 3QQ7A 2VC8A 2DXTA 5GAMd 2Y4YA 5L8RE 3X25B 1YHQA 1K8AU 1I9GA 1VQNT 1RL2A 4ZN3A 3ER0A 4F7UG 2QQAA 3QJ6A 4N4HA 4GLKA 5LJ3f 4A4KA 4BB7A 3ZJUA 5DLQE 2A7YA 3BW1A 2HAXA 2QTXA 3OS5A 4KT0E 1QDNA 1QW1A 4NL2A 4PLLA 3JAME 4M7AG 4PJOF 5LJ3d 2K4YA 4XTWA 3I55T 4KULA 1JBMA 3OY9A 2L5QA 4AS1A 3JB9H 1OYXA 4B9XA 1Q7YU 2F5KA 3INZA 1HK9A 4C0FA 1VQLT 5I2SA 4ZGJB 3FPUA 2KAFA 4OVAA 2QI2A 3LX7A 3X28B 1M1KC 1YJNT 2QQ9A 1GXIE 1R8OB 2R57A 3OSVA 2XI9A 3PMTA 1G3TA 2DIGA 1KQ1A 2PVGB 5EPPA 2XKOC 2WSEE 4M75G 3WVDB 4BY6C 4J7FA 1Q81C 1V29B 1X01A 3FJPA 4RV0A 2D0QB 2QQSA 1ZQ1A 3I56A 3OS1A 4X9CA 2LVMA 3L2UA 3PFSA 5GANd 1K73U 1NJIU 5A0GA 4O5VA 3T9NA 3QYHB 4PL6A 1YJWT 2EQKA 4J6YA 4C0DC 2LQ8A 4OB1B 3MEUA 2LT1A 4P5NA 4EMGA 4M7AA 3JB9I 2LCCA 2QDYB 2ZCFB 2A3LA 3CBOA 2DXCA 3M56A 5CKEA 5GMKj 4MZPA 3JCMc 4C8QC 5KE2A 3MEVA 4RCBA 2MWOA 5GAOn 2L8DA 3GPLA 3JCMg 1VQKA 3ZEHA 2ZZDA 3M9QA 2FVUA 4LDVA 2EJFA 2GFAA 3CD6T 4ARIA 3M57A 3L2WA 3J7AF 4IUUA 2V8IA 4MZMA 1TH7A 1UEBA 4BI3A 3LWHA 2XK0A 3PIOA 3LH0A 1N8RC 4LD9K 1WLFA 4OGEA 5C18A 3ZJTA 2HQXA 4NL3A 1MHNA 3UPUA 4J8OA 1VQ4A 2BKDN 2E5QA 3OYAA 3PMIA 5GMKe 2DD4A 3JB9F 3SB2A 2RI2A 2JN0A 3L42A 4KBMB 1YCYA 2K5LA 3FIFA 2DTHA 3SWNB 4FSXA 5GAMg 1WGSA 2PUKB 4M78C 5GAN8 4HT8A 1K8AC 5CKBA 3FRNA 4PJOD 3HU3A 1YJ9A 5GAOq 4BE1A 4A4HA 1O54A 1PSFA 3OYIA 3OSSC 4M77D 2OTJT 3DLMA 3TCJA 4JS5A 5CIUA 4OB3B 4VUBA 4M7DD 1CR5A 3HSBA 3JRZA 1Q7YC 1N8RU 3CMAT 3FDRA 4M75C 4D6WA 4IUPA 1D3BA 4X34A 5CKFA 2CZ1B 3V8JA 5LJ5g 2KSSA 4ZTFA 1Q86U 2DXUA 2PQWA 4QW2A 1BI0A 3GIBA 2RH2A 4XTZA 5GMKh 1I4K1 2X4YA 3MEWA 2O01E 5CCXA 5GAOr 1UGRB 5FLXE 4HCBA 4E47A 1WQ7A 1YHQT 2LW6A 5FU6C 4M7DF 2LRQA 5GANj 4M77B 4L6V5 5EG2A 3C4SA 1ZBXA 1HXDA 4XK8E 5DM7R 4ZTJA 3QQ8A 3L2QA 2RD1A 1NJIC 1S3SA 1QVFS 4JRIA 5FTJA 1XTDA 4JUVA 3CCUA 2PVOB 2ZGWA 2OTLT 4J5YA 5FU7B 3A8LB 4M7AB 4M75D 1VQLA 1KC8U 4C92G 2QA4A 4M77C 1G5VA 3QIIA 5I21A 2LDMA 5LJ3h 5FU6B 1QVFA 1XQHA 2IVWA 2F69A 2M0OA 4M75E 1JRIA 2ZPGB 2DIQA 2MM0A 3JCMW 5FTKA 1WQWA 5CKDA 3OB9A 1VQNA 4PJOB 2RI5A 3TU4K 2MM2A 4Z02A 3HU2A 3H6ZA 3I56T 2EYQA 3X26B 4OP0A 4UC4A 4BDYA 4L59A 5C0MA 5LJ5h 1YBYA 3JCMe 4XU2A 3OYFA 3G4SA 2DPPB 1YJWA 2RA2A 3CCET 3QSUA 2CYZB 2G3RA 2LCLA 1O75A 3QXEB 5CQXA 1Q81U 5ERGB 1Q86C 2RHZA 2EJ9A 3QYGB 3CCMA 1VQMT 1QVGS 2GF7A 3URGA 3OYCA 2DEQA 1YJNA 3CD6A 3ZGZA 3A8MB 1U1SA 1G3WA 4M78B 4QVCA 3Q1JA 4OF1A 4PNOA 5CR2A 4JDSA 3HKSA 5A0DA 4Y91A 3SWNC 2X4JA 3VUBA 3CXCA 3CMEA 1LNXA 2VXFA 4LDYA 2EIFA 1WPYA 2ZPEB 2GQVA 3BDUA 3BDLA 4J83A 3NTKA 5DY9A 4ZN1A 3CCMT 4Q5WA 3JB9J 4NOYA 4XU3A 1NE8A 3RUXA 4ZGDB 3MP8A 2VXEA 4C5IA 3JCMh 3OYNA 3H8ZA 5FRNA 5LJ3j 2P0KA 4J6WA 3L2VA 3LGAA 2XDBA 5J26A 2K3XA 1NPRA 4PKCC 5A2QE 1VQ9A 2PJHB 2DTOA 1M5Q1 3HFNA 4RG8A 5J39A 4N0AC 1M8VA 4A4FA 2LQKA 2E65A 3CC7T 3MB5A 3JCMb 3LYIA 3O8VA 3MEAA 2DD5A 2B25A 1OZ3A 4FU6A 1B34A 3CCQT 3DKMA 1VIEA 5GAOm 4M7DG 2M9UA 4C92B 3LHDA 3MCAB 2H3JA 5CCBA 4C92C 1W2BA 5FRMA 4CI0C 4C0DB 3S6WA 3ZJVA 3M53A 3OYYA 3QG1A 2OAUA 2PUOB 2VGMA 1BKBA 3RIRA 3OYMA 3GOXA 1U8RA 3L2ZA 5CO7A 2IG0A 2JZ2A 2LC4A 4M7DA 4KDIA 3QBYA 3DB3A 2YVLA 3CCJT 1VQ6T 4BY6B 4J7IA 5GLFA 4E7KA 4EDUA 2CKKA 1VQ8A 3GNFB 1VQOA 2P4TA 5CKHA 2E12A 2O4XA 1S72T 1K9MU 2DTIA 2O4XB 3M4GA 1XOVA 1YJ9T 4XQ3A 3CCVT 3GLXA 3OMGA 4A54A 3P8HA 4C8QF 2CZ6B 3G71A 2DVEA 3M58A 1X75C 3CBPA 2YLBA 3NFCA 2D9TA 2RO0A 3C94A 3RMQA 4OGCA 4BD3A 2NLUA 2VYTA 4LDUA 3FB9A 4F7UB 1YI2T 4RMOA 3JCMf 1S72A 5GAN5 3A8GB 3QHSA 3QZ9B 4M78G 1KD1U 1E32A 3OYLA 2FL7A 2DZ9A 4HCZA 2KY9A 3OQ5A 1BI1A 4M78E 5I2MA 4O6JA 5M9OA 4N4GA 4C0ZA 3TREA 2EAYA 3RESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIB A;  2KY9 A; 
#chains in the Genus database with same CATH topology
