2KY9A

Solution nmr structure of ydhk c-terminal domain from b.subtilis, northeast structural genomics consortium target target sr518
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
MKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMVDYTSTTSGEKVKNHKWVTEDELSAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein ydhK
publication title Solution NMR Structure of ydhK C-terminal Domain from B.subtilis, Northeast Structural Genomics Consortium Target Target SR518
rcsb
source organism Bacillus subtilis
total genus 26
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1130 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ky9A01
3.10.330.60 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2ky9A02
4FIBA 2KY9A
chains in the Genus database with same CATH superfamily
3ASKA 1OX9A 4BACA 1X69A 3M0UA 1FYNA 3M58A 3JCMW 1VQOA 2LW6A 1M9SA 2JTMA 2EQMA 3MEVA 2GFAA 3FDRA 1M3CA 5CVIA 4C0ZA 4M7AB 4M78C 1QKWA 4BY6C 3VUBA 5FTKA 5L23A 4M78A 1VQ8A 2QA4Q 2D0NA 4LN2A 3EHQA 3ZL7C 2GF7A 3M57A 4M75C 5GAOp 1TU0B 4ZGEB 3CCEQ 4EMGA 3PFSA 1K8AR 1QKXA 4XQ3A 4IUTA 2R57A 1M8MA 5I2SA 5KYYB 2J06A 1KHCA 2NUPB 3SB2A 4DEYA 3QSUA 2K9GA 1U3OA 1HD3A 1HXDA 1BB9A 5CIUA 3LGFA 3A8LB 3VYGA 1LPLA 4E7HA 3I55T 2HBPA 2W10A 4ESRA 5A2QE 1RABB 3HRTA 2E10A 3CC4Q 4HVUA 2HSEB 3HL8A 1H3HA 3FLGA 1PHTA 2EYYA 2F5TX 2RI2A 4CC7A 3A8GB 1VQPT 2ZPEB 2VYTA 1ZQ1A 3EFOA 3CMEQ 1QCNA 1VQ9Q 2RJEA 2E64A 4E7KA 1ABQA 3CXCS 1YJWQ 4JS4A 4OMQA 1I81A 1Q82U 5CD1A 1QCSA 1NBEB 1U1TA 2LDMA 1YHQA 2BKDN 2HCKA 3C4SA 3RKWA 1ZA1B 5EC7A 4OMLA 4M7DB 4PFOA 1MMAA 3PIPA 2O4XB 1ABOA 3EGUA 1QP3A 3CCLT 5KYUB 2RJFA 3RR6A 3PMTA 1M1KU 4RCCA 3CCRQ 2DK3A 2DILA 2MWOA 2DZ9A 5GLFA 3CCUT 3G1JA 4C8QE 2JXBA 3FC3A 1VQLQ 4HT8A 2K5IA 2EGCA 2RNAA 1UFFA 4BE1A 3E9GA 