2KY9A

Solution nmr structure of ydhk c-terminal domain from b.subtilis, northeast structural genomics consortium target target sr518
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
MKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMVDYTSTTSGEKVKNHKWVTEDELSAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ydhK
publication title Solution NMR Structure of ydhK C-terminal Domain from B.subtilis, Northeast Structural Genomics Consortium Target Target SR518
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 26
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1130 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ky9A01
3.10.330.60 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2ky9A02
2KY9A 4FIBA
chains in the Genus database with same CATH superfamily
4XAXB 2R5AA 4FCYA 3M0PA 3M0RA 2OTLA 3CD6Q 4OB1B 2KAFA 2ROLA 1RAGB 1HJDA 5GMKj 3VKIA 3CC2Q 3H9NA 4OVAA 4BUGA 4J6WA 2EVRA 1JJ2P 1RI0A 1VOMA 5FU7C 1OPLA 2K3XA 2EJGA 2XD0A 5L23A 3BE3A 3UPUA 5AT1B 1TTHB 2QTXA 2CSQA 3RDVA 3MEAA 1I8FA 3URGA 4C8QF 2HAXA 5KYXB 3L42A 2FYKA 2PNIA 5FU6C 5LJ5g 2QDYB 1E6GA 1VIEA 3VRZA 2EQUA 2QDLA 3EFRA 1H3HA 3TSWA 2QQBA 5CVIA 2X35A 2QEXA 2K2VA 2M02A 1YJNQ 3EFOB 2MM0A 1K9MC 3JCMd 5GAN2 4RTXA 4AFQC 1PSEA 2FO0A 1VQNQ 3LGLA 5IAYA 4RTYA 5D7UA 1Q81U 2CZ6B 3OYDA 1D09B 4E7LA 2YUPA 1EX4A 3X24B 1IXDA 1KG1A 3QSUA 5KCHA 2OI3A 5GMKi 4OGEA 3CMEA 2XK0A 4M77C 5GAN5 1M27C 1WYXA 2LJ0A 3P8HA 4OMOA 3FJPA 3CCEQ 2WSCE 4R56A 3Q1JA 4B6MA 5GLFA 1FMWA 2F2WA 4OMNA 2DMOA 2QGGA 3ZEHA 1Y96B 3OYBA 3SWNC 2X51A 8AT1B 1GCQA 2PWYA 2RPNA 2RF0A 3E2UA 2DXBA 2K3BA 2PUKB 1WHHA 1VQ7A 3OW2A 1AHJB 2DK3A 1XTDA 4AT1B 5KYNA 4LD9K 2DTHA 2RH2A 5GJVB 5GANg 1M9SA 4F17A 2P84A 4HXJA 2GFAA 5KYUB 3QYGB 2KT1A 1WPYA 3CCMT 1I5OB 3KUFA 1NEBA 3EG2A 1BKBA 4CC3A 1NZ9A 2ZAEA 4HVWA 3HL8A 4PJOG 3C12A 4J6YA 1AZEA 2NUPB 1I5LA 3RNJA 1KC8R 4ATOA 3H41A 2Y90A 3CF2A 1WI7A 2VGMA 1TUGB 5CKEA 2DRMA 1OI1A 1W4SA 3I35A 4FYVB 4QW2A 4C0FA 1R0BG 1BI1A 2JN0A 2KROA 2QQAA 1VQ7T 2DJZA 2KBTA 3SFMA 1WHMA 2P4RA 2O9SA 1KSWA 2C0TA 3CCSQ 3V8KA 5IXBA 2FRWA 4IIOA 2MMPA 4OB3B 5C0MA 1YJ9A 4M7AD 1UECA 2OX7A 4F7UG 2HBWA 5IXFA 1PRLC 2QASA 3V8LA 4M78D 2LP5A 3OW2S 2RJFA 2AHJB 3LH0A 4PJNA 2I2LA 3HRTA 1RACB 2QGFB 1TSFA 1Y07A 3E1SA 3QIIA 2EFIA 3OS2A 3TIWA 2K79A 2HKNA 2VC8A 5CIUA 1KQ2A 2ENMA 2F5KA 4LUEA 3VS6A 1IO6A 2P4TA 2K6DA 4JS4A 4JDSA 1YITA 1K9AA 4MZPA 1X75C 1RUWA 2E41A 5FLXE 1X43A 5DLQE 4GLKA 4M7AA 1JRIA 2KXCA 3JB9H 2NWMA 3L1AA 1YI2A 1YJ9T 5J26A 1YNZA 4XU2A 3OYJA 1QVGA 1UHCA 2C0OA 2SRCA 2BIVA 2QQSA 4C5EA 4C92G 2JMCA 3A8HB 2DZ9A 4AFSC 1M2VA 2Q1DX 4DBQA 1UGRB 4GBQA 3FEOA 2DLPA 3CPWA 2M16A 1PHTA 3M55A 5LJ5f 3F70A 3VS0A 2PVOB 1MGQA 2YT6A 2KDSA 2HL3A 1D1CA 3WVEB 1YITT 2W10A 3O8VA 1Q86U 1R0CB 3WVDB 3M53A 5IHIA 1XJWB 3A8GB 3CCQQ 3CCLA 1M5Q1 3QJ6A 2HBPA 2QYZA 4HCBA 1NJIC 4IIMA 5GAOr 1C0MA 4ARCA 4C8QD 1K0SA 3CMAA 2QK0A 4KH0B 5J39A 4CRIA 1R8OB 4PJOA 4M75C 1VQOA 2AZSA 4FSXA 2COYA 2GQVA 2CP6A 3EAEA 3M59A 3HP9A 1VQ6A 3G71Q 1VQPQ 3M4YA 1AWOA 4LN2A 1E32A 1NPPA 3OYFA 2JTEA 2A36A 1QVGS 5CR2A 1SSFA 4J7IA 1RI9A 2NUTA 1UGQB 7AT1B 4XTWA 2DL5A 2E64A 1KFZA 1ZQ1A 1QWEA 2EJFA 3LYIA 1VYVA 4JS5A 2JXBA 5GANf 2CKKA 2QTVA 3CPWS 3CCLT 2PVDB 2RMOA 3JSCA 3L2UA 2EGEA 2P0PA 2J05A 1BBZA 2O31A 1LCKA 2RNAA 2QI2A 1KQSA 1D1AA 1CZ5A 3HU2A 5DLOA 3CMAT 1JEGA 1WHGA 2E65A 4M7AE 2FVUA 2DFUA 2C06A 5LJ3j 4PL6A 4V2SA 1H641 2O2OA 3GOXA 4IUUA 1VQOT 1W1FA 4M78E 1VQ8Q 4N0AC 2DXCA 2GTOA 1QVFP 2A28A 1Q81C 2RHIA 1WQWA 1VYUA 2E3HA 4RG8A 2LQ8A 2DD4A 4FW1A 4OB2B 2LDMA 1YJNA 2RI5A 3RMQA 2M51A 2E6ZA 4M7AB 1QW1A 3CBPA 4YTLA 3RBBB 3GP8A 1VQNA 3RESA 4KUDK 5ERGB 1YHQQ 1DJ7B 2ZGWA 5C18A 2FL7A 4BDYA 2FPDA 2IVWA 2RK1A 5FROA 2LX7A 2NYSA 4KH1B 4C5GA 3QJYA 1M2VB 4GY5A 4OMPA 3CCEA 1K8AR 1M1KU 2YUQA 3QWYA 2D8HA 4QT7A 3C95A 2DZCA 4AMCA 1IRXA 1OOTA 4IUVA 1KQSS 2IIMA 2KRMA 1ZA2B 5CCAA 2QQ9A 1N8RR 3TU4K 2EKHA 5GAN6 1SG5A 2YVLA 1EFNA 2KXDA 5CAIA 1G2BA 1R7RA 1YJNT 3GNFB 1AD5A 5HK3A 4ZTFA 1YCYA 1VQNT 4J7FA 4PLLA 3RR6A 1WHLA 1UGSB 1I4K1 2CYZB 2GFUA 4C0GA 1GRIA 2FRYA 3LH5A 1K1ZA 3FIFA 4LE9A 1BU1A 3SDZA 2VVKA 3R6NA 3V7CA 4PJOB 4C8QE 1VQMQ 2JV2A 3CCET 3UATA 1VQ4A 4FT4A 3OMGA 2E5QA 1LNXA 5IN1A 1H92A 3FPRA 5I2SA 2GQIA 5LJ5e 3CCVQ 2G6FX 1Q95G 4DBHA 4ME7A 3X20B 2DVJA 2GGRA 3CCRQ 2NUTB 2DTIA 3UWNA 2RHZA 3GNGA 3M58A 2XIDA 1NLPC 3AHUA 5KH6A 5A0LA 1RAIB 2A3LA 2AKLA 3LX7A 2VKNA 5C1BA 2EQJA 3IQLA 1D0ZA 3ULRB 2VWFA 3CC7A 5D6WA 4D8KA 4BY6B 3UDCA 2V1RA 1T3LA 1PWTA 2CP7A 1PD1A 2LCSA 2JVVA 1D0YA 2F2XA 4ZGJB 2YLCA 2DF6A 1B07A 2HDAA 2FPFA 3DKMA 1YJWA 4R0KA 3JRZA 4C0DC 3HFOA 1ZLMA 3NHNA 3EG9A 3ASKA 1EIFA 4J9EA 4M7DF 3U23A 4XTZA 2KQWA 2M9UA 3EHRA 3MEWA 2JJ9A 2F69A 3H0HA 4E7IA 1RABB 2EYZA 2Y4YA 3JCMe 1CKAA 2WSFE 4FU6A 1I81A 3E9GA 4JRIA 2LMJA 2OAWA 3CCST 2GNCA 2L2PA 5GAN8 2J6KA 3ME9A 1LJOA 1WLFA 4KUIA 4ZNXA 1NJIU 1WHJA 1M3BA 3CC7T 1SPKA 2QA4Q 2FZGB 3R6OA 1LPLA 1O9SA 4LD6A 3SHWA 1C6VX 2AZVA 3S6WA 2K57A 4LDXA 2E3IA 3VS2A 2A7YA 3PT9A 3VRYA 2XDDA 3OSSC 1ZUYA 1A0NB 2CH4A 2P0KA 1S3SA 1YJWT 1X69A 1QLYA 3OYYA 3HHTB 1M4ZA 4E47A 2DYIA 3MKDA 1QVPA 2DILA 4F16A 3JCMJ 3TVTA 2HMAA 5GAOl 3CCQA 1M1GA 3BDLA 1TS9A 2DM1A 1OZ3A 2DBKA 3RERA 3RKWA 2K3YA 4RUGA 1MNDA 3QUIA 3RKYA 2YDLA 2LTOA 1XQHA 5LJ3h 4DEYA 4HCKA 1ZBJA 3JB9F 2RJDA 2G3RA 3VV0A 1P92A 1CSKA 4M75D 5KCOA 5GAN3 4ZN1A 1Q86R 2OAUA 1E6HA 4C92C 1X6BA 1Y57A 2YRVA 1OULA 3NTIA 2DVEA 1GL5A 3G71A 2DXUA 4OB0B 1VQPA 4KT0E 2EJ9A 4X9CA 3BQBA 5D6YA 2XMFA 3UA6A 4M7AG 3OYNA 1YIJQ 2PTKA 5CKHA 4QVZA 3BY7A 1VQLQ 3CCMA 2IG0A 2XDPA 2ZZDA 4NL3A 4M78G 2CP2A 2VB6A 2HQHA 2BZXA 4A63B 3FJ5A 3CCQT 3QYHB 1G3TA 2EIFA 4AS1A 4KDIA 3G6EA 1UGVA 3DB3A 3JCMX 1OQKA 1TH7A 3PMIA 4EIKA 3CEYA 3MP1A 1WHKA 2DEQA 1N27A 2CZ7B 2DX1A 4MMLA 5KE2A 1SRLA 1B3QA 1TXQA 2KYBA 1K9MR 5FTJA 4DEXA 4CC7A 1VQ8A 3JCMg 3G71T 1VQPT 1YN8A 2ED0A 4RTWA 4PJJA 3EG9B 1IHWA 4KDLA 3OW2P 5FTKA 4RKUE 3JCMP 3PMTA 3FDRA 2YWWA 1WJSA 1G3WA 5C6SA 5GMKl 2LW6A 1M1KC 3MEVA 1X2QA 1BCMA 1VIFA 5GAMf 3G6ET 2KRNA 2BTTA 1WXBA 1SEMA 1Q82U 5CQYA 4ELYC 1U8RA 1W2BA 4M77F 3G4SQ 4C5IA 3JCMV 1Y0MA 2DL8A 5LJ5j 1VQ8T 1SF9A 4OF1A 3A8LB 4BE1A 2LT4A 1FMVA 4E7JA 2DJQA 1JBMA 4BI3A 2RI2A 1ZSZA 3OS5A 3L2VA 1ACMB 1K73C 4A4GA 2CZ0B 1IREB 1M1KR 2COWA 3CC4A 3HKSA 3VU3C 1RAEB 4FSSA 1QCNA 4LUDA 3OS0A 1TG0A 1YHQT 4J6XA 1WFWA 2M0OA 4M7DD 4FW2A 5LJ3d 3MB5A 8ATCB 5KE3A 1UHFA 3HU3A 3REBB 2K2MA 4RMOA 2DIGA 2L3QA 2ZPFB 3PIPA 1K76A 4CI0C 1VQKQ 1WXUA 4HVVA 5GAOm 2FEIA 1KHIA 1Q7YU 3PFSA 1Z9ZA 1I0CA 