 4PJN A;  3CC4 T;  4BDZ A;  3TEE A;  1E6H A;  4RTV A;  2K3Y A;  3EG2 A;  1Q82 R;  3U23 A;  1N6A A;  2YUQ A;  3AHU A;  2QQR A;  2RK2 A;  2LQN A;  5GAN 4;  1KC8 C;  3VS0 A;  5HK0 A;  4M7A F;  1M90 C;  3FC3 A;  4ARC A;  1SSF A;  2D8H A;  1K8A R;  4BUG A;  4M77 F;  2R5M A;  2DZC A;  4RG2 A;  3FPR A;  2KRM A;  1YIT T;  1T0J A;  1BK2 A;  3TSZ A;  4MMK A;  2MAM A;  3EFR A;  1OUL A;  1M27 C;  5GAN f;  1M2O A;  2Q1C X;  2YHT A;  1HYO A;  4IUR A;  5GAN 2;  1NPP A;  1IHW A;  3QZ5 B;  4LNP A;  3L1A A;  1X69 A;  3EAE A;  5GJV B;  1WHG A;  1M1F A;  3KBG A;  4KRT A;  3CXC P;  4JLG A;  2RQR A;  2QEX A;  1K1Z A;  3CC2 T;  2DBM A;  3OYD A;  2KVQ G;  4M75 F;  1QVG A;  1OEB A;  1WJS A;  2EVR A;  2KNB B;  5GJW B;  1M3A A;  4J9D A;  5CD1 A;  2C0T A;  1AWW A;  4JPB W;  4OMF B;  1Y57 A;  3OA6 A;  2K2M A;  5FWC A;  4CC3 A;  1KHI A;  3G71 Q;  2ZPH B;  4M7A D;  2RK1 A;  3QC8 A;  2E5K A;  3G6E A;  4XTU A;  2JTM A;  4FT2 A;  4J6X A;  3OYJ A;  1UGQ B;  1KQS S;  4PJO E;  1MV0 B;  3CPW A;  2QQB A;  2FB7 A;  4C8Q B;  4DOW A;  3JCM J;  4DBF A;  3ASK A;  8ATC B;  4M7A A;  3PGG A;  1Y7X A;  2DKG A;  4A4E A;  4GLM A;  3X24 B;  1VQO T;  1I1J A;  4JJC A;  2K6D A;  4C8Q D;  2QEX Q;  3H0I A;  4HT9 A;  4ELY C;  4JRP A;  1WLP B;  1MMD A;  5IT9 E;  2YXY A;  2RJD A;  2J05 A;  2KDS A;  3V8L A;  5LL6 S;  3KXT A;  5LJ5 f;  3VUZ A;  3LLR A;  1FXX A;  2X35 A;  1BIB A;  3HRU A;  4BE0 A;  1K73 R;  4DQ2 A;  2LTO A;  4QVD A;  3OW2 A;  3UA6 A;  2JUF A;  2PWY A;  2CUB A;  4M7D B;  3A8O B;  1KD1 R;  4AQ7 A;  4LDW A;  2NUP B;  2E64 A;  2W0Z A;  4PLI A;  3G7Z A;  3CC7 Q;  2DLP A;  2LP5 A;  1QMC A;  3LGF A;  3QWY A;  1C6V X;  5C6S A;  3JCM V;  5FRO A;  1YIT A;  1EFN A;  3WXM B;  1TUG B;  2HSP A;  1K73 C;  2ROL A;  2HKN A;  1N9S A;  3LW5 E;  3MPU B;  4LUD A;  3V7C A;  3CPW S;  2YWW A;  1OOT A;  2E6N A;  1M30 A;  2K79 A;  2HBP A;  4XU0 A;  5FWB A;  4YTL A;  1WHJ A;  2CDT A;  3BQB A;  4E7Z A;  3V7R A;  1VQ7 T;  3OYB A;  2LNH B;  3MET A;  4F7U A;  4LD6 A;  1K76 A;  4KH1 B;  1QKX A;  3VYH B;  1M9S A;  1VQK T;  3MHX A;  3TQ7 P;  2G6F X;  5CCA A;  2JTF A;  1YIT Q;  1UJ0 A;  2RHX A;  3QO3 A;  3G6E Q;  2H8H A;  2X3X D;  1KD1 C;  3FLG A;  4DBH A;  3RKW A;  2QTV A;  1ZSZ B;  3M5A A;  2BZY A;  4ELZ C;  2A36 A;  2DYB A;  3OYG A;  1G3S A;  1TS9 A;  3M59 A;  5D6Y A;  2RQT A;  2RB6 A;  2K2V A;  4E7L A;  4Y28 E;  1CZ5 A;  3CC4 A;  2DYI A;  2V8J A;  2P0Q A;  2LZ6 B;  2Q18 X;  3CMA A;  2LX7 A;  1EIF A;  3M55 A;  3HRS A;  4MZT A;  2B25 A;  1WJQ A;  3BY7 A;  2E6Z A;  2VC8 A;  5GAM d;  1I9G A;  1YHQ A;  1RL2 A;  4F7U G;  3QJ6 A;  3ZJU A;  4LN2 A;  1I07 A;  3OS5 A;  4NL2 A;  4PJO F;  4AS1 A;  1OYX A;  1VQ8 Q;  1HK9 A;  3M0Q A;  2RQU A;  2A08 A;  2NYS A;  3FPU A;  8AT1 B;  4FW1 A;  2QQ9 A;  2YT6 A;  3OSV A;  2XI9 A;  1G3T A;  1SG5 A;  5EPP A;  1M2V B;  4J7F A;  2KT8 A;  2LVM A;  5A0G A;  3QYH B;  1JU5 C;  4C0D C;  4P5N A;  2LT1 A;  1YP5 A;  2A3L A;  3CBO A;  5KE2 A;  3GPL A;  4RCB A;  2L8D A;  3ZEH A;  3CD6 T;  4ARI A;  2V8I A;  1AWX A;  1TH7 A;  1XJW B;  3LWH A;  3ZJT A;  1N8R C;  1G8X A;  4OGE A;  2HQX A;  1W1F A;  3CD6 Q;  1VQ4 A;  3OYA A;  3A98 A;  2DD4 A;  1ZA2 B;  3FIF A;  3SWN B;  1T0H A;  4HVU A;  3LH5 A;  3HU3 A;  4BE1 A;  1W2B P;  1PD1 A;  2X3W D;  1PSF A;  1M1K R;  3OSS C;  3TCJ A;  2K7A A;  2EW3 A;  4VUB A;  4M7D D;  1Z9Q A;  1TUC A;  3HSB A;  3JRZ A;  1Q7Y C;  4IUP A;  4JZ3 A;  1LPL A;  2DXU A;  4QW2 A;  3CQT A;  1I4K 1;  2X4Y A;  3MEW A;  2D1X A;  1UEC A;  3CCJ Q;  5FU6 C;  3CCS Q;  2KRN A;  1W70 A;  4XK8 E;  1OU9 A;  2DA9 A;  5DM7 R;  1NJI C;  2JM9 A;  1QVF S;  1XTD A;  1H8K A;  4JUV A;  1RAG B;  4OML A;  5FU7 B;  1Q7Y R;  2BTT A;  2QA4 A;  3QII A;  2JS2 A;  1QVF A;  1XQH A;  2XMF A;  2ZPG B;  2OTJ Q;  3JCM W;  5CKD A;  2BE7 D;  4PJO B;  2RI5 A;  4IIM A;  3TU4 K;  3I56 T;  2EGC A;  4L59 A;  1WYX A;  5LJ5 h;  1HD3 A;  3CCE T;  5CQX A;  1CKB A;  5ERG B;  3CCR Q;  1VQM T;  2GF7 A;  1I0C A;  2PZ1 A;  2DL8 A;  2QG9 B;  3Q1J A;  4PNO A;  2EBP A;  5A0D A;  4Y91 A;  3CXC A;  2HQH A;  2W10 A;  4QT7 A;  9ATC B;  4NOY A;  4XU3 A;  1NE8 A;  1WXB A;  4ZGD B;  3MP8 A;  2V1Q A;  1WA7 A;  1ABO A;  3H8Z A;  1BB9 A;  4GBQ A;  4ZNX A;  1VQ9 A;  4PKC C;  1EX4 A;  5J39 A;  4KGX B;  2E65 A;  2PTK A;  3MB5 A;  3MEA A;  2L0A A;  4FU6 A;  3CCQ T;  5GAO m;  4M7D G;  3MCA B;  1EZZ B;  1BKB A;  3OYM A;  1WHL A;  2LC4 A;  1UUE A;  4J7I A;  5GLF A;  4EDU A;  4AFU C;  1D1C A;  2P4T A;  2E12 A;  2O4X A;  1S72 T;  1K9M U;  1XOV A;  1YJ9 T;  4J9H A;  3OMG A;  1A0N B;  4C8Q F;  2CZ6 B;  3G71 A;  3CBP A;  2D9T A;  4BD3 A;  2AZV A;  1S72 Q;  1IGQ A;  4F16 A;  1YJ9 Q;  2CSQ A;  1SHF A;  3QZ9 B;  1KD1 U;  1E32 A;  2FL7 A;  2JMA A;  2DER A;  1PRM C;  1ZLM A;  1LCK A;  5M9O A;  2EAY A;  3IQL A;  1Y96 A;  3GF5 A;  2X4X A;  2KEA A;  1RAD