4OMMA 1UDLA 4DBRA 3TREA 3LGLA 1AT1B 3TVTA 1KQSP 3M0RA 4WCIA 2IPOB 4HKEA 4LDUA 2VB6A 3INZA 1KQ1A 1M1GA 1VOMA 1PC0A 1TS9A 1JB0E 2F2WA 3EG0A 2K3XA 3ME9A 4A54A 3OYJA 1YITT 1D09B 4M7AC 1Y96B 2CP3A 2CZ6B 5DLQE 4KBMB 3LYIA 3S3NA 5GANg 3OMGA 1RLPC 3FJPA 1QQJA 1Q82R 3VV0A 1HK9A 4C5EA 3PGGA 1KD1U 2LX9A 1KG1A 5CKHA 2ESWA 4C92G 1W2BS 1SRLA 3CC7Q 2Q19X 3M0QA 2E3HA 3CCVA 3MEAA 2LCSA 2EKOA 1RLQC 2NUPA 3JB9D 1YJNQ 2LQKA 1KC8C 2RHYA 5C1BA 1LJOA 2L3RA 4C0GA 2DYBA 1VIEA 1K9MC 4DA4A 5LJ5d 1S72T 1VQOQ 3QC8A 2E5KA 2DZCA 3DB3A 1NJIU 5GAN7 5EQJB 2OTLA 4M4ZA 1PKTA 2D8HA 3L1AA 1AEYA 2PTKA 1CZ5A 2BTTA 4OMNA 3JB9F 3MP6A 2LQNA 1VQ8Q 5FWCA 1JRIA 2LVMA 3CC7T 1OYXA 5GANe 4M7DC 3FRNA 2LNHB 1TWBA 3WVDB 4M7DA 2KRNA 1KD1R 1E32A 2O4XA 5KYUA 3PIOA 1WXBA 5LJ3f 1QLYA 5A0LA 3TIWA 3M4GA 1B7TA 1MMNA 2O2OA 2HD0A 3NPFA 1BIAA 3M53A 2CH4A 4QVZA 1VQOT 4YTLA 4IIMA 4M77F 4PFPA 2RI5A 1Y07A 2QXFA 4M78D 3WXMB 2AK5A 4L5GA 2GNCA 4Z88A 2DVJA 4FIBA 4A53A 3CMAA 2A37A 4JJDA 1M2VB 5IH2A 1AD5A 2FPEA 5ECAA 2M1HA 2X4YA 2VVKA 3MKDA 4KUDK 1CZ4A 5KYXB 4KGXB 1WA7A 3UPUA 4CC4B 1N9SA 2MYSA 2QTVA 2DTIA 2EQIA 1WHKA 4CC2A 5GMKl 1YHQQ 5GAN8 4GLKA 5J3BA 2P0QA 1IHVA 4F7UB 4M78F 4N4IA 5FLXE 2DXBA 2AKLA 3U23A 4AQ7A 1X2KA 2O9VA 3REAB 2KNBB 1IZ6A 1QWFA 2B8AA 1ZSGA 5GANf 3X20B 4M75F 2OAUA 4KRTA 1F1BB 1K73U 3TSZA 3CBPA 4Y28E 5HK0A 2RQVA 2DD4A 2RQRA 3NMZC 2DPPB 4RMOA 4N4HA 3QDRB 4IUVA 3RESA 3L42A 3KBGA 5C18A 2YRVA 2DLPA 4C8QD 1AZGB 5GMKi 3JCMh 2ROLA 4HCCA 1G3SA 2DERA 2DTHA 1I5OB 4BI4A 3OBWA 2JTEA 4CI0C 1Q86U 4J9BA 1OPLA 2ZPFB 4JUVA 1B3QA 2P4RA 1FMWA 2WSEE 5DYGA 3OYDA 1VQ4Q 1M5Q1 5HKCA 2EQJA 2DA9A 2DKGA 4JDSA 1WX6A 3VS5A 4Y92A 2BZXA 4PJOB 4TVRA 1JQQA 1W1FA 2RHXA 3LH5A 4BE2A 4NOYA 4JJCA 3R6NA 1Q81U 5GAMg 3CCVQ 2Z0WA 3JAME 1M1FA 1RAGB 3HHTB 2KBTA 2GCXA 1K1ZA 