2EPDA 2ESWA 2LZ6B 2VV5A 2BZYA 1S72Q 1U1SA 1WXTA 3I56A 3CCRA 1B7TA 2PUOB 4M78A 1W2BS 5GANj 1UGPB 1M8VA 4X34A 2FHDA 2ZPEB 4J9DA 5EG2A 3UA7A 3OYMA 1X6OA 2GCXA 1T0JA 4MZTA 3CC4T 1G5VA 2K7AA 1RLQC 3EG3A 1QVGP 4M7DA 1JU5C 3MO8A 3I9QA 2E5KA 2ECZA 2A37A 3J81E 2DTOA 1ZBXA 2YXYA 1D3BA 3JCMb 3CPWP 4XTXA 1UE9A 3SD4A 2KGTA 2K9GA 4NOYA 2LRQA 3GPLA 3OSVA 4EMGA 3CCVT 3VS4A 2OTLQ 2K4YA 1RAHB 2VASA 4A4HA 5DYGA 2EYYA 1BIAA 3JCMW 2M0YA 1HYOA 1V76A 4XU1A 3I56T 3UF4A 5D6XA 2MYSA 3CCRT 4N4HA 1NE8A 1FX7A 3JB9D 3OYEA 4HVUA 2MI6A 1D1BA 1YWOA 2JTMA 2LC4A 1SSHA 1CR5A 2HZYA 2BE7D 4OP0A 5FWBA 3M0UA 4N4IA 2XDBA 4F14A 2JZ2A 3NTHA 1UJYA 4LDVA 2FPEA 2MAMA 2DYBA 1CZ4A 1SRMA 3M9QA 3A5ZB 1G3SA 1H8KA 2O4XA 5AYFA 3JCMf 1C1AA 5GMKm 4EMKA 2X4YA 2QEXQ 2FG0A 4NS5A 4AFUC 1PCXA 3CD6A 1NJIR 3GBQA 1GCQC 4C8QA 2DERA 2L3PA 4XTUA 1ABOA 5L8RE 4JRKA 3CC2A 1ZSZB 2EQMA 1O54A 2F2VA 4II1A 3UT1A 1OZ2A 5GMKe 3CMEQ 4XU0A 2GBQA 2LQKA 4JUVA 5GAMe 2D1XA 4BI8B 2KSSA 1KQSP 4WTOB 4ANJA 2QQRA 4E6RA 5J3BA 5I22A 4JZ3A 3L2WA 3OYKA 4M75F 4BACA 3TCJA 1ZHIA 4M7DE 2Q19X 3KXTA 3J7AF 2DKGA 2EBPA 1EZZB 2L89A 1AT1B 2HNIA 1M1FA 1HSQA 4GLMA 1JXMA 4LDWA 1ZC1A 2BZ8A 3CCUQ 1M90U 1GFDA 3CD6T 3M5AA 1T3SA 1MMGA 3META 2H8HA 1YIJA 3RUXA 1CKBA 3LGFA 4WF2A 5GAOq 3QPHA 1TWBA 4M78B 1KC8U 1VQLA 2CP3A 3CC2T 2KK4A 2IPOB 5GAOn 2HQXA 4IURA 2J6OA 1OX8A 4M77D 2KT8A 2X4WA 3A1PA 3A8MB 2BE9B 2D0QB 4QKUA 3MEUA 4M7DB 3L2RA 2E10A 1VQ9Q 2LNHB 3NTKA 2L0AA 2HSPA 4DQ2A 1Q81R 5HKCA 5IHKA 1FXXA 2F5TX 2L3SA 3HU1A 9ATCB 2JM9A 5LJ5h 1PKTA 4PLIA 1ZX6A 4A54A 1D3BB 4F04B 2JOYA 1NBEB 2EQIA 1UTIA 2R57A 3N5BB 2RQTA 1Z9QA 1AWJA 3S3OA 3PNWC 3DLLA 1PC0A 3CXCA 2RJCA 2DAQA 1NEGA 1YIJT 3NFCA 4M77A 5FTNA 3G7ZA 4J9IA 1YJ9Q 4XU3A 4EPCA 1MNEA 1Q82C 1VQLT 4M7AC 1GFCA 3QWZA 2KRSA 3RIRA 1FWZA 2XG8D 4L5GA 4PFPA 4PKCC 1K73U 3ZJVA 4LDUA 3G1JA 2RO0A 3WXMB 2ZPHB 2R5MA 4M78C 4ORZA 3KBGA 1QCSA 4QVCA 2B25A 3SWNA 2ATCB 1BB9A 1WA7A 4O5VA 4CC2A 3H0FA 3E19A 3CBOA 1D0XA 4XTYA 5IT9E 1UFFA 4KRTA 3OYIA 3G4SA 3P8BB 2O4XB 2VXFA 1NPRA 4EMHA 4F7UE 4EMKB 4J8OA 3QZ5B 2PVGB 3OB9A 3PVLA 1YWPA 1M2OA 3OYLA 3CCSA 3C4SA 4A4EA 4JLIA 4A4KA 5GANh 4C8QB 3EHQA 2BKDN 5GAMg 1YI2Q 3QZ9B 1N5ZA 2DL7A 4L6V5 2EYWA 2RN8A 3CBMA 5A0DA 1KD1U 5FRMA 4JLGA 1RADB 1MHNA 3M56A 2AKKA 2OTJQ 1OX9A 3CXCS 1Q7YC 5CQXA 1SHGA 1OU8A 3JCMc 1UUEA 2O01E 4MDWA 3JB9I 4DBFA 1NM7A 4A53A 3MCAB 4PJOC 2LT1A 2WSEE 1AWXA 1R77A 1UJ0A 4N4GA 4E7SA 2X3WD 1VQ5Q 2DRKA 3G4ST 5CK9A 4IUQA 1VQKA 5FTMA 3D7SB 5I11A 2HSEB 2V1QA 2LJ3A 2PJHB 3EH2A 1BI3A 2ED1A 3EG1A 3ZJUA 3LWHA 2JNGA 1QP2A 2Z0WA 2OJ2A 2R58A 4KLNA 3GF5A 5A0GA 2M1HA 2MK5A 1HD3A 4QVDA 2MF2A 1LOJA 1X2KA 5EQJB 1UG1A 3M0QA 2RQUA 3HTRA 4M77E 5FU6B 4PK4A 4C5HA 1TUCA 2LVMA 3A98A 2V8IA 3M0SA 4OMQA 5I21A 4KULA 4BY6C 1QMCA 1VQ6Q 2AK5A 2RHUA 1M8MA 4E7KA 2GF7A 4AQ7A 3EG0A 1G8XA 5LJ5d 3V8JA 3QBYA 1VQKT 1WDXA 5KYYA 2DD5A 1I9GA 3V7RA 1FMKA 4ZN3A 2ZCFB 1IGQA 2MPXC 3JV3A 3S3MA 2HD0A 4PJOF 5M9OA 2O88A 2LX9A 1S72T 4M77B 1JJ2A 2CDTA 1KQ1A 2MIOA 3OYHA 3V7SA 4QQDA 2DO3A 3S3NA 4M4ZA 4JPBW 5GAMj 2XHCA 2K5IA 1G3YA 5IH2A 1BIBA 3ZL7C 2DXTA 2O9VA 3ZGZA 3QDFA 1ZA1B 4J9BA 3SWNB 1WGSA 2XI9A 2EYXA 1WX6A 5DYIA 1SHFA 2Q18X 3T9NA 3QG1A 2MM2A 4F7UF 5CKBA 3OBWA 3EGXA 2ZPIB 4HT9A 5CKDA 4ZGDB 1WQ7A 3QO3A 1I1JA 3FC3A 2HL5C 2DETA 2E1HA 1BCOA 1K8AU 2YUJA 4DBRA 2JS2A 2OTLT 4KODA 4HT8A 3C0CA 4UC4A 3REAB 5GANd 2YHTA 3MP8A 1LVKA 1ZUKA 4J9HA 2DE0X 4M75A 4M7DG 4FL6A 1NYFA 2X4XA 3QWXX 2H3JA 1S1NA 5GAN7 5EPPA 4PNOA 5GAN4 2RM4A 1I07A 3H0IA 1N8RU 4ARIA 2D0NA 1QQJA 2CT3A 1AWWA 1VA7A 1B34A 3VS3A 2D6FA 5CO7A 1M90C 2XICA 5LJ3e 5CD1A 4HCZA 4ESRA 1JJ2S 2RHXA 2MCNA 1KC8C 1QP3A 2HQEA 3PE0A 4C92F 1IGUA 2HCKA 1WZOA 3BW1A 4JJDA 2J7IA 1BI2A 1PRMC 2QEXT 4AFZC 3VJPA 3CCUA 2KVQG 1BYMA 2A0FB 2HEQA 4DOWA 1YHQA 2E70A 3I55Q 2KMTA 4MMKA 1V1CA 3RMSA 4CC4B 4N0AA 2FZCB 1PSFA 1RAFB 4PJLA 3CMET 3ER0A 3HRSA 1M90R 1NG2A 3OBYA 1WIEA 1VQ4Q 1VQ9A 3CCJQ 3JAME 2KR3A 4D8DA 3TSZA 2ABLA 3NMZC 1W2BP 3OA6A 4FYWB 2CH4W 3QQ7A 4J9FA 3JB9G 4C8QG 6AT1B 4OMLA 1JXOA 3NGPA 1TUDA 2H3EB 3QKJA 2DNUA 5KYYB 2QG9B 4NL2A 5I2MA 4KGXB 3CCUT 3DLMA 4KGVB 1AVZC 1U1TA 3HRUA 2EGAA 4TVRA 5HY6A 4IUTA 3X28B 1YBYA 2VUBA 5CCXA 3CC7Q 4FYYB 3OMCA 3FPTA 3VYHB 3A8OB 5KYWA 1UDLA 3C94A 1U5SA 4FIBA 1VQMA 4RTVA 1Y7XA 2XKOC 2KNBB 3OYCA 2D9TA 1IHVA 1IZ6A 3X26B 1NYGA 4M75E 3BDUA 1VQ9T 4OMFB 2YUNA 2J06A 1YJWQ 3H8ZA 3CCVA 2MOXA 5HCKA 2LQWA 1KJWA 2CZ1B 2Y4XA 3EGXB 3ZBDA 1HXDA 1KD1C 1K73R 2EYQA 3GLXA 4RG2A 4QQ6A 1YP5A 4Q5WA 4K11A 3TQ7P 3MHXA 1XOVA 4KGZB 3OS1A 3MP6A 3JB9J 2HKQB 3GIBA 2RHYA 3THKA 3VUBA 1OYXA 4M75B 3SEMA 2CP0A 2DEUA 1N6AA 5LJ3g 3LLRA 3INZA 2KE9A 5FW9A 2DBMA 4VUBA 2OTJA 2RA2A 1UB4A 5CKFA 1VQMT 1MMDA 4E7ZA 4R55A 1B34B 1MMAA 2RQWA 5DY9A 4HA8A 1G83A 2EKOA 4DA4A 3E9FA 4Y92A 3TEEA 1OV3A 4PJOD 2DA9A 2AT1B 1BI0A 1M30A 1N9SA 2JMAA 1JB0E 5ECAA 4AG1C 1KD1R 1VQ5A 3FRNA 2JW4A 4ELZC 2NUZA 1IB8A 3X25B 5EC7A 4M77G 1MV3A 1ZSGA 2X3XD 1GBQA 3LWIA 1W6XA 3M54A 1PD0A 2LCLA 5GMKh 1Y71A 4LXCA 1QDNA 1YI2T 5GAMh 4MDXA 5DM7R 2QA4A 3LW5E 5IHNA 4A4FA 2EAYA 1BK2A 1YCSB 2PQWA 3SB2A 3CPFA 2RD1A 2CT4A 4RCBA 2OTJT 2DL3A 1ABQA 2QXFA 1QKXA 2Q1CX 4B9WA 4BB7A 4LDYA 2QAZA 1PNJA 2LNVA 2EQKA 1XNIA 3VYGA 4C0ZA 1VQ5T 5A2QE 4OGCA 3PTAA 1PG5B 1K0XA 2LCCA 4XK8E 1ZUUA 3CCMQ 2E6NA 4KBMB 2AIRB 3OYAA 4CQNA 3PVQA 1MMNA 4XTVA 2DL4A 2RQRA 5FTLA 1K9MU 1F1BB 4IUPA 3QXEB 4F7UA 4LNPA 3G6EQ 2RK2A 4BE0A 2QA4T 2JS0A 4DOVA 1U06A 2L3RA 2YLBA 3I5RA 5KYWB 2DPPB 1TU0B 4C92D 4E7HA 1QVFA 2F1LA 3QHSA 3DB4A 3PGGA 2EW3A 4QQGA 3NPFA 1QWFA 2KEAA 2JM8A 1WLPB 1VQ7Q 2RJEA 1K8AC 5CCBA 3JCMQ 3P8DA 1UEBA 1VQ6T 3KFVA 4Y28E 2MWPA 4BI4A 4D6WA 3OY9A 3FB9A 2DIQA 4ZGEB 1PM3A 2VGNA 5FRNA 1KIKA 2CUDA 1X27A 3OYGA 1VYTA 2LQNA 3AT1B 2P0QA 1N8RC 2FB7A 2V8KA 1PKSA 3LHDA 1OEBA 4JRPA 1HK9A 4RCCA 1ZSZC 3M57A 4JJCA 2J6FA 4B9XA 1H3ZA 4PFZA 4PFOA 4C92A 1O75A 5GAOp 1AEYA 4FM4B 1N9RA 2Q1AX 3EGDA 3J80E 1J3TA 1NLOC 3ZJTA 2X4JA 3OQ5A 4JRQA 2RQVA 1X01A 4RV0A 2JTFA 2E12A 2XU8A 1JQQA 2KI7A 1WJRA 1W70A 3EH1A 2X9HA 2ROTA 4PJOE 4Z88A 4HCCA 2K5LA 4P5NA 1QVFS 3VS1A 1V29B 3CXCP 2EGCA 2COZA 3LGAA 1X6GA 2B86A 3M0TA 3CC4Q 2NLUA 4J9CA 2YSQA 1KHCA 1QKWA 4O6JA 4JZ4A 3MJXA 4BE2A 3I55A 5LJ3f 4WCIA 2CSIA 1JO8A 5GAMd 3VS7A 1RL2A 2C0IA 4ZTJA 5KYXA 4C0DB 4EDUA 4M7DC 4AG2C 1SKUB 1TOVA 3I5SA 2CS7A 5LL6S 2V8JA 2CP5A 1YITQ 1E7OA 3HSBA 3CCJA 2ZPBB 3JCMh 2D8JA 3EFOA 3ZFJA 2L8DA 1RLPC 1Q82R 1K4US 1GXIE 4Z89A 4JJNK 5B6CA 5HK0A 3I56Q 2KYMA 2CUBA 1VUBA 4FYXB 4Z8AA 1GBRA 3QDRB 1GCPA 4M75G 2PU9B 3EGUA 2A08A 4Z02A 2FZKB 4Y91A 2GTJA 3RKXA 2BUDA 4IKFA 4F7UB 4E2FB 3I55T 1QCFA 2YRCA 2I0NA 2L5QA 4M7AF 1MV0B 2KY9A 3EFSA 3VS5A 1AZGB 1WJQA 2WACA 2MWOA 4FT2A 2W0ZA 3O5ZA 1Y96A 4L59A 4KO8A 4RTUA 2RB6A 1QCOA 3CQTA 3HPWA 4M78F 1OPKA 2LJ1A 2CREA 4C92E 1VQ4T 2ZPGB 2RI3A 3CCJT 2VYTA 4BD3A 2SEMA 4OMMA 1M3AA 3M4GA 3CCLQ 1RAAB 1YFNA 1S72A 4XQ3A 1AOJA 4EMKC 2CGHA 5FWCA 5KYUA 3TREA 4BDZA 3BFMA 5FU7B 4MZMA 2PZ1A 3CMAQ 4J9GA 4C8QC 1MUZA 1U3OA 5GANe 1Q7YR 2JT4A 1KK7A 2VXEA 1VQOQ 4RTZA 4RTTA 4J83A 5GJWB 1T0HA 3VUZA 2K5FA 2YUOA 4C92B 4X1VA 2E4HA 3L2ZA 1WNLA 2NUPA 4PJMA 1ARKA 3HFNA 4X9DA 3MPUB 3EGDB 1M3CA 3QC8A 3L2QA 3FPUA 1OU9A 2V26A 2EWNA 3QQ8A 2B8AA 3FLGA 4JJBA 2JUFA 1Q86C 2YRDA 3PIOA 4HKEA 4J5YA 3H6ZA 1FYNA