B;  3NTH A;  2CGH A;  2PU9 B;  4B9W A;  4PFZ A;  1RAF B;  2Q1A X;  2HCK A;  4HA8 A;  2EFI A;  4XAX B;  2CZ0 B;  3PE0 A;  3JCM X;  5KYU A;  1X6O A;  3L2Q A;  3PT9 A;  1CKA A;  4A4G A;  4RCC A;  2ZPI B;  4M7A C;  1E7O A;  1R0B G;  1W4S A;  4HCK A;  2HQE A;  3MKD A;  1M90 U;  4HCC A;  1OI1 A;  3CCR A;  2DM1 A;  2KXC A;  1D0Z A;  3LGL A;  2YUJ A;  2Y90 A;  3MP6 A;  2X4W A;  1SKU B;  3CCS T;  3P8B B;  1Z9Z A;  1BYM A;  1Q95 G;  1AZG B;  4OMO A;  3M0U A;  2XID A;  2K3B A;  3VKI A;  1OU8 A;  1JJ2 P;  3VU3 C;  1FMK A;  1VQP A;  4XTX A;  2EJG A;  1BIA A;  4N4I A;  5LJ5 e;  4IIO A;  5HK3 A;  1DJ7 B;  3QWZ A;  1PG5 B;  1VQ5 T;  1JJ2 S;  2I2L A;  5AYF A;  4M78 F;  2M0Y A;  3CCJ A;  1YFN A;  1RI0 A;  3TVT A;  4L5G A;  4PJO G;  3CCV Q;  2EGE A;  1TSF A;  1VQ5 Q;  4FM4 B;  5GAM f;  3JCM Q;  1PC0 A;  2FEI A;  3SEM A;  1PD0 A;  1UJY A;  2EQU A;  1NBE B;  2DBK A;  3MP1 A;  5HKC A;  2GFU A;  2BE9 B;  3RMS A;  3VJP A;  4C92 E;  1K9M C;  5D6W A;  1N9R A;  4M78 A;  2EQJ A;  2RPN A;  3V7S A;  3UT1 A;  3R6N A;  4BI8 B;  1D1B A;  2JTE A;  3GP8 A;  2V8K A;  2QA4 T;  3QKJ A;  4BDY A;  1QP2 A;  3SFM A;  4GY5 A;  2FPD A;  3HL8 A;  2KYM A;  3OYE A;  1Q86 R;  2QA4 Q;  2EYW A;  1NZ9 A;  5GAM h;  1ZHI A;  1YIJ T;  3A1P A;  2DRM A;  2XDD A;  3HU1 A;  5IXF A;  3CCL T;  3P8D A;  2HSE B;  3GNG A;  1UHC A;  3EGX A;  3VV0 A;  4JRQ A;  1ZUY A;  3NTI A;  1H3H A;  3ME9 A;  4EMK B;  2FO0 A;  4OB0 B;  1JJ2 A;  1I8F A;  4QQG A;  1R0C B;  3EFS A;  4C0G A;  5GAN h;  4M77 A;  4QVZ A;  3EG9 A;  2CUD A;  3F70 A;  1GCQ A;  3UDC A;  1KQS A;  2ENM A;  4AG2 C;  2QEX T;  1VYU A;  5LJ3 e;  1OX8 A;  1WHH A;  2WSF E;  2GNC A;  3CME Q;  1PSE A;  5IN1 A;  2ED1 A;  2COW A;  2J06 A;  1WZO A;  3CEY A;  3S3N A;  4HKE A;  3C95 A;  4LDX A;  1V76 A;  2FZK B;  4A53 A;  4KUI A;  3CPF A;  1JXO A;  3X20 B;  4E7I A;  2MYS A;  4JRK A;  2YUN A;  1KSW A;  3RDV A;  4DOV A;  1OV3 A;  2JXB A;  3PTA A;  3A5Z B;  3E9F A;  2KBT A;  1VQ7 A;  1M4Z A;  2KK4 A;  2RJC A;  2XG8 D;  1LVK A;  3BFM A;  5GMK i;  3CC7 A;  5D6X A;  4FIB A;  1D3B B;  2X9H A;  1SF9 A;  5KH6 A;  3I55 Q;  1OZ2 A;  3CPW P;  2DRK A;  2FHD A;  4IUT A;  1X6B A;  1TXQ A;  5ECA A;  2GCX A;  1AHJ B;  5I22 A;  1WXT A;  3E1S A;  2VVK A;  1BI2 A;  1X6G A;  1VQ6 A;  2X51 A;  4PK4 A;  1GFD A;  5EQJ B;  3ZL7 C;  1TG0 A;  2MMP A;  3CCU T;  4FT4 A;  2LJ1 A;  4R56 A;  2P0P A;  4II1 A;  2IIM A;  3EGU A;  2OI3 A;  2CZ7 B;  2E10 A;  1VUB A;  2L3R A;  3HHT B;  1K9A A;  2DK3 A;  2KGT A;  1MND A;  4ME7 A;  5GMK m;  2DXT A;  2MIO A;  5L8R E;  2AT1 B;  1K8A U;  4ZN3 A;  2LJ3 A;  2O2O A;  3ER0 A;  4BB7 A;  2MPX C;  2A7Y A;  1MUZ A;  2IPO B;  4KT0 E;  2DMO A;  4PLL A;  1QCF A;  3JAM E;  4M7A G;  4KUL A;  1PKT A;  3EH1 A;  2E4H A;  5L23 A;  4C0F A;  2J6O A;  1VQL T;  5I2S A;  4OVA A;  3X28 B;  2C0I A;  3VS1 A;  2OTL Q;  5KYX A;  4D8K A;  2DIG A;  1KQ1 A;  1Q81 C;  1X01 A;  4D8D A;  4K11 A;  1ZQ1 A;  4OMP A;  3I56 A;  1NJI U;  3T9N A;  2ROT A;  3UA7 A;  4PL6 A;  4J6Y A;  4OB1 B;  3MEU A;  5AT1 B;  5IH2 A;  2QDY B;  7AT1 B;  1KFZ A;  3M56 A;  5CKE A;  5I11 A;  2MWO A;  3JCM g;  3G1J A;  2DX1 A;  1N8R R;  1GCQ C;  3L2W A;  3BE3 A;  1MMG A;  1UEB A;  2I0N A;  1WLF A;  2XK0 A;  4LD9 K;  2KT1 A;  5C18 A;  1VQ4 Q;  3UPU A;  3NMZ C;  2LCS A;  1Q81 R;  1X2Q A;  2BKD N;  2E5Q A;  3PMI A;  5GMK e;  1GBQ A;  2JN0 A;  3L42 A;  3SHW A;  4FSX A;  1WGS A;  1RAC B;  4M78 C;  4HT8 A;  5CKB A;  2KRO A;  3OYI A;  4F04 B;  1RLP C;  4FW2 A;  4OB3 B;  2QK0 A;  1CR5 A;  3CMA T;  3FDR A;  4X34 A;  5CKF A;  4ZTF A;  1Q86 U;  2PQW A;  1ZX6 A;  2L3S A;  5GMK h;  2HZY A;  5FLX E;  1QKW A;  3QDF A;  5GAN j;  4M77 B;  1ZBX A;  2DET A;  3QQ8 A;  2RD1 A;  5FTJ A;  1FYN A;  3CCU A;  2PVO B;  1AWJ A;  3A8L B;  3TSW A;  5IHN A;  4M75 D;  1YHQ Q;  5LJ3 h;  5FU6 B;  3EG9 B;  4JZ4 A;  1VA7 A;  2MM0 A;  2DIQ A;  1JO8 A;  1VQN A;  2OX7 A;  2DIL A;  2EGA A;  3X26 B;  2AIR B;  4DBQ A;  2RMO A;  3JCM e;  2RA2 A;  1CSK A;  3QSU A;  1Q81 U;  1O75 A;  6AT1 B;  2RHZ A;  3CCU Q;  3QYG B;  2GTJ A;  2EYX A;  4J9B A;  2DEQ A;  1U1S A;  5CR2 A;  2JJ9 A;  1KJW A;  3SWN C;  1M8M A;  3I9Q A;  4ZN1 A;  3CCM T;  4AFS C;  2YDL A;  2YUO A;  2O31 A;  4RTU A;  3JCM h;  