4Z8AA 2L2PA 2PQWA 5FRNA 1SRMA 2F2VA 1OI1A 5D6YA 2RQTA 2X3WD 1MHNA 4KGVB 3TCJA 2JN0A 3CCQA 1IREB 4QQ6A 5AT1B 2G6FX 3G4ST 1WQ7A 1SEMA 2KGTA 4E6RA 1D0ZA 5KCOA 1KC8R 2XDBA 2K5FA 3EH2A 1M2VA 5FU6B 5GAMd 2OTLQ 2VGMA 3KXTA 2LCCA 4J9DA 2V8JA 1WIEA 3F70A 5KYXA 1S3SA 2PUOB 3G71T 2L8DA 1OZ2A 1IGQA 2YVLA 1YWPA 4JZ4A 1ACMB 3D7SB 1KK7A 2M02A 2ED0A 4ZGDB 3OYYA 3FPTA 2BIVA 2C0OA 4M7AF 3M0TA 2B25A 2DXTA 4F7UA 1M8VA 2RN8A 5DYIA 3SDZA 3M59A 3RMSA 1AWOA 2DTOA 3GBQA 3EGDB 2ABLA 5GAMe 3CC2A 2YUOA 2WSFE 3UDCA 1TTHB 2I0NA 2L3SA 2DBMA 1QP2A 2VXEA 5IAYA 2QQRA 4XTYA 2O01E 5CKEA 2OTLT 4NS5A 3CMAQ 1BCOA 4MDWA 2R58A 2AIRB 4J5YA 2QEXQ 5DM7R 3JB9G 2OTJT 1YFNA 2JNGA 4M7DD 4MZPA 4Y91A 3OMCA 3CCSQ 3X28B 5LL6S 1M27C 4JRPA 3E9FA 1WLFA 3QQ7A 5FWBA 4N4GA 1UJ0A 1MNDA 2PVDB 1YIJQ 3OYLA 2DF6A 2F1LA 4JJBA 4R0KA 2E6NA 2EGAA 1QVGA 3ZGZA 4PJOC 2JV2A 2FG0A 1WJSA 3V7RA 2K79A 3JCMJ 2ZGWA 2QAZA 4PJOA 2EJ9A 1WQWA 1NE8A 4M77G 1I4K1 1PRMC 1NYFA 4M7DF 2EAYA 1VQMT 2YT6A 1R7RA 4PJMA 2VKNA 1G2BA 3VYHB 2QGFB 3ER0A 3CMAT 4FT4A 1WLPB 1PKSA 5LJ5j 4KH1B 1WGSA 2MF2A 2CZ0B 2MWPA 4C8QB 1K8AU 4KUIA 3QPHA 1K4US 1WJRA 2CUDA 5L8RE 5KE2A 1J3TA 2YRCA 4O5VA 2KXDA 3NTKA 2EYWA 4NL3A 3G6ET 3M9QA 2KY9A 4B6MA 4Z02A 2QYZA 4M78G 2KT1A 1D1CA 2LZ6B 3EHRA 5ERGB 3RUXA 1Z9QA 4B9XA 5IHKA 1RAAB 4J9IA 4M75G 4HCBA 1WHLA 3UWNA 3J7AF 1WPYA 3BW1A 1U1SA 1NLOC 5GMKh 2CZ1B 3HFNA 2AHJB 3RIRA 3CCMA 1SKUB 3A8OB 2NUZA 4OMOA 5M9OA 2XMFA 3EGDA 4C5GA 4BB7A 3V8JA 2FZKB 4E7JA 1UG1A 1OU8A 4AMCA 1UGQB 2FL7A 3CBMA 2D1XA 2DRMA 1E6GA 4M77E 2GTOA 1O54A 5CO7A 3T9NA 3CCQQ 2P4TA 2MAMA 4Z89A 3MJXA 8ATCB 1FWZA 4MZTA 5GJVB 2ZPGB 2QGGA 2J6KA 2EJGA 2DL5A 4OP0A 3LHDA 4IUUA 5KYWB 3VS6A 2EFIA 1BKBA 2HEQA 4BUGA 1VQ6A 1WFWA 3EGXB 4AFZC 4BE0A 2YLBA 2BZYA 1YI2A 3GIBA 3QUIA 1AWWA 2QDLA 1BI0A 1N8RU 