chains in the Genus database with same CATH topology
1VQ9A 1YCYA 4XAXB 1VQNT 2R5AA 4J7FA 3JAME 2OTLA 4PLLA 4OP0A 4N4IA 2XDBA 4OB1B 1UGSB 2JZ2A 2KAFA 1I4K1 2CYZB 3NTHA 3OA6A 2GFUA 4LDVA 2MAMA 4C0GA 3QQ7A 5GMKj 1CZ4A 3JB9G 3VKIA 4C8QG 3FIFA 3M9QA 3A5ZB 4OVAA 3SDZA 1G3SA 4BUGA 4J6WA 2O4XA 3QKJA 5AYFA 3JCMf 3V7CA 4PJOB 5GMKm 4C8QE 4EMKA 4NL2A 5I2MA 2JV2A 2X4YA 3CCET 3CCUT 3DLMA 1U1TA 1RI0A 1VQ4A 4NS5A 4FT4A 5FU7C 3HRUA 3OMGA 3CD6A 2E5QA 1LNXA 4TVRA 5HY6A 4IUTA 2K3XA 3X28B 2EJGA 5IN1A 3FPRA 1YBYA 4C8QA 5I2SA 5LJ5e 3UPUA 2XD0A 4XTUA 2VUBA 2QTXA 5CCXA 3MEAA 1I8FA 4ME7A 3URGA 5L8RE 3OMCA 3FPTA 3X20B 4C8QF 2HAXA 4JRKA 3CC2A 3VYHB 3A8OB 3L42A 2FYKA 5FU6C 5LJ5g 2QDYB 1VIEA 2DTIA 3UWNA 2RHZA 3GNGA 3M58A 3C94A 2EQMA 2EQUA 2XIDA 1O54A 3EFRA 4FIBA 4II1A 3AHUA 5KH6A 5A0LA 3UT1A 1VQMA 1OZ2A 1Y7XA 5GMKe 2XKOC 3OYCA 4XU0A 2D9TA 2QQBA 1IZ6A 2LQKA 2X35A 5CVIA 2A3LA 3X26B 2K2VA 2QEXA 3LX7A 4JUVA 4M75E 2MM0A 3BDUA 1VQ9T 1K9MC 5GAMe 3JCMd 4BI8B 2KSSA 5C1BA 4OMFB 5GAN2 2EQJA 1PSEA 3LGLA 5IAYA 2QQRA 3H8ZA 3CCVA 1Q81U 2CZ6B 3OYDA 3CC7A 5D6WA 5J3BA 2CZ1B 4E7LA 2Y4XA 3ZBDA 1HXDA 4BY6B 3X24B 3L2WA 3UDCA 1KD1C 1KG1A 3OYKA 4M75F 2EYQA 3GLXA 4RG2A 3TCJA 1ZHIA 4QQ6A 4BACA 3QSUA 3KXTA 5KCHA 4M7DE 2Q19X 5GMKi 4OGEA 4Q5WA 3CMEA 2XK0A 4M77C 3J7AF 2JVVA 5GAN5 2DKGA 3P8HA 2L89A 2HNIA 3FJPA 1M1FA 4LDWA 1ZC1A 3MHXA 1M90U 1XOVA 4ZGJB 3OS1A 2YLCA 2WSCE 3MP6A 3JB9J 3CD6T 3M5AA 4R56A 3DKMA 3Q1JA 2RHYA 4C0DC 3JRZA 3META 1YJWA 3GIBA 5GLFA 1YIJA 3HFOA 3VUBA 1OYXA 4M75B 3RUXA 3ASKA 1EIFA 3LGFA 4WF2A 1N6AA 4M7DF 5LJ3g 5GAOq 3QPHA 4M78B 3LLRA 4XTZA 2KQWA 2M9UA 1KC8U 3MEWA 3ZEHA 1VQLA 3CC2T 2KK4A 3INZA 1Y96B 3OYBA 5GAOn 2F69A 2HQXA 4IURA 3SWNC 4E7IA 4M77D 2Y4YA 3JCMe 4VUBA 2PWYA 2X4WA 2OTJA 2RA2A 1UB4A 2DXBA 5CKFA 2PUKB 2WSFE 4FU6A 4R55A 1VQMT 3A8MB 1I81A 3E9GA 4JRIA 1B34B 1VQ7A 3OW2A 1AHJB 2D0QB 2DK3A 1XTDA 5DY9A 4HA8A 3MEUA 3CCST 2EKOA 4M7DB 3L2RA 4DA4A 2E10A 4LD9K 3E9FA 3TEEA 2DTHA 4PJOD 5GAN8 3NTKA 2RH2A 1LJOA 3ME9A 5GANg 1WLFA 4DQ2A 4KUIA 1BI0A 1M9SA 1N9SA 5HKCA 1NJIU 2GFAA 3CC7T 1JB0E 1FXXA 2F5TX 3HU1A 3QYGB 1VQ5A 3FRNA 4ELZC 5LJ5h 1WPYA 4PLIA 3R6OA 3X25B 3CCMT 1O9SA 4LD6A 4M77G 4A54A 1D3BB 3KUFA 3S6WA 1BKBA 2JOYA 2K57A 2R57A 3N5BB 4LDXA 1NZ9A 2A7YA 3PT9A 2XDDA 3LWIA 3M54A 3S3OA 3OSSC 3HL8A 3PNWC 3DLLA 3CXCA 2LCLA 2P0KA 5GMKh 4PJOG 3C12A 1S3SA 1YJWT 2RJCA 1Y71A 2DAQA 4J6YA 1QDNA 1YIJT 3NFCA 3OYYA 1YI2T 5GAMh 1I5LA 4M77A 5FTNA 3HHTB 3G7ZA 4MDXA 1M4ZA 4ATOA 5DM7R 2QA4A 2Y90A 4XU3A 4EPCA 4E47A 3CF2A 1Q82C 1VQLT 3LW5E 2VGMA 4M7AC 3QWZA 5CKEA 4A4FA 2EAYA 1OI1A 1W4SA 1QVPA 3RIRA 1FWZA 2XG8D 2PQWA 4L5GA 3SB2A 4QW2A 3CPFA 2RD1A 4C0FA 4RCBA 2OTJT 1BI1A 4PKCC 1K73U 2JN0A 3JCMJ 3ZJVA 4LDUA 2QXFA 2QQAA 2RO0A 2DJZA 5GAOl 3CCQA 1VQ7T 3WXMB 1M1GA 2R5MA 2ZPHB 3BDLA 4M78C 3SFMA 4B9WA 4BB7A 2Q1CX 4LDYA 3KBGA 1OZ3A 1QCSA 4QVCA 2B25A 3SWNA 3V8KA 2LNVA 2EQKA 4O5VA 3RERA 2MMPA 3RKWA 1XNIA 2K3YA 3E19A 4OB3B 5C0MA 1YJ9A 3QUIA 3RKYA 4M7AD 3CBOA 2LTOA 1XQHA 5LJ3h 3VYGA 4C0ZA 4XTYA 4F7UG 5IT9E 1VQ5T 5A2QE 3JB9F 2RJDA 4OGCA 3OYIA 3PTAA 3G4SA 2LCCA 2G3RA 3P8BB 2O4XB 1P92A 2VXFA 4M75D 4XK8E 1NPRA 3VV0A 4EMHA 2E6NA 5KCOA 4ZN1A 5GAN3 2OAUA 3V8LA 4F7UE 4KBMB 4EMKB 4J8OA 4M78D 3QZ5B 4C92C 3OYAA 4CQNA 3OW2S 4XTVA 2PVGB 3OB9A 2YRVA 2RJFA 2AHJB 3LH0A 3NTIA 2I2LA 3HRTA 3OYLA 2DVEA 1K9MU 5FTLA 1Y07A 3E1SA 2DXUA 4IUPA 4OB0B 3G71A 3CCSA 3C4SA 1VQPA 3QIIA 3QXEB 2EJ9A 4JLIA 4KT0E 2EFIA 4X9CA 4A4EA 4A4KA 4C8QB 4F7UA 5D6YA 5GANh 2RK2A 2VC8A 3OS2A 3TIWA 2BKDN 5CIUA 4BE0A 4M7AG 3OYNA 1KQ2A 5GAMg 3QZ9B 2QA4T 4DOVA 2L3RA 2YLBA 4L6V5 2F5KA 5CKHA 4QVZA 3BY7A 2DPPB 3CBMA 5A0DA 1KD1U 5FRMA 2P4TA 3CCMA 2IG0A 4C92D 4JLGA 4E7HA 2XDPA 1QVFA 2ZZDA 4NL3A 4M78G 1MHNA 3DB4A 3QHSA 4JDSA 3M56A 3PGGA 4JS4A 1YITA 4QQGA 4MZPA 1X75C 2E41A 5FLXE 3CCQT 5DLQE 4GLKA 3CXCS 3QYHB 1Q7YC 2RJEA 5CQXA 1K8AC 4M7AA 1G3TA 5CCBA 2EIFA 3JCMQ 4AS1A 1JRIA 1UEBA 3P8DA 3JCMc 1VQ6T 3JB9H 4KDIA 2O01E 2MWPA 4Y28E 4MDWA 4BI4A 3L1AA 3DB3A 4D6WA 3JB9I 3OY9A 3G6EA 3FB9A 4A53A 3JCMX 2DIQA 3MCAB 1TH7A 1YI2A 4ZGEB 2VGNA 1YJ9T 2LT1A 4PJOC 3PMIA 5FRNA 5J26A 3OYJA 4XU2A 2WSEE 3CEYA 3MP1A 2DEQA 1QVGA 4N4GA 2BIVA 2QQSA 3BQBA 3OYGA 4C5EA 4C92G 3G4ST 5CK9A 1N27A 4IUQA 2P0QA 1VQKA 5FTMA 2CZ7B 1N8RC 4MMLA 3A8HB 2DZ9A 5KE2A 2Q1DX 5FTJA 2FB7A 2V8KA 3LHDA 2PJHB 1BI3A 1UGRB 4JRPA 3JCMg 1HK9A 1VQ8A 4RCCA 3G71T 3FEOA 3LWHA 3CPWA 3M57A 1VQPT 3ZJUA 2JNGA 2M16A 1QP2A 4B9XA 1H3ZA 4KDLA 3M55A 4C92A 5LJ5f 3F70A 2R58A 1O75A 5GAOp 4KLNA 4FM4B 1N9RA 3GF5A 2PVOB 5FTKA 1MGQA 4RKUE 3JCMP 5A0GA 2KDSA 3PMTA 2Q1AX 3FDRA 3J80E 3ZJTA 1WJSA 2M1HA 1G3WA 2X4JA 3WVEB 5C6SA 1YITT 4QVDA 2MF2A 3OQ5A 1LOJA 5EQJB 5GMKl 3O8VA 2LW6A 1Q86U 4JRQA 4M77E 3WVDB 1M1KC 3M53A 3MEVA 5FU6B 3A8GB 4C5HA 2LVMA 1X01A 1VIFA 5GAMf 4RV0A 2V8IA 2JTFA 3CCLA 5I21A 2E12A 1M5Q1 3QJ6A 2XU8A 4KULA 4BY6C 3G6ET 1WJRA 2HBPA 4HCBA 1NJIC 2RHUA 4E7KA 5GAOr 4PJOE 2GF7A 4AQ7A 1Q82U 4ARCA 5CQYA 4ELYC 4C8QD 4HCCA 2K5LA 1U8RA 3CMAA 5LJ5d 4P5NA 1W2BA 1QVFS 4M77F 3V8JA 1V29B 3QBYA 1VQKT 4C5IA 5J39A 4CRIA 3JCMV 3LGAA 2DD5A 1R8OB 1I9GA 3V7RA 4ZN3A 4PJOA 4M75C 2ZCFB 5LJ5j 1VQOA 2NLUA 4FSXA 1VQ8T 1KHCA 2GQVA 4OF1A 3S3MA 2HD0A 3EAEA 3A8LB 4O6JA 4PJOF 5M9OA 3I55A 3M59A 3HP9A 5LJ3f 4BE2A 1VQ6A 4BE1A 2LX9A 2LT4A 1S72T 3M4YA 4M77B 1E32A 1NPPA 1JJ2A 3OYFA 1KQ1A 5GAMd 1QVGS 4E7JA 5CR2A 3OYHA 1RL2A 1SSFA 4J7IA 4QQDA 3V7SA 4ZTJA 1JBMA 2DO3A 2RI2A 4BI3A 4C0DB 4EDUA 4M7DC 3S3NA 3OS5A 3L2VA 5GAMj 1UGQB 2XHCA 2K5IA 2CS7A 4XTWA 1G3YA 2E64A 2CZ0B 1IREB 5LL6S 4A4GA 1ZQ1A 2V8JA 1BIBA 3CC4A 2EJFA 3HKSA 3VU3C 2DXTA 3HSBA 3LYIA 4JS5A 5GANf 3OS0A 2ZPBB 3CCJA 2CKKA 3JCMh 3ZGZA 3ZFJA 3CPWS 3SWNB 1YHQT 4J6XA 3CCLT 2PVDB 1WGSA 2XI9A 3JSCA 3L2UA 2L8DA 5DYIA 2P0PA 2Q18X 2M0OA 3T9NA 1GXIE 