1UG1 A;  3OYN A;  5FRN A;  5LJ3 j;  4J6W A;  2K3X A;  1NPR A;  2DTO A;  1TOV A;  3HFN A;  2ED0 A;  3CC7 T;  1X43 A;  3O8V A;  2DD5 A;  3LHD A;  4C92 C;  5FRM A;  4R0K A;  3ZJV A;  4C0D B;  2J6K A;  2PUO B;  3RIR A;  4FYX B;  1G2B A;  3L2Z A;  2DL3 A;  1ZUK A;  2BZ8 A;  3UF4 A;  4M7D A;  2GTO A;  1PNJ A;  3CCJ T;  1VQO A;  5CKH A;  1K0S A;  4HVW A;  2RQV A;  4A54 A;  2OAW A;  2DVE A;  3M58 A;  1X75 C;  4F14 A;  3NFC A;  4IKF A;  3C94 A;  3EHQ A;  4LDU A;  3FB9 A;  3A8G B;  3OW2 P;  2KY9 A;  2NUT A;  5I2M A;  1YN8 A;  4PJO D;  3UAT A;  1UGS B;  3EG0 A;  2RJE A;  1IRE B;  2JVV A;  4BE2 A;  1M1G A;  2QAZ A;  2RI3 A;  4RTT A;  1X2K A;  2BIV A;  1K9M R;  4AMC A;  4MDW A;  4PJO C;  2FRW A;  1ACM B;  3CCR T;  3WVE B;  1ARK A;  4C5E A;  4V2S A;  3NPF A;  4J9G A;  5KCH A;  5GAO l;  2L2P A;  3ULR B;  1W6X A;  1OX9 A;  1YIJ A;  2MCN A;  5FU7 C;  3NGP A;  1CZ4 A;  2B86 A;  1UE9 A;  1JEG A;  3CME T;  2DNU A;  4C5H A;  1QWF A;  1Q82 C;  5GAM e;  1VOM A;  1ZSZ C;  2AHJ B;  5J3B A;  3JB9 G;  1Y71 A;  1BCO A;  3JCM P;  4FYW B;  1LJO A;  4M75 B;  2D6F A;  3CCQ A;  2HL5 C;  4EMK A;  2F5T X;  2WSC E;  2LMJ A;  4A63 B;  3OBW A;  2KE9 A;  4WF2 A;  2YRC A;  1VQP T;  3JSC A;  2DJZ A;  1VQ9 Q;  4C8Q A;  1ZA1 B;  2JMC A;  1PKS A;  1D09 B;  2MWP A;  3MJX A;  5GAN 3;  2EQM A;  3TIW A;  5KYU B;  1VQ5 A;  4TVR A;  2VKN A;  1QQJ A;  4JS4 A;  5DYI A;  4C92 D;  3QJY A;  1N5Z A;  4ORZ A;  1BU1 A;  2LNV A;  5GAO p;  2FZC B;  2D0N A;  2K5F A;  5FTK A;  3J80 E;  1B34 B;  5A0L A;  3L2R A;  1VQ8 T;  4M7D C;  1KQ2 A;  2JT4 A;  5FTM A;  3OBY A;  3VS3 A;  1U06 A;  2BUD A;  5KYW B;  1UB4 A;  2P84 A;  3H0F A;  4WTO B;  2J7I A;  3CCL A;  3DLL A;  4M77 E;  5GAN 7;  5KYN A;  3VS2 A;  2ESW A;  1W2B S;  2VB6 A;  2RF0 A;  1PM3 A;  1WNL A;  4F17 A;  1QVF P;  1ZC1 A;  4M4Z A;  2V1R A;  3JB9 D;  1K0X A;  2VUB A;  1QVG P;  2A0F B;  2RM4 A;  3CCS A;  5FTN A;  1TTH B;  3HP9 A;  4XTY A;  2MI6 A;  5LJ5 d;  3J81 E;  5FW9 A;  2CS7 A;  4ANJ A;  3OMC A;  1KQS P;  1KIK A;  4KDL A;  3QUI A;  1WJR A;  1UTI A;  4XTV A;  3CCE A;  1NEG A;  2E1H A;  4DA4 A;  1U5S A;  4KUD K;  3PIP A;  1VQ4 T;  3C12 A;  1I5O B;  1ZSZ A;  3EG3 A;  4FL6 A;  2Q19 X;  1M3C A;  2EYY A;  2LQW A;  5GAN e;  2GGR A;  1UGV A;  1YI2 Q;  1IRX A;  1UGP B;  2LX9 A;  2RQW A;  2DL5 A;  2EKO A;  2YUP A;  4MML A;  4IUQ A;  1MGQ A;  2AZS A;  4C92 F;  4EPC A;  1HJD A;  2HEQ A;  4F7U F;  2E70 A;  2MF2 A;  3CCV A;  4FYY B;  2XD0 A;  2K57 A;  4QKU A;  5GAN g;  1VIF A;  4N0A A;  4M7A E;  4BAC A;  2F2X A;  2R5A A;  3VS7 A;  2JV2 A;  4M7D E;  2O9V A;  3RKY A;  2EKH A;  3PNW C;  3G6E T;  3DB4 A;  3R6O A;  4Y92 A;  5KYY B;  5CVI A;  1SRL A;  4NS5 A;  4C8Q G;  2F1L A;  4PJO A;  2OTL A;  1RUW A;  4Z8A A;  1QCO A;  3CCL Q;  2RHY A;  3INZ A;  2FYK A;  3G71 T;  1KG1 A;  3V8K A;  1WDX A;  2OJ2 A;  3VS6 A;  2Y4Y A;  4X1V A;  3X25 B;  2EQI A;  2QQA A;  5LJ3 f;  4GLK A;  4RUG A;  2HAX A;  1WIE A;  2L3Q A;  3BW1 A;  2HBW A;  1GRI A;  1QW1 A;  1WI7 A;  5LJ3 d;  1YJN Q;  2K4Y A;  4XTW A;  3I55 T;  3CC2 Q;  2L5Q A;  5IXB A;  4B9X A;  3GBQ A;  3O5Z A;  5IHK A;  4KGV B;  2QI2 A;  3LX7 A;  1M1K C;  1YJN T;  1RAH B;  2R57 A;  2QAS A;  3PMT A;  1KK7 A;  4RV0 A;  2D0Q B;  3THK A;  4X9C A;  3PFS A;  4O5V A;  1YJW T;  4EMG A;  3JB9 I;  2DXC A;  5GMK j;  1HSQ A;  4MZP A;  4C8Q C;  5GAO n;  1YJW Q;  1BBZ A;  2VAS A;  3M9Q A;  2EJF A;  2CP3 A;  2CT4 A;  3M57 A;  3J7A F;  1K4U S;  4MZM A;  4BI3 A;  3PIO A;  2FPE A;  3LH0 A;  1UHF A;  1VQO Q;  3JB9 F;  4KBM B;  1JXM A;  3FJ5 A;  2DL4 A;  1YJ9 A;  4JJB A;  4LE9 A;  1VYT A;  4A4H A;  3C0C A;  1X27 A;  2QGF B;  3EHR A;  3DLM A;  4JS5 A;  2DL7 A;  2H3E B;  1JQQ A;  4LUE A;  1PWT A;  4M75 C;  5IHI A;  1BI0 A;  3GIB A;  1AT1 B;  4XTZ A;  2CRE A;  3QWX X;  2JM8 A;  5CCX A;  4E47 A;  1VQ6 Q;  3E2U A;  2LW6 A;  4M7D F;  2LRQ A;  1NLP C;  4L6V 5;  5EG2 A;  3C4S A;  4KH0 B;  1C0M A;  2K9G A;  1YWP A;  3RR6 A;  2OTL T;  4J5Y A;  1VQL A;  4C92 G;  4M77 C;  1G5V A;  5I21 A;  2LDM A;  1AEY A;  2IVW A;  1JRI A;  1UDL A;  2HDA A;  3OB9 A;  2KXD A;  2COZ A;  2MM2 A;  4Z02 A;  3H6Z A;  2QYZ A;  2EYQ A;  4UC4 A;  1YBY A;  2BZX A;  1VQK Q;  1IO6 A;  3EGD B;  3QXE B;  2LCL A;  