2J6FA 3MP1A 1Y7XA 1VQKQ 1VQNA 1VYTA 3M0PA 2FYKA 4MMKA 2HQHA 5CKBA 4FYXB 1TG0A 2H3EB 2JM8A 3CC2Q 4M75E 3QYGB 3M54A 1HSQA 3CEYA 4OB1B 3EAEA 2QA4T 4D8KA 4ELZC 4BDZA 2A7YA 3META 1QVFP 2NYSA 3CCET 5CCXA 2VUBA 5LJ3g 3OW2A 4N0AA 1QVGP 2ZPHB 4J9FA 4BI8B 2RH2A 4C8QC 2PZ1A 1T0JA 5HY6A 1XOVA 2DRKA 1BI1A 2Y90A 2DFUA 1C1AA 4C8QA 3MHXA 4JRIA 3CCJA 3JRZA 2LQWA 2VC8A 2HL3A 5GMKj 4M7AG 1ZBJA 3EH1A 1JJ2S 1YCYA 3H6ZA 3HRSA 3I35A 1GL5A 3CC4T 2QI2A 2RHUA 3NTHA 1M90C 1D0XA 1Y0MA 2YRDA 5LJ3d 2GTJA 1VQ7A 1TOVA 3DLMA 4KGZB 4RV0A 1N8RR 3QWXX 3CMET 1VQ9T 3A8MB 4FM4B 4RTUA 1IGUA 4KDLA 1SHFA 4F7UF 1YJWT 3CPWP 4QQGA 2V26A 2BZ8A 3BFMA 2M51A 4QT7A 4HCZA 4ARCA 1W70A 2KDSA 2ECZA 2COYA 4X34A 4ZNXA 2L89A 5IXFA 2GQVA 3EFSA 5CQYA 3C0CA 1VQ4A 3H41A 3GPLA 3PNWC 1C0MA 4A4KA 4C5IA 3VU3C 2CGHA 2VASA 4HCKA 5LJ3e 2K6DA 4KO8A 3CCRT 2MOXA 5GAMj 4B9WA 1GFCA 1YJ9A 1VQLT 2GQIA 2LJ3A 5HCKA 3A8HB 4PJOD 1MV0B 2Q1CX 3CPFA 3OQ5A 4XU3A 5KYWA 3BQBA 7AT1B 4DOVA 4DBQA 3FPRA 2EYXA 3VS2A 4EMHA 1K0SA 4JJNK 3EGXA 2RI3A 1N27A 1X43A 2LRQA 4LDWA 2LQ8A 4M7AE 4M7DG 1YCSB 4EPCA 5GANd 3X24B 4ORZA 2FRYA 3JV3A 4ZTJA 2EQUA 1K9AA 2E3IA 3SHWA 1R0BG 2XI9A 3RERA 3CCMQ 2ENMA 1SSHA 4D8DA 3Q1JA 5IHNA 4PJOF 2KEAA 5D6WA 1M4ZA 1U06A 1QDNA 1GFDA 5GAN4 1UGSB 1YNZA 1WJQA 4CRIA 2O9SA 4UC4A 4EIKA 1D1AA 4E7IA 4J7FA 2KR3A 1PM3A 2DL7A 4CC3A 1WZOA 1TUGB 3QYHB 1LNXA 3TSWA 4FCYA 1RL2A 5GAOq 1OU9A 1UTIA 4OMFB 1YJNT 3HU3A 2JZ2A 1PNJA 1RAIB 4F04B 3RBBB 1VQ6Q 3NTIA 3PVQA 4QVCA 3MP8A 1SG5A 2JTFA 4C92E 1YI2Q 1N5ZA 3OW2P 2XU8A 3CXCA 5GAOn 3JCMf 2PVGB 4QW2A 4JS5A 5EPPA 3HRUA 1VQNQ 2DVEA 2EYQA 2LX7A 3QHSA 3ZJVA 1H8KA 4AFQC 2RPNA 2QEXA 2OJ2A 5CAIA 2COZA 4IUQA 3HKSA 2K3BA 2KI7A 1ZHIA 1VQ8T 5FTJA 3VS3A 3P8BB 2KAFA 3CCSA 4OF1A 1NYGA 3A1PA 3CQTA 2XICA 2A36A 1M30A 2KQWA 1ZSZA 1I07A 