3QG1A 4JJNK 4M7DD 2QI2A 5LJ3d 5HK0A 2MM2A 4F7UF 1KQSA 5B6CA 1VUBA 3MB5A 1CZ5A 3HU2A 5DLOA 5CKBA 3QDRB 3OBWA 3CMAT 2E65A 2ZPIB 5KE3A 4M7AE 4M75G 3HU3A 2FVUA 4HT9A 5CKDA 2C06A 4ZGDB 2PU9B 2DIGA 1WQ7A 2ZPFB 4PL6A 5LJ3j 4CI0C 4RMOA 3PIPA 4V2SA 3QO3A 5GAOm 1H641 3FC3A 4Z02A 1KHIA 3GOXA 4IUUA 2E1HA 4Y91A 1VQOT 1Q7YU 3PFSA 1K8AU 2YUJA 3RKXA 2BUDA 4M78E 4IKFA 2VV5A 2OTLT 4F7UB 3I55T 4HT8A 4KODA 4N0AC 4UC4A 5GANd 2DXCA 2YHTA 3MP8A 1U1SA 2L5QA 4M7AF 2KY9A 3EFSA 4M75A 2RHIA 1Q81C 4M7DG 4FL6A 3I56A 1WQWA 3CCRA 2X4XA 2PUOB 2H3JA 1WJQA 2WACA 4M78A 5GAN7 1W2BS 2MWOA 5GANj 1UGPB 4FT2A 5EPPA 1Y96A 4PNOA 5GAN4 2RM4A 4L59A 1M8VA 4KO8A 4X34A 2RB6A 2FHDA 2ZPEB 4RG8A 5EG2A 3OYMA 2LQ8A 1N8RU 4ARIA 3HPWA 4M78F 1X6OA 2DD4A 2GCXA 4OB2B 2LDMA 4MZTA 3CC4T 2RI5A 1YJNA 3RMQA 1G5VA 4C92E 1B34A 2E6ZA 1VQ4T 2ZPGB 1QW1A 2RI3A 4M7AB 3CCJT 3CBPA 2D6FA 5CO7A 4YTLA 2VYTA 4BD3A 3GP8A 1M90C 3RESA 1VQNA 2XICA 5LJ3e 4M7DA 4KUDK 5CD1A 5ERGB 3M4GA 3MO8A 4HCZA 1DJ7B 1JJ2S 1S72A 4XQ3A 2ZGWA 4EMKC 5C18A 2RHXA 2CGHA 1KC8C 2FL7A 3TREA 4BDYA 1QP3A 2IVWA 4BDZA 3BFMA 2HQEA 2RK1A 5FU7B 3J81E 4C92F 2DTOA 5FROA 1ZBXA 4MZMA 4C5GA 1D3BA 3BW1A 3JCMb 3QJYA 4XTXA 4C8QC 3SD4A 1BI2A 4GY5A 2QEXT 3VJPA 5GANe 3CCEA 3CCUA 1M1KU 2KVQG 2VXEA 4NOYA 1BYMA 2LRQA 3GPLA 3OSVA 4J83A 4DOWA 1YHQA 3VUZA 2E70A 4EMGA 3CCVT 2K5FA 2K4YA 4C92B 2KMTA 4A4HA 5DYGA 1BIAA 2DZCA 3C95A 3JCMW 3L2ZA 1WNLA 4MMKA 4XU1A 4IUVA 3I56T 1KQSS 3HFNA 5D6XA 3CCRT 4X9DA 4N4HA 1K73C 1NE8A 1FX7A 3JB9D 3QC8A 3RMSA 5CCAA 3L2QA 2QQ9A 3FPUA 3TU4K 4N0AA 5GAN6 1PSFA 2EWNA 2MI6A 3OYEA 2YVLA 3QQ8A 2B8AA 3FLGA 2JTMA 2LC4A 3CMET 5CAIA 1R7RA 2JUFA 1Q86C 3PIOA 3ER0A 1YJNT 3GNFB 3HRSA 4HKEA 4J5YA 3OBYA 5HK3A 3H6ZA 4ZTFA 1CR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KY9 A;  4FIB A; 
#chains in the Genus database with same CATH topology
 4XAX B;  2R5A A;  4FCY A;  3M0P A;  3M0R A;  2OTL A;  3CD6 Q;  4OB1 B;  2KAF A;  2ROL A;  1RAG B;  1HJD A;  5GMK j;  3VKI A;  3CC2 Q;  3H9N A;  4OVA A;  4BUG A;  4J6W A;  2EVR A;  1JJ2 P;  1RI0 A;  1VOM A;  5FU7 C;  1OPL A;  2K3X A;  2EJG A;  2XD0 A;  5L23 A;  3BE3 A;  3UPU A;  5AT1 B;  1TTH B;  2QTX A;  2CSQ A;  3RDV A;  3MEA A;  1I8F A;  3URG A;  4C8Q F;  2HAX A;  5KYX B;  3L42 A;  2FYK A;  2PNI A;  5FU6 C;  5LJ5 g;  2QDY B;  1E6G A;  1VIE A;  3VRZ A;  2EQU A;  2QDL A;  3EFR A;  1H3H A;  3TSW A;  2QQB A;  5CVI A;  2X35 A;  2QEX A;  2K2V A;  2M02 A;  1YJN Q;  3EFO B;  2MM0 A;  1K9M C;  3JCM d;  5GAN 2;  4RTX A;  4AFQ C;  1PSE A;  2FO0 A;  1VQN Q;  3LGL A;  5IAY A;  4RTY A;  5D7U A;  1Q81 U;  2CZ6 B;  3OYD A;  1D09 B;  4E7L A;  2YUP A;  1EX4 A;  3X24 B;  1IXD A;  1KG1 A;  3QSU A;  5KCH A;  2OI3 A;  5GMK i;  4OGE A;  3CME A;  2XK0 A;  4M77 C;  5GAN 5;  1M27 C;  1WYX A;  2LJ0 A;  3P8H A;  4OMO A;  3FJP A;  3CCE Q;  2WSC E;  4R56 A;  3Q1J A;  4B6M A;  5GLF A;  1FMW A;  2F2W A;  4OMN A;  2DMO A;  2QGG A;  3ZEH A;  1Y96 B;  3OYB A;  3SWN C;  2X51 A;  8AT1 B;  1GCQ A;  2PWY A;  2RPN A;  2RF0 A;  3E2U A;  2DXB A;  2K3B A;  2PUK B;  1WHH A;  1VQ7 A;  3OW2 A;  1AHJ B;  2DK3 A;  1XTD A;  4AT1 B;  5KYN A;  4LD9 K;  2DTH A;  2RH2 A;  5GJV B;  5GAN g;  1M9S A;  4F17 A;  2P84 A;  4HXJ A;  2GFA A;  5KYU B;  3QYG B;  2KT1 A;  1WPY A;  3CCM T;  1I5O B;  3KUF A;  1NEB A;  3EG2 A;  1BKB A;  4CC3 A;  1NZ9 A;  2ZAE A;  4HVW A;  3HL8 A;  4PJO G;  3C12 A;  4J6Y A;  1AZE A;  2NUP B;  1I5L A;  3RNJ A;  1KC8 R;  4ATO A;  3H41 A;  2Y90 A;  3CF2 A;  1WI7 A;  2VGM A;  1TUG B;  5CKE A;  2DRM A;  1OI1 A;  1W4S A;  3I35 A;  4FYV B;  4QW2 A;  4C0F A;  1R0B G;  1BI1 A;  2JN0 A;  2KRO A;  2QQA A;  1VQ7 T;  2DJZ A;  2KBT A;  3SFM A;  1WHM A;  2P4R A;  2O9S A;  1KSW A;  2C0T A;  3CCS Q;  3V8K A;  5IXB A;  2FRW A;  4IIO A;  2MMP A;  4OB3 B;  5C0M A;  1YJ9 A;  4M7A D;  1UEC A;  2OX7 A;  4F7U G;  2HBW A;  5IXF A;  1PRL C;  2QAS A;  3V8L A;  4M78 D;  2LP5 A;  3OW2 S;  2RJF A;  2AHJ B;  3LH0 A;  4PJN A;  2I2L A;  3HRT A;  1RAC B;  2QGF B;  1TSF A;  1Y07 A;  3E1S A;  3QII A;  2EFI A;  3OS2 A;  3TIW A;  2K79 A;  2HKN A;  2VC8 A;  5CIU A;  1KQ2 A;  2ENM A;  2F5K A;  4LUE A;  3VS6 A;  1IO6 A;  2P4T A;  2K6D A;  4JS4 A;  4JDS A;  1YIT A;  1K9A A;  4MZP A;  1X75 C;  1RUW A;  2E41 A;  5FLX E;  1X43 A;  5DLQ E;  4GLK A;  4M7A A;  1JRI A;  2KXC A;  3JB9 H;  2NWM A;  3L1A A;  1YI2 A;  1YJ9 T;  5J26 A;  1YNZ A;  4XU2 A;  3OYJ A;  1QVG A;  1UHC A;  2C0O A;  2SRC A;  2BIV A;  2QQS A;  4C5E A;  4C92 G;  2JMC A;  3A8H B;  2DZ9 A;  4AFS C;  1M2V A;  2Q1D X;  4DBQ A;  1UGR B;  4GBQ A;  3FEO A;  2DLP A;  3CPW A;  2M16 A;  1PHT A;  3M55 A;  5LJ5 f;  3F70 A;  3VS0 A;  2PVO B;  1MGQ A;  2YT6 A;  2KDS A;  2HL3 A;  1D1C A;  3WVE B;  1YIT T;  2W10 A;  3O8V A;  1Q86 U;  1R0C B;  3WVD B;  3M53 A;  5IHI A;  1XJW B;  3A8G B;  3CCQ Q;  3CCL A;  1M5Q 1;  3QJ6 A;  2HBP A;  2QYZ A;  4HCB A;  1NJI C;  4IIM A;  5GAO r;  1C0M A;  4ARC A;  4C8Q D;  1K0S A;  3CMA A;  2QK0 A;  4KH0 B;  5J39 A;  4CRI A;  1R8O B;  4PJO A;  4M75 C;  1VQO A;  2AZS A;  4FSX A;  2COY A;  2GQV A;  2CP6 A;  3EAE A;  3M59 A;  3HP9 A;  1VQ6 A;  3G71 Q;  1VQP Q;  3M4Y A;  1AWO A;  4LN2 A;  1E32 A;  1NPP A;  3OYF A;  2JTE A;  2A36 A;  1QVG S;  5CR2 A;  1SSF A;  4J7I A;  1RI9 A;  2NUT A;  1UGQ B;  7AT1 B;  4XTW A;  2DL5 A;  2E64 A;  1KFZ A;  1ZQ1 A;  1QWE A;  2EJF A;  3LYI A;  1VYV A;  4JS5 A;  2JXB A;  5GAN f;  2CKK A;  2QTV A;  3CPW S;  3CCL T;  2PVD B;  2RMO A;  3JSC A;  3L2U A;  2EGE A;  2P0P A;  2J05 A;  1BBZ A;  2O31 A;  1LCK A;  2RNA A;  2QI2 A;  1KQS A;  1D1A A;  1CZ5 A;  3HU2 A;  5DLO A;  3CMA T;  1JEG A;  1WHG A;  2E65 A;  4M7A E;  2FVU A;  2DFU A;  2C06 A;  5LJ3 j;  4PL6 A;  4V2S A;  1H64 1;  2O2O A;  3GOX A;  4IUU A;  1VQO T;  1W1F A;  4M78 E;  1VQ8 Q;  4N0A C;  2DXC A;  2GTO A;  1QVF P;  2A28 A;  1Q81 C;  2RHI A;  1WQW A;  1VYU A;  2E3H A;  4RG8 A;  2LQ8 A;  2DD4 A;  4FW1 A;  4OB2 B;  2LDM A;  1YJN A;  2RI5 A;  3RMQ A;  2M51 A;  2E6Z A;  4M7A B;  1QW1 A;  3CBP A;  4YTL A;  3RBB B;  3GP8 A;  1VQN A;  3RES A;  4KUD K;  5ERG B;  1YHQ Q;  1DJ7 B;  2ZGW A;  5C18 A;  2FL7 A;  4BDY A;  2FPD A;  2IVW A;  2RK1 A;  5FRO A;  2LX7 A;  2NYS A;  4KH1 B;  4C5G A;  3QJY A;  1M2V B;  4GY5 A;  4OMP A;  3CCE A;  1K8A R;  1M1K U;  2YUQ A;  3QWY A;  2D8H A;  4QT7 A;  3C95 A;  2DZC A;  4AMC A;  1IRX A;  1OOT A;  4IUV A;  1KQS S;  2IIM A;  2KRM A;  1ZA2 B;  5CCA A;  2QQ9 A;  1N8R R;  3TU4 K;  2EKH A;  