2C0O A;  1SHG A;  2EJ9 A;  1OQK A;  3CCM A;  1QVG S;  2L3P A;  3URG A;  5D7U A;  3OYC A;  3H9N A;  1YJN A;  1G3W A;  4M78 B;  4QVC A;  4JDS A;  3HKS A;  4E7S A;  3CME A;  3CCQ Q;  2VXF A;  2JS0 A;  1WPY A;  2GQV A;  3BDL A;  3RNJ A;  4Q5W A;  1AOJ A;  2KYB A;  2VXE A;  1VQM Q;  1B3Q A;  3LGA A;  5J26 A;  2PJH B;  4RG8 A;  1M5Q 1;  4N0A C;  1M8V A;  1NG2 A;  1OZ3 A;  1VIE A;  2M9U A;  4C92 B;  4CI0 C;  3M53 A;  3OYY A;  2VGM A;  1WFW A;  1U8R A;  5CO7 A;  2DJQ A;  2JZ2 A;  1GL5 A;  2CH4 A;  3QBY A;  3DB3 A;  2YVL A;  4BY6 B;  2DFU A;  3GNF B;  1YIJ Q;  4PFO A;  1IB8 A;  2FG0 A;  2DTI A;  3M4G A;  4XQ3 A;  2M02 A;  4OMN A;  5KYW A;  2YLB A;  2RO0 A;  1U3O A;  2VYT A;  1AWO A;  2ATC B;  4M78 G;  2DZ9 A;  2P4R A;  4M78 E;  4OMM A;  4O6J A;  4N4G A;  4D6W A;  3RES A;  3PVL A;  2O88 A;  3OW2 S;  4CC2 A;  2LT4 A;  1E6G A;  2MK5 A;  2YRD A;  3I55 A;  3LWI A;  2KQW A;  3D7S B;  1B07 A;  1I81 A;  4B6M A;  4CC4 B;  1VYV A;  2E3I A;  1MMN A;  2CP2 A;  5KCO A;  1R77 A;  1SRM A;  4XU1 A;  3G4S T;  2C06 A;  4AFQ C;  2D8J A;  1IZ6 A;  2JOY A;  4J9E A;  2PVD B;  1U1T A;  3N5B B;  2DO3 A;  5HCK A;  3S3O A;  4HXJ A;  1BI3 A;  1YWO A;  1QLY A;  3CCM Q;  1ZBJ A;  3HFO A;  2EWN A;  5FTL A;  1RAE B;  3RKX A;  2RHI A;  4EMH A;  2AKK A;  2COY A;  1NM7 A;  2RJF A;  2RHU A;  3SDZ A;  2VGN A;  1WX6 A;  5DLO A;  4CQN A;  4IUV A;  1WXU A;  4M77 G;  1R7R A;  1Y07 A;  1QCS A;  5KE3 A;  1H64 1;  4OB2 B;  1KHC A;  2JW4 A;  3H0H A;  3VS4 A;  1VQM A;  1PCX A;  1FWZ A;  2HNI A;  3A8H B;  5GAM j;  2DF6 A;  4KO8 A;  4HVV A;  1QCN A;  3EFO A;  2DVJ A;  1H3Z A;  3HPW A;  2CH4 W;  3CCE Q;  2KMT A;  1RAI B;  3QPH A;  1IGU A;  4KLN A;  4M75 A;  1G83 A;  2JNG A;  1J3T A;  4PJM A;  2GBQ A;  1T3L A;  3M4Y A;  1VQ7 Q;  2ZPF B;  5DYG A;  4PJL A;  4C5G A;  3VYG A;  4WCI A;  4LXC A;  3M54 A;  4M78 D;  1YI2 A;  2B8A A;  2K5I A;  1ZSG A;  2CSI A;  4EMK C;  3QDR B;  3E9G A;  1OPK A;  2A37 A;  2NUP A;  5LJ5 j;  2XHC A;  1Y96 B;  1OPL A;  3EFO B;  2QXF A;  4DBR A;  1Y0M A;  2XU8 A;  2NUZ A;  1QP3 A;  3KUF A;  5CAI A;  3CF2 A;  5HY6 A;  4R55 A;  4ZGE B;  2Q1D X;  2CP0 A;  3ZBD A;  3CC4 Q;  1MMA A;  1NYF A;  4E7H A;  4RKU E;  2WAC A;  1TWB A;  4RTZ A;  2L89 A;  3MO8 A;  4MDX A;  3E19 A;  3SWN A;  3RER A;  3OS2 A;  3CBM A;  1F1B B;  4QQ6 A;  2SEM A;  2YRV A;  4X9D A;  2J6F A;  2M1H A;  1NYG A;  5GMK l;  3CXC S;  2R58 A;  3FEO A;  4PFP A;  3CC2 A;  2DXB A;  2KRS A;  4JJN K;  3RBB B;  2ZAE A;  3OYK A;  2E41 A;  2NUT B;  4E7J A;  1VQ9 T;  4C92 A;  4QQD A;  5GAN 6;  2ZPB B;  1D0Y A;  1WHM A;  4KOD A;  2HMA A;  1M1K U;  2VV5 A;  2HKQ B;  3OS0 A;  4PJJ A;  5LJ3 g;  5CK9 A;  1N27 A;  3G4S Q;  3JCM d;  3EG1 A;  3FPT A;  2XIC A;  2RN8 A;  2V26 A;  4E6R A;  1P92 A;  2XDP A;  2OTJ A;  1LOJ A;  2M16 A;  2E3H A;  1FX7 A;  4JLI A;  3ZFJ A;  3OYH A;  4RTX A;  2GQI A;  5B6C A;  4BI4 A;  4FSS A;  1TUD A;  5C1B A;  2DAQ A;  5IAY A;  4ATO A;  4KGZ B;  1XNI A;  3HRT A;  1MV3 A;  1H92 A;  4CRI A;  4F7U E;  1Q82 U;  3M0T A;  1QVP A;  1M90 R;  1G3Y A;  2LJ0 A;  3SD4 A;  3UWN A;  3REB B;  1T3S A;  2YLC A;  2HD0 A;  3S3M A;  1I5L A;  1VQN Q;  2Y4X A;  1JB0 E;  4C8Q E;  1O9S A;  2VWF A;  5CQY A;  3QQ7 A;  1VQN T;  5KYY A;  4N4H A;  4A4K A;  5DLQ E;  2FPF A;  4RTY A;  2QTX A;  2O9S A;  4J9F A;  1QDN A;  3EGD A;  1JBM A;  3OY9 A;  3JB9 H;  1RAA B;  4AT1 B;  2ABL A;  1Q7Y U;  2F5K A;  4ZGJ B;  1IHV A;  2KAF A;  1GXI E;  1R8O B;  3M0P A;  4OMQ A;  1YCS B;  2PVG B;  2XKO C;  2WSE E;  4M75 G;  3WVD B;  4BY6 C;  1V29 B;  3FJP A;  4DEY A;  3PVQ A;  2QQS A;  3L2U A;  3VRZ A;  3OS1 A;  1K73 U;  5GAN d;  1KC8 R;  2EQK A;  4J9C A;  3AT1 B;  2LQ8 A;  2DEU A;  2QDL A;  2LCC A;  2ZCF B;  3EGX B;  3JCM c;  3MEV A;  1VQK A;  1SEM A;  1NEB A;  1RI9 A;  2ZZD A;  2FVU A;  4LDV A;  2GFA A;  1QWE A;  1D1A A;  4IUU A;  5CCB A;  4NL3 A;  1MHN A;  4J8O A;  2EYZ A;  3SB2 A;  2PNI A;  3HTR A;  4RTW A;  2RI2 A;  5EC7 A;  1YCY A;  2K5L A;  2DTH A;  4E2F B;  5GAM g;  2PUK B;  5GAN 8;  1K8A C;  3FRN A;  2CP7 A;  1D0X A;  5GAO q;  1NLO C;  2A28 A;  1O54 A;  2F2W A;  3JV3 A;  4M77 D;  2OTJ T;  2MOX A;  5CIU A;  1N8R U;  3I56 Q;  1D3B A;  2F2V A;  3V8J A;  2CZ1 B;  5LJ5 g;  2KSS A;  1BCM