1X6BA 2EJFA 3IQLA 1YIJA 3MPUB 4FW2A 1M2OA 1YN8A 3A5ZB 3QKJA 2C06A 3CD6A 1NM7A 5HK3A 3CCJQ 4AFUC 4LXCA 1X27A 2RMOA 2ZPIB 3THKA 1YI2T 4FL6A 2RQUA 2XIDA 2DL3A 1UJYA 1GBRA 4PJLA 1PG5B 2YLCA 3UATA 9ATCB 2COWA 4AFSC 4J9CA 4OB0B 2P84A 1VQ7Q 3UF4A 2CP2A 3I56Q 4A4HA 2PNIA 1KC8U 1TUDA 4ZN1A 1SF9A 1I0CA 2DXUA 3SFMA 2HSPA 1M90R 3SEMA 1QVFS 1K9MU 1V1CA 2E12A 3GF5A 4J9EA 1UGPB 1CKBA 2PU9B 5IN1A 3OYMA 1Q7YC 1W2BA 1YHQT 1BCMA 2DM1A 2XHCA 3JCMX 4AT1B 1G8XA 1UUEA 2EYZA 4JZ3A 3GOXA 4V2SA 2KYMA 4A63B 1I8FA 1N6AA 2Y4XA 2AZVA 2NWMA 4LNPA 4QQDA 1NLPC 3L2ZA 1YJ9Q 4KT0E 4PNOA 3OYAA 2E4HA 3TQ7P 5CR2A 1WHGA 4J8OA 4C8QF 2RJDA 3OSVA 3JCMV 1JEGA 3FPUA 3OYBA 1KQSS 1E7OA 3BE3A 2SEMA 1GCQC 3OB9A 1R0CB 5I22A 4A4EA 4F7UG 3BDUA 2H8HA 1GCQA 2KRSA 3CPWS 2PJHB 3S6WA 5GAN5 4VUBA 3OA6A 4OMPA 3UT1A 3DLLA 1YBYA 5IHIA 2A08A 1D1BA 2DXCA 1VQ4T 4IIOA 3H9NA 1K9MR 2IVWA 2F2XA 5AYFA 1VQPA 2LT1A 2ZZDA 1RI0A 5EG2A 1QCFA 2X4WA 3PVLA 4RCBA 3NGPA 5LJ5h 4CQNA 3JCMc 2RM4A 3FEOA 3I5SA 2FZGB 1NZ9A 2QASA 2M0YA 3CXCP 4BI3A 1JXOA 2HMAA 1AWXA 2X4XA 3OYIA 3CCVT 2MM2A 2CREA 1PWTA 1UGVA 1VQKA 2DE0X 4JPBW 1KJWA 2YDLA 4BD3A 3M4YA 1BBZA 5GAN3 2DIGA 3URGA 3CCLA 1VQ5Q 5GAN6 3OYCA 1Q95G 4DEXA 2V8KA 1SPKA 2ED1A 3S3OA 3HTRA 4J6XA 3CCUA 2LJ0A 5LJ3j 4AG2C 4WTOB 2L3QA 3ZFJA 3QIIA 4PJOG 1WHMA 1QCOA 3OYNA 2E1HA 4RKUE 2X4JA 2MPXC 4OVAA 5GJWB 2A28A 3X26B 1QW1A 1OZ3A 4PFZA 3EG3A 1WYXA 3HFOA 4C92D 4IURA 3GNFB 1SSFA 3LW5E 1H641 3E19A 3CF2A 3EFRA 1YITA 4KH0B 3OBYA 2JMCA 5A0DA 2V1RA 3QXEB 2ROTA 3JCMb 2X9HA 1UE9A 2DYIA 3CD6Q 1UB4A 5KCHA 1OQKA 2C0IA 4XTXA 5CK9A 4JRQA 1I1JA 2V1QA 3VUZA 2CZ7B 3JB9H 1HJDA 3MEUA 2KROA 1W2BP 1YWOA 2YXYA 3QQ8A 3OYKA 2FRWA 4D6WA 1T0HA 1VA7A 2CT4A 5GANj 4L59A 2CSQA 2QEXT 1ZUUA 2FHDA 3ZJTA 4QVDA 3CCST 3MB5A 2GFUA 2ZPBB 1S72A 5GAN2 1AHJB 