5GAN 6;  1SG5 A;  2YVL A;  1EFN A;  2KXD A;  5CAI A;  1G2B A;  1R7R A;  1YJN T;  3GNF B;  1AD5 A;  5HK3 A;  4ZTF A;  1YCY A;  1VQN T;  4J7F A;  4PLL A;  3RR6 A;  1WHL A;  1UGS B;  1I4K 1;  2CYZ B;  2GFU A;  4C0G A;  1GRI A;  2FRY A;  3LH5 A;  1K1Z A;  3FIF A;  4LE9 A;  1BU1 A;  3SDZ A;  2VVK A;  3R6N A;  3V7C A;  4PJO B;  4C8Q E;  1VQM Q;  2JV2 A;  3CCE T;  3UAT A;  1VQ4 A;  4FT4 A;  3OMG A;  2E5Q A;  1LNX A;  5IN1 A;  1H92 A;  3FPR A;  5I2S A;  2GQI A;  5LJ5 e;  3CCV Q;  2G6F X;  1Q95 G;  4DBH A;  4ME7 A;  3X20 B;  2DVJ A;  2GGR A;  3CCR Q;  2NUT B;  2DTI A;  3UWN A;  2RHZ A;  3GNG A;  3M58 A;  2XID A;  1NLP C;  3AHU A;  5KH6 A;  5A0L A;  1RAI B;  2A3L A;  2AKL A;  3LX7 A;  2VKN A;  5C1B A;  2EQJ A;  3IQL A;  1D0Z A;  3ULR B;  2VWF A;  3CC7 A;  5D6W A;  4D8K A;  4BY6 B;  3UDC A;  2V1R A;  1T3L A;  1PWT A;  2CP7 A;  1PD1 A;  2LCS A;  2JVV A;  1D0Y A;  2F2X A;  4ZGJ B;  2YLC A;  2DF6 A;  1B07 A;  2HDA A;  2FPF A;  3DKM A;  1YJW A;  4R0K A;  3JRZ A;  4C0D C;  3HFO A;  1ZLM A;  3NHN A;  3EG9 A;  3ASK A;  1EIF A;  4J9E A;  4M7D F;  3U23 A;  4XTZ A;  2KQW A;  2M9U A;  3EHR A;  3MEW A;  2JJ9 A;  2F69 A;  3H0H A;  4E7I A;  1RAB B;  2EYZ A;  2Y4Y A;  3JCM e;  1CKA A;  2WSF E;  4FU6 A;  1I81 A;  3E9G A;  4JRI A;  2LMJ A;  2OAW A;  3CCS T;  2GNC A;  2L2P A;  5GAN 8;  2J6K A;  3ME9 A;  1LJO A;  1WLF A;  4KUI A;  4ZNX A;  1NJI U;  1WHJ A;  1M3B A;  3CC7 T;  1SPK A;  2QA4 Q;  2FZG B;  3R6O A;  1LPL A;  1O9S A;  4LD6 A;  3SHW A;  1C6V X;  2AZV A;  3S6W A;  2K57 A;  4LDX A;  2E3I A;  3VS2 A;  2A7Y A;  3PT9 A;  3VRY A;  2XDD A;  3OSS C;  1ZUY A;  1A0N B;  2CH4 A;  2P0K A;  1S3S A;  1YJW T;  1X69 A;  1QLY A;  3OYY A;  3HHT B;  1M4Z A;  4E47 A;  2DYI A;  3MKD A;  1QVP A;  2DIL A;  4F16 A;  3JCM J;  3TVT A;  2HMA A;  5GAO l;  3CCQ A;  1M1G A;  3BDL A;  1TS9 A;  2DM1 A;  1OZ3 A;  2DBK A;  3RER A;  3RKW A;  2K3Y A;  4RUG A;  1MND A;  3QUI A;  3RKY A;  2YDL A;  2LTO A;  1XQH A;  5LJ3 h;  4DEY A;  4HCK A;  1ZBJ A;  3JB9 F;  2RJD A;  2G3R A;  3VV0 A;  1P92 A;  1CSK A;  4M75 D;  5KCO A;  5GAN 3;  4ZN1 A;  1Q86 R;  2OAU A;  1E6H A;  4C92 C;  1X6B A;  1Y57 A;  2YRV A;  1OUL A;  3NTI A;  2DVE A;  1GL5 A;  3G71 A;  2DXU A;  4OB0 B;  1VQP A;  4KT0 E;  2EJ9 A;  4X9C A;  3BQB A;  5D6Y A;  2XMF A;  3UA6 A;  4M7A G;  3OYN A;  1YIJ Q;  2PTK A;  5CKH A;  4QVZ A;  3BY7 A;  1VQL Q;  3CCM A;  2IG0 A;  2XDP A;  2ZZD A;  4NL3 A;  4M78 G;  2CP2 A;  2VB6 A;  2HQH A;  2BZX A;  4A63 B;  3FJ5 A;  3CCQ T;  3QYH B;  1G3T A;  2EIF A;  4AS1 A;  4KDI A;  3G6E A;  1UGV A;  3DB3 A;  3JCM X;  1OQK A;  1TH7 A;  3PMI A;  4EIK A;  3CEY A;  3MP1 A;  1WHK A;  2DEQ A;  1N27 A;  2CZ7 B;  2DX1 A;  4MML A;  5KE2 A;  1SRL A;  1B3Q A;  1TXQ A;  2KYB A;  1K9M R;  5FTJ A;  4DEX A;  4CC7 A;  1VQ8 A;  3JCM g;  3G71 T;  1VQP T;  1YN8 A;  2ED0 A;  4RTW A;  4PJJ A;  3EG9 B;  1IHW A;  4KDL A;  3OW2 P;  5FTK A;  4RKU E;  3JCM P;  3PMT A;  3FDR A;  2YWW A;  1WJS A;  1G3W A;  5C6S A;  5GMK l;  2LW6 A;  1M1K C;  3MEV A;  1X2Q A;  1BCM A;  1VIF A;  5GAM f;  3G6E T;  2KRN A;  2BTT A;  1WXB A;  1SEM A;  1Q82 U;  5CQY A;  4ELY C;  1U8R A;  1W2B A;  4M77 F;  3G4S Q;  4C5I A;  3JCM V;  1Y0M A;  2DL8 A;  5LJ5 j;  1VQ8 T;  1SF9 A;  4OF1 A;  3A8L B;  4BE1 A;  2LT4 A;  1FMV A;  4E7J A;  2DJQ A;  1JBM A;  4BI3 A;  2RI2 A;  1ZSZ A;  3OS5 A;  3L2V A;  1ACM B;  1K73 C;  4A4G A;  2CZ0 B;  1IRE B;  1M1K R;  2COW A;  3CC4 A;  3HKS A;  3VU3 C;  1RAE B;  4FSS A;  1QCN A;  4LUD A;  3OS0 A;  1TG0 A;  1YHQ T;  4J6X A;  1WFW A;  2M0O A;  4M7D D;  4FW2 A;  5LJ3 d;  3MB5 A;  8ATC B;  5KE3 A;  1UHF A;  3HU3 A;  3REB B;  2K2M A;  4RMO A;  2DIG A;  2L3Q A;  2ZPF B;  3PIP A;  1K76 A;  4CI0 C;  1VQK Q;  1WXU A;  4HVV A;  5GAO m;  2FEI A;  1KHI A;  1Q7Y U;  3PFS A;  1Z9Z A;  1I0C A;  2EPD A;  2ESW A;  2LZ6 B;  2VV5 A;  2BZY A;  1S72 Q;  1U1S A;  1WXT A;  3I56 A;  3CCR A;  1B7T A;  2PUO B;  4M78 A;  1W2B S;  5GAN j;  1UGP B;  1M8V A;  4X34 A;  2FHD A;  2ZPE B;  4J9D A;  5EG2 A;  3UA7 A;  3OYM A;  1X6O A;  2GCX A;  1T0J A;  4MZT A;  3CC4 T;  1G5V A;  2K7A A;  1RLQ C;  3EG3 A;  1QVG P;  4M7D A;  1JU5 C;  3MO8 A;  3I9Q A;  2E5K A;  2ECZ A;  2A37 A;  3J81 E;  2DTO A;  1ZBX A;  2YXY A;  1D3B A;  3JCM b;  3CPW P;  4XTX A;  1UE9 A;  3SD4 A;  2KGT A;  2K9G A;  4NOY A;  2LRQ A;  3GPL A;  3OSV A;  4EMG A;  3CCV T;  3VS4 A;  2OTL Q;  2K4Y A;  1RAH B;  2VAS A;  4A4H A;  5DYG A;  2EYY A;  1BIA A;  3JCM W;  2M0Y A;  1HYO A;  1V76 A;  4XU1 A;  3I56 T;  3UF4 A;  5D6X A;  2MYS A;  3CCR T;  4N4H A;  1NE8 A;  1FX7 A;  3JB9 D;  3OYE A;  4HVU A;  2MI6 A;  1D1B A;  1YWO A;  2JTM A;  2LC4 A;  1SSH A;  1CR5 A;  2HZY A;  2BE7 D;  4OP0 A;  5FWB A;  3M0U A;  4N4I A;  2XDB A;  4F14 A;  2JZ2 A;  3NTH A;  1UJY A;  4LDV A;  2FPE A;  2MAM A;  2DYB A;  1CZ4 A;  1SRM A;  3M9Q A;  3A5Z B;  1G3S A;  1H8K A;  2O4X A;  5AYF A;  3JCM f;  1C1A A;  5GMK m;  4EMK A;  2X4Y A;  2QEX Q;  2FG0 A;  4NS5 A;  4AFU C;  1PCX A;  3CD6 A;  1NJI R;  3GBQ A;  1GCQ C;  4C8Q A;  2DER A;  2L3P A;  4XTU A;  1ABO A;  5L8R E;  4JRK A;  3CC2 A;  1ZSZ B;  2EQM A;  1O54 A;  2F2V A;  4II1 A;  3UT1 A;  1OZ2 A;  5GMK e;  3CME Q;  4XU0 A;  2GBQ A;  2LQK A;  4JUV A;  5GAM e;  2D1X A;  4BI8 B;  2KSS A;  1KQS P;  4WTO B;  4ANJ A;  2QQR A;  4E6R A;  5J3B A;  5I22 A;  4JZ3 A;  3L2W A;  3OYK A;  4M75 F;  4BAC A;  3TCJ A;  1ZHI A;  4M7D E;  2Q19 X;  3KXT A;  3J7A F;  2DKG A;  2EBP A;  1EZZ B;  2L89 A;  1AT1 B;  2HNI A;  1M1F A;  1HSQ A;  4GLM A;  1JXM A;  4LDW A;  1ZC1 A;  2BZ8 A;  3CCU Q;  1M90 U;  1GFD A;  3CD6 T;  3M5A A;  1T3S A;  1MMG A;  3MET A;  2H8H A;  1YIJ A;  3RUX A;  1CKB A;  3LGF A;  4WF2 A;  5GAO q;  3QPH A;  1TWB A;  4M78 B;  1KC8 U;  1VQL A;  2CP3 A;  3CC2 T;  2KK4 A;  2IPO B;  5GAO n;  2HQX A;  4IUR A;  2J6O A;  1OX8 A;  4M77 D;  2KT8 A;  2X4W A;  3A1P A;  3A8M B;  2BE9 B;  2D0Q B;  4QKU A;  3MEU A;  4M7D B;  3L2R A;  2E10 A;  1VQ9 Q;  2LNH B;  3NTK A;  2L0A A;  2HSP A;  4DQ2 A;  1Q81 R;  5HKC A;  5IHK A;  1FXX A;  2F5T X;  2L3S A;  3HU1 A;  9ATC B;  2JM9 A;  5LJ5 h;  1PKT A;  4PLI A;  1ZX6 A;  4A54 A;  1D3B B;  4F04 B;  2JOY A;  1NBE B;  2EQI A;  1UTI A;  2R57 A;  3N5B B;  2RQT A;  1Z9Q A;  1AWJ A;  3S3O A;  3PNW C;  3DLL A;  1PC0 A;  3CXC A;  2RJC A;  2DAQ A;  1NEG A;  1YIJ T;  3NFC A;  4M77 A;  5FTN A;  3G7Z A;  4J9I A;  1YJ9 Q;  4XU3 A;  4EPC A;  1MNE A;  1Q82 C;  1VQL T;  