A;  2RH2 A;  3KFV A;  4CC7 A;  2O01 E;  5GAO r;  1VQP Q;  1UGR B;  2CT3 A;  4HCB A;  1YHQ T;  1WQ7 A;  1AZE A;  1IXD A;  2YSQ A;  1NJI R;  1HXD A;  3CMA Q;  4ZTJ A;  3REA B;  1S3S A;  4JRI A;  2DE0 X;  2ZGW A;  4M7A B;  1KC8 U;  1AD5 A;  2FZG B;  2F69 A;  4Z89 A;  2M0O A;  4M75 E;  3H41 A;  1WQW A;  1PHT A;  1YNZ A;  4Z88 A;  4OP0 A;  3HU2 A;  4J9I A;  5C0M A;  3OYF A;  1YJW A;  4XU2 A;  1FMW A;  3G4S A;  2DPP B;  1GCP A;  2RNA A;  3I5R A;  2AKL A;  2CYZ B;  2G3R A;  1Q86 C;  1AVZ C;  2KI7 A;  1FMV A;  1SSH A;  1RAB B;  3ZGZ A;  3CD6 A;  2Z0W A;  3A8M B;  4OF1 A;  1C1A A;  3VUB A;  2X4J A;  1M2V A;  1LNX A;  4AFZ C;  4LDY A;  2EIF A;  2ZPE B;  4FYV B;  3BDU A;  5DY9 A;  1V1C A;  4J83 A;  3NTK A;  2ECZ A;  3JB9 J;  4FCY A;  3RUX A;  4C5I A;  5KYX B;  1PRL C;  1VQL Q;  2P0K A;  3L2V A;  2XDB A;  2SRC A;  5A2Q E;  3M0S A;  3VS5 A;  2EPD A;  4A4F A;  2LQK A;  2M51 A;  3JCM b;  3LYI A;  1B34 A;  2AK5 A;  3DKM A;  2H3J A;  4AG1 C;  1W2B A;  2NWM A;  3EH2 A;  3I35 A;  3S6W A;  3QG1 A;  2OAU A;  3GOX A;  3M0R A;  4JJD A;  2IG0 A;  2FRY A;  1S1N A;  4KDI A;  4DEX A;  2CP5 A;  1VQ6 T;  1M3B A;  4ESR A;  4E7K A;  2CKK A;  1VQ8 A;  1B7T A;  2O4X B;  1TU0 B;  1WHK A;  2KR3 A;  3NHN A;  3CCV T;  1GFC A;  3GLX A;  1GBR A;  1ABQ A;  3P8H A;  1MNE A;  1UFF A;  3RMQ A;  4OGC A;  1SPK A;  2NLU A;  3I5S A;  4F7U B;  1YI2 T;  4RMO A;  3JCM f;  1S72 A;  5GAN 5;  3QHS A;  3VRY A;  3OYL A;  2QGG A;  4HCZ A;  1ZUU A;  3OQ5 A;  1BI1 A;  2HL3 A;  4EIK A;  1RLQ C;  4C0Z A;  3TRE A;  2CP6 A; 
#chains in the Genus database with same CATH homology
 1Y96 A;  3GF5 A;  2X4X A;  3CC4 T;  4BDZ A;  3NTH A;  1UGS B;  3TEE A;  2CGH A;  3OW2 S;  2PU9 B;  4B9W A;  2RJE A;  2LT4 A;  2K3Y A;  3LWI A;  2Q1A X;  3I55 A;  1IRE B;  2JVV A;  2KQW A;  1M1G A;  4BE2 A;  1N6A A;  3AHU A;  1I81 A;  2QQR A;  2RI3 A;  2RK2 A;  2BIV A;  5GAN 4;  1KC8 C;  4MDW A;  4PJO C;  4HA8 A;  2EFI A;  5KCO A;  5HK0 A;  4M7A F;  1M90 C;  4XAX B;  3CCR T;  2CZ0 B;  4XU1 A;  3FC3 A;  4IKF A;  4ARC A;  3WVE B;  3JCM X;  3G4S T;  2C06 A;  1SSF A;  4C5E A;  4V2S A;  1IZ6 A;  1X6O A;  2JOY A;  4BUG A;  4M77 F;  5KCH A;  5GAO l;  2R5M A;  2DZC A;  1U1T A;  2PVD B;  3N5B B;  3PT9 A;  4RG2 A;  3FPR A;  2DO3 A;  4A4G A;  4RCC A;  2ZPI B;  4M7A C;  1W4S A;  1YIJ A;  1YIT T;  5FU7 C;  2HQE A;  3S3O A;  1CZ4 A;  1M90 U;  1BI3 A;  1OI1 A;  4HCC A;  3CCR A;  4MMK A;  2MAM A;  3EFR A;  5FTL A;  3HFO A;  2EWN A;  5GAN f;  2Q1C X;  2YHT A;  2RHI A;  3RKX A;  4EMH A;  3CME T;  4IUR A;  5GAN 2;  4C5H A;  1NPP A;  2RJF A;  3LGL A;  2YUJ A;  1Q82 C;  5GAM e;  2Y90 A;  3MP6 A;  3QZ5 B;  2RHU A;  2X4W A;  2AHJ B;  3SDZ A;  3L1A A;  2VGN A;  3P8B B;  3CCS T;  1BYM A;  3EAE A;  5DLO A;  4CQN A;  4IUV A;  5J3B A;  4M77 G;  1R7R A;  2XID A;  3VKI A;  1Y71 A;  3JCM P;  3JB9 G;  1Y07 A;  1QCS A;  1M1F A;  3KBG A;  1H64 1;  5KE3 A;  1LJO A;  4JLG A;  4OB2 B;  1KHC A;  3VU3 C;  1VQM A;  1VQP A;  4M75 B;  4XTX A;  2QEX A;  2EJG A;  1BIA A;  1FWZ A;  4N4I A;  3CCQ A;  2HNI A;  3A8H B;  5GAM j;  3OYD A;  5LJ5 e;  2KVQ G;  4M75 F;  1QVG A;  3CC2 T;  4KO8 A;  4EMK A;  2F5T X;  2WSC E;  5HK3 A;  1DJ7 B;  1WJS A;  3OBW A;  3QWZ A;  4WF2 A;  1VQ5 T;  1JJ2 S;  3HPW A;  1H3Z A;  2I2L A;  5AYF A;  1VQP T;  3JSC A;  2DJZ A;  4M78 F;  2KMT A;  3QPH A;  3CCJ A;  5CD1 A;  4C8Q A;  1RI0 A;  4OMF B;  4KLN A;  4M75 A;  3OA6 A;  2JNG A;  4L5G A;  4PJO G;  4FM4 B;  1KHI A;  5GAM f;  3JCM Q;  2MWP A;  5GAN 3;  3TIW A;  2EQM A;  2ZPH B;  3M4Y A;  4M7A D;  1VQ5 A;  2RK1 A;  4TVR A;  3QC8 A;  2ZPF B;  2EQU A;  2D6F A;  5DYG A;  3G6E A;  4XTU A;  2JTM A;  4FT2 A;  4C5G A;  4J6X A;  4JS4 A;  5DYI A;  4C92 D;  3VYG A;  3QJY A;  3OYJ A;  3MP1 A;  5HKC A;  1UGQ B;  2GFU A;  1KQS S;  3M54 A;  4M78 D;  1YI2 A;  2B8A A;  3RMS A;  3VJP A;  2K5I A;  4PJO E;  4C92 E;  4EMK C;  1K9M C;  3QDR B;  3E9G A;  3CPW A;  2QQB A;  2FB7 A;  5D6W A;  1N9R A;  2LNV A;  4C8Q B;  5GAO p;  4DOW A;  3JCM J;  4M78 A;  5LJ5 j;  3ASK A;  2EQJ A;  2K5F A;  3V7S A;  2XHC A;  3UT1 A;  3PGG A;  3J80 E;  1Y7X A;  1B34 B;  2DKG A;  4A4E A;  1Y96 B;  4BI8 B;  5A0L A;  3L2R A;  1VQ8 T;  4M7D C;  3X24 B;  1KQ2 A;  1VQO T;  4C8Q D;  