4M7A C;  1GFC A;  3QWZ A;  2KRS A;  3RIR A;  1FWZ A;  2XG8 D;  4L5G A;  4PFP A;  4PKC C;  1K73 U;  3ZJV A;  4LDU A;  3G1J A;  2RO0 A;  3WXM B;  2ZPH B;  2R5M A;  4M78 C;  4ORZ A;  3KBG A;  1QCS A;  4QVC A;  2B25 A;  3SWN A;  2ATC B;  1BB9 A;  1WA7 A;  4O5V A;  4CC2 A;  3H0F A;  3E19 A;  3CBO A;  1D0X A;  4XTY A;  5IT9 E;  1UFF A;  4KRT A;  3OYI A;  3G4S A;  3P8B B;  2O4X B;  2VXF A;  1NPR A;  4EMH A;  4F7U E;  4EMK B;  4J8O A;  3QZ5 B;  2PVG B;  3OB9 A;  3PVL A;  1YWP A;  1M2O A;  3OYL A;  3CCS A;  3C4S A;  4A4E A;  4JLI A;  4A4K A;  5GAN h;  4C8Q B;  3EHQ A;  2BKD N;  5GAM g;  1YI2 Q;  3QZ9 B;  1N5Z A;  2DL7 A;  4L6V 5;  2EYW A;  2RN8 A;  3CBM A;  5A0D A;  1KD1 U;  5FRM A;  4JLG A;  1RAD B;  1MHN A;  3M56 A;  2AKK A;  2OTJ Q;  1OX9 A;  3CXC S;  1Q7Y C;  5CQX A;  1SHG A;  1OU8 A;  3JCM c;  1UUE A;  2O01 E;  4MDW A;  3JB9 I;  4DBF A;  1NM7 A;  4A53 A;  3MCA B;  4PJO C;  2LT1 A;  2WSE E;  1AWX A;  1R77 A;  1UJ0 A;  4N4G A;  4E7S A;  2X3W D;  1VQ5 Q;  2DRK A;  3G4S T;  5CK9 A;  4IUQ A;  1VQK A;  5FTM A;  3D7S B;  5I11 A;  2HSE B;  2V1Q A;  2LJ3 A;  2PJH B;  3EH2 A;  1BI3 A;  2ED1 A;  3EG1 A;  3ZJU A;  3LWH A;  2JNG A;  1QP2 A;  2Z0W A;  2OJ2 A;  2R58 A;  4KLN A;  3GF5 A;  5A0G A;  2M1H A;  2MK5 A;  1HD3 A;  4QVD A;  2MF2 A;  1LOJ A;  1X2K A;  5EQJ B;  1UG1 A;  3M0Q A;  2RQU A;  3HTR A;  4M77 E;  5FU6 B;  4PK4 A;  4C5H A;  1TUC A;  2LVM A;  3A98 A;  2V8I A;  3M0S A;  4OMQ A;  5I21 A;  4KUL A;  4BY6 C;  1QMC A;  1VQ6 Q;  2AK5 A;  2RHU A;  1M8M A;  4E7K A;  2GF7 A;  4AQ7 A;  3EG0 A;  1G8X A;  5LJ5 d;  3V8J A;  3QBY A;  1VQK T;  1WDX A;  5KYY A;  2DD5 A;  1I9G A;  3V7R A;  1FMK A;  4ZN3 A;  2ZCF B;  1IGQ A;  2MPX C;  3JV3 A;  3S3M A;  2HD0 A;  4PJO F;  5M9O A;  2O88 A;  2LX9 A;  1S72 T;  4M77 B;  1JJ2 A;  2CDT A;  1KQ1 A;  2MIO A;  3OYH A;  3V7S A;  4QQD A;  2DO3 A;  3S3N A;  4M4Z A;  4JPB W;  5GAM j;  2XHC A;  2K5I A;  1G3Y A;  5IH2 A;  1BIB A;  3ZL7 C;  2DXT A;  2O9V A;  3ZGZ A;  3QDF A;  1ZA1 B;  4J9B A;  3SWN B;  1WGS A;  2XI9 A;  2EYX A;  1WX6 A;  5DYI A;  1SHF A;  2Q18 X;  3T9N A;  3QG1 A;  2MM2 A;  4F7U F;  5CKB A;  3OBW A;  3EGX A;  2ZPI B;  4HT9 A;  5CKD A;  4ZGD B;  1WQ7 A;  3QO3 A;  1I1J A;  3FC3 A;  2HL5 C;  2DET A;  2E1H A;  1BCO A;  1K8A U;  2YUJ A;  4DBR A;  2JS2 A;  2OTL T;  4KOD A;  4HT8 A;  3C0C A;  4UC4 A;  3REA B;  5GAN d;  2YHT A;  3MP8 A;  1LVK A;  1ZUK A;  4J9H A;  2DE0 X;  4M75 A;  4M7D G;  4FL6 A;  1NYF A;  2X4X A;  3QWX X;  2H3J A;  1S1N A;  5GAN 7;  5EPP A;  4PNO A;  5GAN 4;  2RM4 A;  1I07 A;  3H0I A;  1N8R U;  4ARI A;  2D0N A;  1QQJ A;  2CT3 A;  1AWW A;  1VA7 A;  1B34 A;  3VS3 A;  2D6F A;  5CO7 A;  1M90 C;  2XIC A;  5LJ3 e;  5CD1 A;  4HCZ A;  4ESR A;  1JJ2 S;  2RHX A;  2MCN A;  1KC8 C;  1QP3 A;  2HQE A;  3PE0 A;  4C92 F;  1IGU A;  2HCK A;  1WZO A;  3BW1 A;  4JJD A;  2J7I A;  1BI2 A;  1PRM C;  2QEX T;  4AFZ C;  3VJP A;  3CCU A;  2KVQ G;  1BYM A;  2A0F B;  2HEQ A;  4DOW A;  1YHQ A;  2E70 A;  3I55 Q;  2KMT A;  4MMK A;  1V1C A;  3RMS A;  4CC4 B;  4N0A A;  2FZC B;  1PSF A;  1RAF B;  4PJL A;  3CME T;  3ER0 A;  3HRS A;  1M90 R;  1NG2 A;  3OBY A;  1WIE A;  1VQ4 Q;  1VQ9 A;  3CCJ Q;  3JAM E;  2KR3 A;  4D8D A;  3TSZ A;  2ABL A;  3NMZ C;  1W2B P;  3OA6 A;  4FYW B;  2CH4 W;  3QQ7 A;  4J9F A;  3JB9 G;  4C8Q G;  6AT1 B;  4OML A;  1JXO A;  3NGP A;  1TUD A;  2H3E B;  3QKJ A;  2DNU A;  5KYY B;  2QG9 B;  4NL2 A;  5I2M A;  4KGX B;  3CCU T;  3DLM A;  4KGV B;  1AVZ C;  1U1T A;  3HRU A;  2EGA A;  4TVR A;  5HY6 A;  4IUT A;  3X28 B;  1YBY A;  2VUB A;  5CCX A;  3CC7 Q;  4FYY B;  3OMC A;  3FPT A;  3VYH B;  3A8O B;  5KYW A;  1UDL A;  3C94 A;  1U5S A;  4FIB A;  1VQM A;  4RTV A;  1Y7X A;  2XKO C;  2KNB B;  3OYC A;  2D9T A;  1IHV A;  1IZ6 A;  3X26 B;  1NYG A;  4M75 E;  3BDU A;  1VQ9 T;  4OMF B;  2YUN A;  2J06 A;  1YJW Q;  3H8Z A;  3CCV A;  2MOX A;  5HCK A;  2LQW A;  1KJW A;  2CZ1 B;  2Y4X A;  3EGX B;  3ZBD A;  1HXD A;  1KD1 C;  1K73 R;  2EYQ A;  3GLX A;  4RG2 A;  4QQ6 A;  1YP5 A;  4Q5W A;  4K11 A;  3TQ7 P;  3MHX A;  1XOV A;  4KGZ B;  3OS1 A;  3MP6 A;  3JB9 J;  2HKQ B;  3GIB A;  2RHY A;  3THK A;  3VUB A;  1OYX A;  4M75 B;  3SEM A;  2CP0 A;  2DEU A;  1N6A A;  5LJ3 g;  3LLR A;  3INZ A;  2KE9 A;  5FW9 A;  2DBM A;  4VUB A;  2OTJ A;  2RA2 A;  1UB4 A;  5CKF A;  1VQM T;  1MMD A;  4E7Z A;  4R55 A;  1B34 B;  1MMA A;  2RQW A;  5DY9 A;  4HA8 A;  1G83 A;  2EKO A;  4DA4 A;  3E9F A;  4Y92 A;  3TEE A;  1OV3 A;  4PJO D;  2DA9 A;  2AT1 B;  1BI0 A;  1M30 A;  1N9S A;  2JMA A;  1JB0 E;  5ECA A;  4AG1 C;  1KD1 R;  1VQ5 A;  3FRN A;  2JW4 A;  4ELZ C;  2NUZ A;  1IB8 A;  3X25 B;  5EC7 A;  4M77 G;  1MV3 A;  1ZSG A;  2X3X D;  1GBQ A;  3LWI A;  1W6X A;  3M54 A;  1PD0 A;  2LCL A;  5GMK h;  1Y71 A;  4LXC A;  1QDN A;  1YI2 T;  5GAM h;  4MDX A;  5DM7 R;  2QA4 A;  3LW5 E;  5IHN A;  4A4F A;  2EAY A;  1BK2 A;  1YCS B;  2PQW A;  3SB2 A;  3CPF A;  2RD1 A;  2CT4 A;  4RCB A;  2OTJ T;  2DL3 A;  1ABQ A;  2QXF A;  1QKX A;  2Q1C X;  4B9W A;  4BB7 A;  4LDY A;  2QAZ A;  1PNJ A;  2LNV A;  2EQK A;  1XNI A;  3VYG A;  4C0Z A;  1VQ5 T;  5A2Q E;  4OGC A;  3PTA A;  1PG5 B;  1K0X A;  2LCC A;  4XK8 E;  1ZUU A;  3CCM Q;  2E6N A;  4KBM B;  2AIR B;  3OYA A;  4CQN A;  3PVQ A;  1MMN A;  4XTV A;  2DL4 A;  2RQR A;  5FTL A;  1K9M U;  1F1B B;  4IUP A;  3QXE B;  4F7U A;  4LNP A;  3G6E Q;  2RK2 A;  4BE0 A;  2QA4 T;  2JS0 A;  4DOV A;  1U06 A;  2L3R A;  2YLB A;  3I5R A;  5KYW B;  2DPP B;  1TU0 B;  4C92 D;  4E7H A;  1QVF A;  2F1L A;  3QHS A;  3DB4 A;  3PGG A;  2EW3 A;  4QQG A;  3NPF A;  1QWF A;  2KEA A;  2JM8 A;  1WLP B;  1VQ7 Q;  2RJE A;  1K8A C;  5CCB A;  3JCM Q;  3P8D A;  1UEB A;  1VQ6 T;  3KFV A;  4Y28 E;  2MWP A;  4BI4 A;  4D6W A;  3OY9 A;  3FB9 A;  2DIQ A;  4ZGE B;  1PM3 A;  2VGN A;  5FRN A;  1KIK A;  2CUD A;  1X27 A;  3OYG A;  1VYT A;  2LQN A;  3AT1 B;  2P0Q A;  1N8R C;  2FB7 A;  2V8K A;  1PKS A;  3LHD A;  1OEB A;  4JRP A;  1HK9 A;  4RCC A;  1ZSZ C;  3M57 A;  4JJC A;  2J6F A;  4B9X A;  1H3Z A;  4PFZ A;  4PFO A;  4C92 A;  1O75 A;  5GAO p;  1AEY A;  4FM4 B;  1N9R A;  2Q1A X;  3EGD A;  3J80 E;  1J3T A;  1NLO C;  3ZJT A;  2X4J A;  3OQ5 A;  4JRQ A;  2RQV A;  1X01 A;  4RV0 A;  2JTF A;  2E12 A;  2XU8 A;  1JQQ A;  2KI7 A;  1WJR A;  1W70 A;  3EH1 A;  2X9H A;  2ROT A;  4PJO E;  4Z88 A;  4HCC A;  2K5L A;  4P5N A;  1QVF S;  3VS1 A;  1V29 B;  3CXC P;  2EGC A;  2COZ A;  3LGA A;  1X6G A;  2B86 A;  3M0T A;  3CC4 Q;  2NLU A;  4J9C A;  2YSQ A;  1KHC A;  1QKW A;  4O6J A;  4JZ4 A;  3MJX A;  4BE2 A;  3I55 A;  5LJ3 f;  4WCI A;  2CSI A;  1JO8 A;  5GAM d;  3VS7 A;  1RL2 A;  2C0I A;  4ZTJ A;  5KYX A;  4C0D B;  4EDU A;  4M7D C;  4AG2 C;  1SKU B;  1TOV A;  3I5S A;  2CS7 A;  5LL6 S;  2V8J A;  2CP5 A;  1YIT Q;  1E7O A;  3HSB A;  3CCJ A;  2ZPB B;  3JCM h;  2D8J A;  3EFO A;  3ZFJ A;  2L8D A;  1RLP C;  1Q82 R;  1K4U S;  1GXI E;  4Z89 A;  4JJN K;  5B6C A;  5HK0 A;  3I56 Q;  2KYM A;  2CUB A;  1VUB A;  4FYX B;  4Z8A A;  1GBR A;  3QDR B;  1GCP A;  4M75 G;  2PU9 B;  3EGU A;  2A08 A;  4Z02 A;  2FZK B;  4Y91 A;  2GTJ A;  3RKX A;  2BUD A;  4IKF A;  4F7U B;  4E2F B;  3I55 T;  1QCF A;  2YRC A;  2I0N A;  2L5Q A;  4M7A F;  1MV0 B;  2KY9 A;  3EFS A;  3VS5 A;  1AZG B;  1WJQ A;  2WAC A;  2MWO A;  4FT2 A;  2W0Z A;  3O5Z A;  1Y96 A;  4L59 A;  4KO8 A;  4RTU A;  2RB6 A;  1QCO A;  3CQT A;  3HPW A;  4M78 F;  1OPK A;  2LJ1 A;  2CRE A;  4C92 E;  1VQ4 T;  2ZPG B;  2RI3 A;  3CCJ T;  2VYT A;  4BD3 A;  2SEM A;  4OMM A;  1M3A A;  3M4G A;  3CCL Q;  1RAA B;  1YFN A;  1S72 A;  4XQ3 A;  1AOJ A;  4EMK C;  2CGH A;  5FWC A;  5KYU A;  3TRE A;  4BDZ A;  3BFM A;  5FU7 B;  4MZM A;  2PZ1 A;  3CMA Q;  4J9G A;  4C8Q C;  1MUZ A;  1U3O A;  5GAN e;  1Q7Y R;  2JT4 A;  1KK7 A;  2VXE A;  1VQO Q;  4RTZ A;  4RTT A;  4J83 A;  5GJW B;  1T0H A;  3VUZ A;  2K5F A;  2YUO A;  4C92 B;  4X1V A;  2E4H A;  3L2Z A;  1WNL A;  2NUP A;  4PJM A;  1ARK A;  3HFN A;  4X9D A;  3MPU B;  3EGD B;  1M3C A;  3QC8 A;  3L2Q A;  3FPU A;  1OU9 A;  2V26 A;  2EWN A;  3QQ8 A;  2B8A A;  3FLG A;  4JJB A;  2JUF A;  1Q86 C;  2YRD A;  3PIO A;  4HKE A;  4J5Y A;  3H6Z A;  1FYN A; 
#chains in the Genus database with same CATH homology
 1VQ9 A;  1YCY A;  4XAX B;  1VQN T;  2R5A A;  4J7F A;  3JAM E;  2OTL A;  4PLL A;  4OP0 A;  4N4I A;  2XDB A;  4OB1 B;  1UGS B;  2JZ2 A;  2KAF A;  1I4K 1;  2CYZ B;  3NTH A;  3OA6 A;  2GFU A;  4LDV A;  2MAM A;  4C0G A;  3QQ7 A;  5GMK j;  1CZ4 A;  3JB9 G;  3VKI A;  4C8Q G;  3FIF A;  3M9Q A;  3A5Z B;  4OVA A;  3SDZ A;  1G3S A;  4BUG A;  4J6W A;  2O4X A;  3QKJ A;  5AYF A;  3JCM f;  3V7C A;  4PJO B;  5GMK m;  4C8Q E;  4EMK A;  4NL2 A;  5I2M A;  2JV2 A;  2X4Y A;  3CCE T;  3CCU T;  3DLM A;  1U1T A;  1RI0 A;  1VQ4 A;  4NS5 A;  4FT4 A;  5FU7 C;  3HRU A;  3OMG A;  3CD6 A;  2E5Q A;  1LNX A;  4TVR A;  5HY6 A;  4IUT A;  2K3X A;  3X28 B;  2EJG A;  5IN1 A;  3FPR A;  1YBY A;  4C8Q A;  5I2S A;  5LJ5 e;  3UPU A;  2XD0 A;  4XTU A;  2VUB A;  2QTX A;  5CCX A;  3MEA A;  1I8F A;  4ME7 A;  3URG A;  5L8R E;  3OMC A;  3FPT A;  3X20 B;  4C8Q F;  2HAX A;  4JRK A;  3CC2 A;  3VYH B;  3A8O B;  3L42 A;  2FYK A;  5FU6 C;  5LJ5 g;  2QDY B;  1VIE A;  2DTI A;  3UWN A;  2RHZ A;  3GNG A;  3M58 A;  3C94 A;  2EQM A;  2EQU A;  2XID A;  1O54 A;  3EFR A;  4FIB A;  4II1 A;  3AHU A;  5KH6 A;  5A0L A;  3UT1 A;  1VQM A;  1OZ2 A;  1Y7X A;  5GMK e;  2XKO C;  3OYC A;  4XU0 A;  2D9T A;  2QQB A;  1IZ6 A;  2LQK A;  2X35 A;  5CVI A;  2A3L A;  3X26 B;  2K2V A;  2QEX A;  3LX7 A;  4JUV A;  4M75 E;  2MM0 A;  3BDU A;  1VQ9 T;  1K9M C;  5GAM e;  3JCM d;  4BI8 B;  2KSS A;  5C1B A;  4OMF B;  5GAN 2;  2EQJ A;  1PSE A;  3LGL A;  5IAY A;  2QQR A;  3H8Z A;  3CCV A;  1Q81 U;  2CZ6 B;  3OYD A;  3CC7 A;  5D6W A;  5J3B A;  2CZ1 B;  4E7L A;  2Y4X A;  3ZBD A;  1HXD A;  4BY6 B;  3X24 B;  3L2W A;  3UDC A;  1KD1 C;  1KG1 A;  3OYK A;  4M75 F;  2EYQ A;  3GLX A;  4RG2 A;  3TCJ A;  1ZHI A;  4QQ6 A;  4BAC A;  3QSU A;  3KXT A;  5KCH A;  4M7D E;  2Q19 X;  5GMK i;  4OGE A;  4Q5W A;  3CME A;  2XK0 A;  4M77 C;  3J7A F;  2JVV A;  5GAN 5;  2DKG A;  3P8H A;  2L89 A;  2HNI A;  3FJP A;  1M1F A;  4LDW A;  1ZC1 A;  3MHX A;  1M90 U;  1XOV A;  4ZGJ B;  3OS1 A;  2YLC A;  2WSC E;  3MP6 A;  3JB9 J;  3CD6 T;  3M5A A;  4R56 A;  3DKM A;  3Q1J A;  2RHY A;  4C0D C;  3JRZ A;  3MET A;  1YJW A;  3GIB A;  5GLF A;  1YIJ A;  3HFO A;  3VUB A;  1OYX A;  4M75 B;  3RUX A;  3ASK A;  1EIF A;  3LGF A;  4WF2 A;  1N6A A;  4M7D F;  5LJ3 g;  5GAO q;  3QPH A;  4M78 B;  3LLR A;  4XTZ A;  2KQW A;  2M9U A;  1KC8 U;  3MEW A;  3ZEH A;  1VQL A;  3CC2 T;  2KK4 A;  3INZ A;  1Y96 B;  3OYB A;  5GAO n;  2F69 A;  2HQX A;  4IUR A;  3SWN C;  4E7I A;  4M77 D;  2Y4Y A;  3JCM e;  4VUB A;  2PWY A;  2X4W A;  2OTJ A;  2RA2 A;  1UB4 A;  2DXB A;  5CKF A;  2PUK B;  2WSF E;  4FU6 A;  4R55 A;  1VQM T;  3A8M B;  1I81 A;  3E9G A;  4JRI A;  1B34 B;  1VQ7 A;  3OW2 A;  1AHJ B;  2D0Q B;  2DK3 A;  1XTD A;  5DY9 A;  4HA8 A;  3MEU A;  3CCS T;  2EKO A;  4M7D B;  3L2R A;  4DA4 A;  2E10 A;  4LD9 K;  3E9F A;  3TEE A;  2DTH A;  4PJO D;  5GAN 8;  3NTK A;  2RH2 A;  1LJO A;  3ME9 A;  5GAN g;  1WLF A;  4DQ2 A;  4KUI A;  1BI0 A;  1M9S A;  1N9S A;  5HKC A;  1NJI U;  2GFA A;  3CC7 T;  1JB0 E;  1FXX A;  2F5T X;  3HU1 A;  3QYG B;  1VQ5 A;  3FRN A;  4ELZ C;  5LJ5 h;  1WPY A;  4PLI A;  3R6O A;  3X25 B;  3CCM T;  1O9S A;  4LD6 A;  4M77 G;  4A54 A;  1D3B B;  3KUF A;  3S6W A;  1BKB A;  2JOY A;  2K57 A;  2R57 A;  3N5B B;  4LDX A;  1NZ9 A;  2A7Y A;  3PT9 A;  2XDD A;  3LWI A;  3M54 A;  3S3O A;  3OSS C;  3HL8 A;  3PNW C;  3DLL A;  3CXC A;  2LCL A;  2P0K A;  5GMK h;  4PJO G;  3C12 A;  1S3S A;  1YJW T;  2RJC A;  1Y71 A;  2DAQ A;  4J6Y A;  1QDN A;  1YIJ T;  3NFC A;  3OYY A;  1YI2 T;  5GAM h;  1I5L A;  4M77 A;  5FTN A;  3HHT B;  3G7Z A;  4MDX A;  1M4Z A;  4ATO A;  5DM7 R;  2QA4 A;  2Y90 A;  4XU3 A;  4EPC A;  4E47 A;  3CF2 A;  1Q82 C;  1VQL T;  3LW5 E;  2VGM A;  4M7A C;  3QWZ A;  5CKE A;  4A4F A;  2EAY A;  1OI1 A;  1W4S A;  1QVP A;  3RIR A;  1FWZ A;  2XG8 D;  2PQW A;  4L5G A;  3SB2 A;  4QW2 A;  3CPF A;  2RD1 A;  4C0F A;  4RCB A;  2OTJ T;  1BI1 A;  4PKC C;  1K73 U;  2JN0 A;  3JCM J;  3ZJV A;  4LDU A;  2QXF A;  2QQA A;  2RO0 A;  2DJZ A;  5GAO l;  3CCQ A;  1VQ7 T;  3WXM B;  1M1G A;  2R5M A;  2ZPH B;  3BDL A;  4M78 C;  3SFM A;  4B9W A;  4BB7 A;  2Q1C X;  4LDY A;  3KBG A;  1OZ3 A;  1QCS A;  4QVC A;  2B25 A;  3SWN A;  3V8K A;  2LNV A;  2EQK A;  4O5V A;  3RER A;  2MMP A;  3RKW A;  1XNI A;  2K3Y A;  3E19 A;  4OB3 B;  5C0M A;  1YJ9 A;  3QUI A;  3RKY A;  4M7A D;  3CBO A;  2LTO A;  1XQH A;  5LJ3 h;  3VYG A;  4C0Z A;  4XTY A;  4F7U G;  5IT9 E;  1VQ5 T;  5A2Q E;  3JB9 F;  2RJD A;  4OGC A;  3OYI A;  3PTA A;  3G4S A;  2LCC A;  2G3R A;  3P8B B;  2O4X B;  1P92 A;  2VXF A;  4M75 D;  4XK8 E;  1NPR A;  3VV0 A;  4EMH A;  2E6N A;  5KCO A;  4ZN1 A;  5GAN 3;  2OAU A;  3V8L A;  4F7U