5FTM A;  4HT9 A;  2QXF A;  3OBY A;  4ELY C;  4JRP A;  2XU8 A;  3GP8 A;  2V8K A;  2BUD A;  2QA4 T;  1QP3 A;  5IT9 E;  3QKJ A;  3KUF A;  2RJD A;  1UB4 A;  5CAI A;  3CF2 A;  5HY6 A;  2KDS A;  3V8L A;  5LL6 S;  1QP2 A;  4ZGE B;  4R55 A;  5LJ5 f;  3SFM A;  4GY5 A;  3VUZ A;  3KXT A;  3DLL A;  3CCL A;  4M77 E;  5GAN 7;  3OYE A;  3HL8 A;  3LLR A;  1FXX A;  2Q1D X;  2X35 A;  1NZ9 A;  1BIB A;  5GAM h;  3HRU A;  1ZHI A;  4BE0 A;  3ZBD A;  1YIJ T;  1W2B S;  4DQ2 A;  2LTO A;  4QVD A;  4E7H A;  3OW2 A;  4RKU E;  2XDD A;  3HU1 A;  2WAC A;  1WNL A;  2JUF A;  3CCL T;  2PWY A;  3P8D A;  2L89 A;  3MO8 A;  3GNG A;  4M7D B;  1ZC1 A;  3VV0 A;  3A8O B;  4JRQ A;  4MDX A;  3E19 A;  3NTI A;  3SWN A;  3JB9 D;  4AQ7 A;  4LDW A;  2VUB A;  2RM4 A;  3OS2 A;  3CBM A;  3RER A;  3CCS A;  2E64 A;  4QQ6 A;  5FTN A;  4PLI A;  2YRV A;  3ME9 A;  4EMK B;  3HP9 A;  4OB0 B;  3G7Z A;  1JJ2 A;  4X9D A;  1I8F A;  4XTY A;  2MI6 A;  3EFS A;  4QQG A;  4C0G A;  2M1H A;  3LGF A;  5LJ5 d;  3J81 E;  5GAN h;  4M77 A;  2CS7 A;  4QVZ A;  5C6S A;  5GMK l;  3OMC A;  3F70 A;  3JCM V;  5FRO A;  3CXC S;  1YIT A;  3UDC A;  2R58 A;  3FEO A;  3WXM B;  2QEX T;  1KQS A;  5LJ3 e;  3CC2 A;  2DXB A;  2WSF E;  1K73 C;  4JJN K;  4KDL A;  1PSE A;  1N9S A;  1WJR A;  3QUI A;  3LW5 E;  4XTV A;  5IN1 A;  3V7C A;  3CPW S;  3CCE A;  3OYK A;  2E6N A;  2E1H A;  2E41 A;  4E7J A;  4DA4 A;  1VQ9 T;  3CEY A;  4C92 A;  4KUD K;  4QQD A;  3PIP A;  4HKE A;  5GAN 6;  2HBP A;  3C95 A;  2ZPB B;  4XU0 A;  3S3N A;  4YTL A;  1VQ4 T;  4LDX A;  4KOD A;  3C12 A;  3BQB A;  1M1K U;  2VV5 A;  3V7R A;  4A53 A;  1VQ7 T;  4KUI A;  3CPF A;  4FL6 A;  3OS0 A;  3OYB A;  3X20 B;  5CK9 A;  5LJ3 g;  4E7I A;  1N27 A;  3MET A;  2Q19 X;  4F7U A;  4LD6 A;  3JCM d;  5GAN e;  4JRK A;  3FPT A;  2XIC A;  3VYH B;  1M9S A;  1VQK T;  3MHX A;  4DOV A;  1P92 A;  1UGP B;  5CCA A;  2LX9 A;  3PTA A;  2JTF A;  2EKO A;  2XDP A;  3A5Z B;  3E9F A;  4MML A;  2OTJ A;  4IUQ A;  1VQ7 A;  1MGQ A;  1M4Z A;  2KK4 A;  2RHX A;  3QO3 A;  1LOJ A;  4C92 F;  4EPC A;  2M16 A;  1KD1 C;  2RJC A;  3FLG A;  2E70 A;  2XG8 D;  3BFM A;  1FX7 A;  3RKW A;  4F7U F;  2MF2 A;  5GMK i;  3CCV A;  3CC7 A;  4JLI A;  2K57 A;  2XD0 A;  3ZFJ A;  3M5A A;  5GAN g;  5D6X A;  3OYH A;  4ELZ C;  4FIB A;  1D3B B;  1VIF A;  4N0A A;  4M7A E;  5B6C A;  5KH6 A;  4BI4 A;  4BAC A;  5C1B A;  2DAQ A;  2R5A A;  1OZ2 A;  5IAY A;  3OYG A;  1G3S A;  4ATO A;  1XNI A;  3HRT A;  2FHD A;  4IUT A;  2JV2 A;  3M59 A;  4M7D E;  5D6Y A;  4CRI A;  2GCX A;  1AHJ B;  3RKY A;  4F7U E;  1Q82 U;  3PNW C;  3G6E T;  3DB4 A;  1QVP A;  3E1S A;  1G3Y A;  1BI2 A;  2K2V A;  2RB6 A;  3R6O A;  4E7L A;  3SD4 A;  1VQ6 A;  4Y28 E;  1CZ5 A;  5CVI A;  3CC4 A;  2V8J A;  2P0Q A;  3UWN A;  4NS5 A;  5EQJ B;  4C8Q G;  2MMP A;  3CCU T;  4FT4 A;  2Q18 X;  4PJO A;  4R56 A;  3CMA A;  2P0P A;  4II1 A;  2OTL A;  2YLC A;  2HD0 A;  3S3M A;  1EIF A;  1I5L A;  2CZ7 B;  2E10 A;  3M55 A;  2RHY A;  1VUB A;  2L3R A;  3HHT B;  2Y4X A;  2FYK A;  1WJQ A;  3HRS A;  1JB0 E;  2DK3 A;  4MZT A;  3BY7 A;  4C8Q E;  3G71 T;  3V8K A;  1O9S A;  2E6Z A;  1KG1 A;  4ME7 A;  5CQY A;  5GMK m;  3QQ7 A;  2VC8 A;  2DXT A;  5GAM d;  2Y4Y A;  5L8R E;  3X25 B;  1YHQ A;  1K8A U;  1I9G A;  1VQN T;  1RL2 A;  4ZN3 A;  3ER0 A;  4F7U G;  2QQA A;  3QJ6 A;  4N4H A;  4GLK A;  5LJ3 f;  4A4K A;  4BB7 A;  3ZJU A;  5DLQ E;  2A7Y A;  3BW1 A;  2HAX A;  2QTX A;  3OS5 A;  4KT0 E;  1QDN A;  1QW1 A;  4NL2 A;  4PLL A;  3JAM E;  4M7A G;  4PJO F;  5LJ3 d;  2K4Y A;  4XTW A;  3I55 T;  4KUL A;  1JBM A;  3OY9 A;  2L5Q A;  4AS1 A;  3JB9 H;  1OYX A;  4B9X A;  1Q7Y U;  2F5K A;  3INZ A;  1HK9 A;  4C0F A;  1VQL T;  5I2S A;  4ZGJ B;  3FPU A;  2KAF A;  4OVA A;  2QI2 A;  3LX7 A;  3X28 B;  1M1K C;  1YJN T;  2QQ9 A;  1GXI E;  1R8O B;  2R57 A;  3OSV A;  2XI9 A;  3PMT A;  1G3T A;  2DIG A;  1KQ1 A;  2PVG B;  5EPP A;  2XKO C;  2WSE E;  4M75 G;  3WVD B;  4BY6 C;  4J7F A;  1Q81 C;  1V29 B;  1X01 A;  3FJP A;  4RV0 A;  2D0Q B;  2QQS A;  1ZQ1 A;  3I56 A;  3OS1 A;  4X9C A;  2LVM A;  3L2U A;  3PFS A;  5GAN d;  1K73 U;  1NJI U;  5A0G A;  4O5V A;  3T9N A;  3QYH B;  4PL6 A;  1YJW T;  2EQK A;  4J6Y A;  4C0D C;  2LQ8 A;  4OB1 B;  3MEU A;  2LT1 A;  4P5N A;  4EMG A;  