E;  4KBM B;  4EMK B;  4J8O A;  4M78 D;  3QZ5 B;  4C92 C;  3OYA A;  4CQN A;  3OW2 S;  4XTV A;  2PVG B;  3OB9 A;  2YRV A;  2RJF A;  2AHJ B;  3LH0 A;  3NTI A;  2I2L A;  3HRT A;  3OYL A;  2DVE A;  1K9M U;  5FTL A;  1Y07 A;  3E1S A;  2DXU A;  4IUP A;  4OB0 B;  3G71 A;  3CCS A;  3C4S A;  1VQP A;  3QII A;  3QXE B;  2EJ9 A;  4JLI A;  4KT0 E;  2EFI A;  4X9C A;  4A4E A;  4A4K A;  4C8Q B;  4F7U A;  5D6Y A;  5GAN h;  2RK2 A;  2VC8 A;  3OS2 A;  3TIW A;  2BKD N;  5CIU A;  4BE0 A;  4M7A G;  3OYN A;  1KQ2 A;  5GAM g;  3QZ9 B;  2QA4 T;  4DOV A;  2L3R A;  2YLB A;  4L6V 5;  2F5K A;  5CKH A;  4QVZ A;  3BY7 A;  2DPP B;  3CBM A;  5A0D A;  1KD1 U;  5FRM A;  2P4T A;  3CCM A;  2IG0 A;  4C92 D;  4JLG A;  4E7H A;  2XDP A;  1QVF A;  2ZZD A;  4NL3 A;  4M78 G;  1MHN A;  3DB4 A;  3QHS A;  4JDS A;  3M56 A;  3PGG A;  4JS4 A;  1YIT A;  4QQG A;  4MZP A;  1X75 C;  2E41 A;  5FLX E;  3CCQ T;  5DLQ E;  4GLK A;  3CXC S;  3QYH B;  1Q7Y C;  2RJE A;  5CQX A;  1K8A C;  4M7A A;  1G3T A;  5CCB A;  2EIF A;  3JCM Q;  4AS1 A;  1JRI A;  1UEB A;  3P8D A;  3JCM c;  1VQ6 T;  3JB9 H;  4KDI A;  2O01 E;  2MWP A;  4Y28 E;  4MDW A;  4BI4 A;  3L1A A;  3DB3 A;  4D6W A;  3JB9 I;  3OY9 A;  3G6E A;  3FB9 A;  4A53 A;  3JCM X;  2DIQ A;  3MCA B;  1TH7 A;  1YI2 A;  4ZGE B;  2VGN A;  1YJ9 T;  2LT1 A;  4PJO C;  3PMI A;  5FRN A;  5J26 A;  3OYJ A;  4XU2 A;  2WSE E;  3CEY A;  3MP1 A;  2DEQ A;  1QVG A;  4N4G A;  2BIV A;  2QQS A;  3BQB A;  3OYG A;  4C5E A;  4C92 G;  3G4S T;  5CK9 A;  1N27 A;  4IUQ A;  2P0Q A;  1VQK A;  5FTM A;  2CZ7 B;  1N8R C;  4MML A;  3A8H B;  2DZ9 A;  5KE2 A;  2Q1D X;  5FTJ A;  2FB7 A;  2V8K A;  3LHD A;  2PJH B;  1BI3 A;  1UGR B;  4JRP A;  3JCM g;  1HK9 A;  1VQ8 A;  4RCC A;  3G71 T;  3FEO A;  3LWH A;  3CPW A;  3M57 A;  1VQP T;  3ZJU A;  2JNG A;  2M16 A;  1QP2 A;  4B9X A;  1H3Z A;  4KDL A;  3M55 A;  4C92 A;  5LJ5 f;  3F70 A;  2R58 A;  1O75 A;  5GAO p;  4KLN A;  4FM4 B;  1N9R A;  3GF5 A;  2PVO B;  5FTK A;  1MGQ A;  4RKU E;  3JCM P;  5A0G A;  2KDS A;  3PMT A;  2Q1A X;  3FDR A;  3J80 E;  3ZJT A;  1WJS A;  2M1H A;  1G3W A;  2X4J A;  3WVE B;  5C6S A;  1YIT T;  4QVD A;  2MF2 A;  3OQ5 A;  1LOJ A;  5EQJ B;  5GMK l;  3O8V A;  2LW6 A;  1Q86 U;  4JRQ A;  4M77 E;  3WVD B;  1M1K C;  3M53 A;  3MEV A;  5FU6 B;  3A8G B;  4C5H A;  2LVM A;  1X01 A;  1VIF A;  5GAM f;  4RV0 A;  2V8I A;  2JTF A;  3CCL A;  5I21 A;  2E12 A;  1M5Q 1;  3QJ6 A;  2XU8 A;  4KUL A;  4BY6 C;  3G6E T;  1WJR A;  2HBP A;  4HCB A;  1NJI C;  2RHU A;  4E7K A;  5GAO r;  4PJO E;  2GF7 A;  4AQ7 A;  1Q82 U;  4ARC A;  5CQY A;  4ELY C;  4C8Q D;  4HCC A;  2K5L A;  1U8R A;  3CMA A;  5LJ5 d;  4P5N A;  1W2B A;  1QVF S;  4M77 F;  3V8J A;  1V29 B;  3QBY A;  1VQK T;  4C5I A;  5J39 A;  4CRI A;  3JCM V;  3LGA A;  2DD5 A;  1R8O B;  1I9G A;  3V7R A;  4ZN3 A;  4PJO A;  4M75 C;  2ZCF B;  5LJ5 j;  1VQO A;  2NLU A;  4FSX A;  1VQ8 T;  1KHC A;  2GQV A;  4OF1 A;  3S3M A;  2HD0 A;  3EAE A;  3A8L B;  4O6J A;  4PJO F;  5M9O A;  3I55 A;  3M59 A;  3HP9 A;  5LJ3 f;  4BE2 A;  1VQ6 A;  4BE1 A;  2LX9 A;  2LT4 A;  1S72 T;  3M4Y A;  4M77 B;  1E32 A;  1NPP A;  1JJ2 A;  3OYF A;  1KQ1 A;  5GAM d;  1QVG S;  4E7J A;  5CR2 A;  3OYH A;  1RL2 A;  1SSF A;  4J7I A;  4QQD A;  3V7S A;  4ZTJ A;  1JBM A;  2DO3 A;  2RI2 A;  4BI3 A;  4C0D B;  4EDU A;  4M7D C;  3S3N A;  3OS5 A;  3L2V A;  5GAM j;  1UGQ B;  2XHC A;  2K5I A;  2CS7 A;  4XTW A;  1G3Y A;  2E64 A;  2CZ0 B;  1IRE B;  5LL6 S;  4A4G A;  1ZQ1 A;  2V8J A;  1BIB A;  3CC4 A;  2EJF A;  3HKS A;  3VU3 C;  2DXT A;  3HSB A;  3LYI A;  4JS5 A;  5GAN f;  3OS0 A;  2ZPB B;  3CCJ A;  2CKK A;  3JCM h;  3ZGZ A;  3ZFJ A;  3CPW S;  3SWN B;  1YHQ T;  4J6X A;  3CCL T;  2PVD B;  1WGS A;  2XI9 A;  3JSC A;  3L2U A;  2L8D A;  5DYI A;  2P0P A;  2Q18 X;  2M0O A;  3T9N A;  1GXI E;  3QG1 A;  4JJN K;  4M7D D;  2QI2 A;  5LJ3 d;  5HK0 A;  2MM2 A;  4F7U F;  1KQS A;  5B6C A;  1VUB A;  3MB5 A;  1CZ5 A;  3HU2 A;  5DLO A;  5CKB A;  3QDR B;  3OBW A;  3CMA T;  2E65 A;  2ZPI B;  5KE3 A;  4M7A E;  4M75 G;  3HU3 A;  2FVU A;  4HT9 A;  5CKD A;  2C06 A;  4ZGD B;  2PU9 B;  2DIG A;  1WQ7 A;  2ZPF B;  4PL6 A;  5LJ3 j;  4CI0 C;  4RMO A;  3PIP A;  4V2S A;  3QO3 A;  5GAO m;  1H64 1;  3FC3 A;  4Z02 A;  1KHI A;  3GOX A;  4IUU A;  2E1H A;  4Y91 A;  1VQO T;  1Q7Y U;  3PFS A;  1K8A U;  2YUJ A;  3RKX A;  2BUD A;  4M78 E;  4IKF A;  2VV5 A;  2OTL T;  4F7U B;  3I55 T;  4HT8 A;  4KOD A;  4N0A C;  4UC4 A;  5GAN d;  2DXC A;  2YHT A;  3MP8 A;  1U1S A;  2L5Q A;  4M7A F;  2KY9 A;  3EFS A;  4M75 A;  2RHI A;  1Q81 C;  4M7D G;  4FL6 A;  3I56 A;  1WQW A;  3CCR A;  2X4X A;  2PUO B;  2H3J A;  1WJQ A;  2WAC A;  4M78 A;  5GAN 7;  1W2B S;  2MWO A;  5GAN j;  1UGP B;  4FT2 A;  5EPP A;  1Y96 A;  4PNO A;  5GAN 4;  2RM4 A;  4L59 A;  1M8V A;  4KO8 A;  4X34 A;  2RB6 A;  2FHD A;  2ZPE B;  4RG8 A;  5EG2 A;  3OYM A;  2LQ8 A;  1N8R U;  4ARI A;  3HPW A;  4M78 F;  1X6O A;  2DD4 A;  2GCX A;  4OB2 B;  2LDM A;  4MZT A;  3CC4 T;  2RI5 A;  1YJN A;  3RMQ A;  1G5V A;  4C92 E;  1B34 A;  2E6Z A;  1VQ4 T;  2ZPG B;  1QW1 A;  2RI3 A;  4M7A B;  3CCJ T;  3CBP A;  2D6F A;  5CO7 A;  4YTL A;  2VYT A;  4BD3 A;  3GP8 A;  1M90 C;  3RES A;  1VQN A;  2XIC A;  5LJ3 e;  4M7D A;  4KUD K;  5CD1 A;  5ERG B;  3M4G A;  3MO8 A;  4HCZ A;  1DJ7 B;  1JJ2 S;  1S72 A;  4XQ3 A;  2ZGW A;  4EMK C;  5C18 A;  2RHX A;  2CGH A;  1KC8 C;  2FL7 A;  3TRE A;  4BDY A;  1QP3 A;  2IVW A;  4BDZ A;  3BFM A;  2HQE A;  2RK1 A;  5FU7 B;  3J81 E;  4C92 F;  2DTO A;  5FRO A;  1ZBX A;  4MZM A;  4C5G A;  1D3B A;  3BW1 A;  3JCM b;  3QJY A;  4XTX A;  4C8Q C;  3SD4 A;  1BI2 A;  4GY5 A;  2QEX T;  3VJP A;  5GAN e;  3CCE A;  3CCU A;  1M1K U;  2KVQ G;  2VXE A;  4NOY A;  1BYM A;  2LRQ A;  3GPL A;  3OSV A;  4J83 A;  4DOW A;  1YHQ A;  3VUZ A;  2E70 A;  4EMG A;  3CCV T;  2K5F A;  2K4Y A;  4C92 B;  2KMT A;  4A4H A;  5DYG A;  1BIA A;  2DZC A;  3C95 A;  3JCM W;  3L2Z A;  1WNL A;  4MMK A;  4XU1 A;  4IUV A;  3I56 T;  1KQS S;  3HFN A;  5D6X A;  3CCR T;  4X9D A;  4N4H A;  1K73 C;  1NE8 A;  1FX7 A;  3JB9 D;  3QC8 A;  3RMS A;  5CCA A;  3L2Q A;  2QQ9 A;  3FPU A;  3TU4 K;  4N0A A;  5GAN 6;  1PSF A;  2EWN A;  2MI6 A;  3OYE A;  2YVL A;  3QQ8 A;  2B8A A;  3FLG A;  2JTM A;  2LC4 A;  3CME T;  5CAI A;  1R7R A;  2JUF A;  1Q86 C;  3PIO A;  3ER0 A;  1YJN T;  3GNF B;  3HRS A;  4HKE A;  4J5Y A;  3OBY A;  5HK3 A;  3H6Z A;  4ZTF A;  1CR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...