4M7A A;  3JB9 I;  2LCC A;  2QDY B;  2ZCF B;  2A3L A;  3CBO A;  2DXC A;  3M56 A;  5CKE A;  5GMK j;  4MZP A;  3JCM c;  4C8Q C;  5KE2 A;  3MEV A;  4RCB A;  2MWO A;  5GAO n;  2L8D A;  3GPL A;  3JCM g;  1VQK A;  3ZEH A;  2ZZD A;  3M9Q A;  2FVU A;  4LDV A;  2EJF A;  2GFA A;  3CD6 T;  4ARI A;  3M57 A;  3L2W A;  3J7A F;  4IUU A;  2V8I A;  4MZM A;  1TH7 A;  1UEB A;  4BI3 A;  3LWH A;  2XK0 A;  3PIO A;  3LH0 A;  1N8R C;  4LD9 K;  1WLF A;  4OGE A;  5C18 A;  3ZJT A;  2HQX A;  4NL3 A;  1MHN A;  3UPU A;  4J8O A;  1VQ4 A;  2BKD N;  2E5Q A;  3OYA A;  3PMI A;  5GMK e;  2DD4 A;  3JB9 F;  3SB2 A;  2RI2 A;  2JN0 A;  3L42 A;  4KBM B;  1YCY A;  2K5L A;  3FIF A;  2DTH A;  3SWN B;  4FSX A;  5GAM g;  1WGS A;  2PUK B;  4M78 C;  5GAN 8;  4HT8 A;  1K8A C;  5CKB A;  3FRN A;  4PJO D;  3HU3 A;  1YJ9 A;  5GAO q;  4BE1 A;  4A4H A;  1O54 A;  1PSF A;  3OYI A;  3OSS C;  4M77 D;  2OTJ T;  3DLM A;  3TCJ A;  4JS5 A;  5CIU A;  4OB3 B;  4VUB A;  4M7D D;  1CR5 A;  3HSB A;  3JRZ A;  1Q7Y C;  1N8R U;  3CMA T;  3FDR A;  4M75 C;  4D6W A;  4IUP A;  1D3B A;  4X34 A;  5CKF A;  2CZ1 B;  3V8J A;  5LJ5 g;  2KSS A;  4ZTF A;  1Q86 U;  2DXU A;  2PQW A;  4QW2 A;  1BI0 A;  3GIB A;  2RH2 A;  4XTZ A;  5GMK h;  1I4K 1;  2X4Y A;  3MEW A;  2O01 E;  5CCX A;  5GAO r;  1UGR B;  5FLX E;  4HCB A;  4E47 A;  1WQ7 A;  1YHQ T;  2LW6 A;  5FU6 C;  4M7D F;  2LRQ A;  5GAN j;  4M77 B;  4L6V 5;  5EG2 A;  3C4S A;  1ZBX A;  1HXD A;  4XK8 E;  5DM7 R;  4ZTJ A;  3QQ8 A;  3L2Q A;  2RD1 A;  1NJI C;  1S3S A;  1QVF S;  4JRI A;  5FTJ A;  1XTD A;  4JUV A;  3CCU A;  2PVO B;  2ZGW A;  2OTL T;  4J5Y A;  5FU7 B;  3A8L B;  4M7A B;  4M75 D;  1VQL A;  1KC8 U;  4C92 G;  2QA4 A;  4M77 C;  1G5V A;  3QII A;  5I21 A;  2LDM A;  5LJ3 h;  5FU6 B;  1QVF A;  1XQH A;  2IVW A;  2F69 A;  2M0O A;  4M75 E;  1JRI A;  2ZPG B;  2DIQ A;  2MM0 A;  3JCM W;  5FTK A;  1WQW A;  5CKD A;  3OB9 A;  1VQN A;  4PJO B;  2RI5 A;  3TU4 K;  2MM2 A;  4Z02 A;  3HU2 A;  3H6Z A;  3I56 T;  2EYQ A;  3X26 B;  4OP0 A;  4UC4 A;  4BDY A;  4L59 A;  5C0M A;  5LJ5 h;  1YBY A;  3JCM e;  4XU2 A;  3OYF A;  3G4S A;  2DPP B;  1YJW A;  2RA2 A;  3CCE T;  3QSU A;  2CYZ B;  2G3R A;  2LCL A;  1O75 A;  3QXE B;  5CQX A;  1Q81 U;  5ERG B;  1Q86 C;  2RHZ A;  2EJ9 A;  3QYG B;  3CCM A;  1VQM T;  1QVG S;  2GF7 A;  3URG A;  3OYC A;  2DEQ A;  1YJN A;  3CD6 A;  3ZGZ A;  3A8M B;  1U1S A;  1G3W A;  4M78 B;  4QVC A;  3Q1J A;  4OF1 A;  4PNO A;  5CR2 A;  4JDS A;  3HKS A;  5A0D A;  4Y91 A;  3SWN C;  2X4J A;  3VUB A;  3CXC A;  3CME A;  1LNX A;  2VXF A;  4LDY A;  2EIF A;  1WPY A;  2ZPE B;  2GQV A;  3BDU A;  3BDL A;  4J83 A;  3NTK A;  5DY9 A;  4ZN1 A;  3CCM T;  4Q5W A;  3JB9 J;  4NOY A;  4XU3 A;  1NE8 A;  3RUX A;  4ZGD B;  3MP8 A;  2VXE A;  4C5I A;  3JCM h;  3OYN A;  3H8Z A;  5FRN A;  5LJ3 j;  2P0K A;  4J6W A;  3L2V A;  3LGA A;  2XDB A;  5J26 A;  2K3X A;  1NPR A;  4PKC C;  5A2Q E;  1VQ9 A;  2PJH B;  2DTO A;  1M5Q 1;  3HFN A;  4RG8 A;  5J39 A;  4N0A C;  1M8V A;  4A4F A;  2LQK A;  2E65 A;  3CC7 T;  3MB5 A;  3JCM b;  3LYI A;  3O8V A;  3MEA A;  2DD5 A;  2B25 A;  1OZ3 A;  4FU6 A;  1B34 A;  3CCQ T;  3DKM A;  1VIE A;  5GAO m;  4M7D G;  2M9U A;  4C92 B;  3LHD A;  3MCA B;  2H3J A;  5CCB A;  4C92 C;  1W2B A;  5FRM A;  4CI0 C;  4C0D B;  3S6W A;  3ZJV A;  3M53 A;  3OYY A;  3QG1 A;  2OAU A;  2PUO B;  2VGM A;  1BKB A;  3RIR A;  3OYM A;  3GOX A;  1U8R A;  3L2Z A;  5CO7 A;  2IG0 A;  2JZ2 A;  2LC4 A;  4M7D A;  4KDI A;  3QBY A;  3DB3 A;  2YVL A;  3CCJ T;  1VQ6 T;  4BY6 B;  4J7I A;  5GLF A;  4E7K A;  4EDU A;  2CKK A;  1VQ8 A;  3GNF B;  1VQO A;  2P4T A;  5CKH A;  2E12 A;  2O4X A;  1S72 T;  1K9M U;  2DTI A;  2O4X B;  3M4G A;  1XOV A;  1YJ9 T;  4XQ3 A;  3CCV T;  3GLX A;  3OMG A;  4A54 A;  3P8H A;  4C8Q F;  2CZ6 B;  3G71 A;  2DVE A;  3M58 A;  1X75 C;  3CBP A;  2YLB A;  3NFC A;  2D9T A;  2RO0 A;  3C94 A;  3RMQ A;  4OGC A;  4BD3 A;  2NLU A;  2VYT A;  4LDU A;  3FB9 A;  4F7U B;  1YI2 T;  4RMO A;  3JCM f;  1S72 A;  5GAN 5;  3A8G B;  3QHS A;  3QZ9 B;  4M78 G;  1KD1 U;  1E32 A;  3OYL A;  2FL7 A;  2DZ9 A;  4HCZ A;  2KY9 A;  3OQ5 A;  1BI1 A;  4M78 E;  5I2M A;  4O6J A;  5M9O A;  4N4G A;  4C0Z A;  3TRE A;  2EAY A;  3RES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...