1JU5C 5D7UA 4FYYB 1O9SA 3I9QA 4Q5WA 2R5AA 2O88A 1YIJT 1BK2A 2AZSA 3SWNB 1FMKA 4OB2B 2OAWA 3V7CA 3OS1A 2A3LA 1LCKA 3RNJA 1KSWA 1R77A 1QMCA 1VUBA 4LD6A 5KH6A 1KQ2A 2CH4W 4FT2A 1M1KC 1CSKA 1Q7YR 2DIQA 4PJNA 2A0FB 1KFZA 2DNUA 2KMTA 1MUZA 4FW1A 2R5MA 4J9HA 1G3WA 2BE9B 5GAOm 4XTUA 2KT8A 3G7ZA 1JO8A 1T3SA 4LUDA 1KHIA 1M3BA 2D9TA 2HQXA 2V8IA 4M77A 5KYNA 2XG8D 3E1SA 3VS1A 3LX7A 4LUEA 4PLLA 2EPDA 3HPWA 4XU0A 4KODA 2CSIA 2RA2A 4RTXA 3LWHA 1AOJA 1BI3A 4RG8A 3I55Q 4XU1A 3QDFA 1LVKA 1XTDA 2CS7A 2QK0A 1UHCA 2RB6A 2RQWA 2K5LA 4C0DB 5CQXA 1X6GA 1CKAA 2XKOC 4ELYC 1VQPQ 4XTVA 1VIFA 2X3XD 2YUNA 3PE0A 4EDUA 2QG9B 2QQAA 1KD1C 2JT4A 4XU2A 2DO3A 1R8OB 2E5QA 1U8RA 1RAHB 3PTAA 4C8QG 1ZLMA 1WHJA 3QWZA 3LH0A 5GAMh 4M78E 4M75A 2Q1AX 2KRMA 2DJZA 4GBQA 4A4FA 3EG1A 2JVVA 2OX7A 4RUGA 1FXXA 3VJPA 1SHGA 1OOTA 2RHIA 3CCLQ 4ANJA 3OSSC 3UA6A 2MIOA 4FYVB 3P8DA 4E7ZA 1N9RA 4HVVA 3OYFA 2E65A 2KE9A 3CCQT 2RK1A 2YWWA 3CCUQ 4HA8A 3AHUA 3RKYA 2FPFA 2BE7D 4N0AC 1AWJA 3M0SA 1WHHA 2F5KA 1NJIC 1O75A 4DQ2A 3QBYA 3P8HA 1Z9ZA 4EMKB 1UGRB 1WDXA 3PMIA 2YUPA 4K11A 2QQSA 1MMGA 2E41A 2XK0A 4C92B 4WF2A 3L2WA 1MV3A 2O31A 3JCMg 1B07A 3SWNC 4RTZA 2CUBA 3HSBA 3V7SA 3HU1A 4IKFA 4II1A 1YITQ 3SWNA 2J6OA 3GNGA 1VQKT 2DBKA 4J83A 4XTZA 4MZMA 3I56A 2VXFA 5GAOl 3QO3A 3CC2T 5I21A 3PT9A 2VGNA 1D3BB 5FTNA 2BUDA 2X51A 1V29B 3C95A 1PD1A 2CYZB 5FROA 3JCMd 1LOJA 1NPPA 3AT1B 4L6V5 4AS1A 1G83A 3TU4K 3VS0A 2NUTB 1RAFB 2EKHA 1EX4A 3ZJUA 2L5QA 1ZSZB 2CP5A 3L2VA 2DJQA 2DEUA 3ZBDA 2K2MA 2PUKB 1EFNA 4C0DC 3L2QA 4XTWA 2DAQA 4DBFA 1BU1A 1S72Q 4GLMA 2DX1A 2D0QB 3G4SA 2HBWA 4LDVA 1B34B 4M7AA 3JCMe 4LD9K 2L3PA 5A0GA 4X1VA 5GMKm 3JB9J 5LJ5g 2XDDA 3G71A 1IHWA 2LP5A 2EGEA 3TEEA 1C6VX 5FRMA 4KDIA 1BI2A 1W6XA 1S1NA 1K73C 3OS0A 2PWYA 2CDTA 2CKKA 3OS5A 5KYYA 1OULA 5C6SA 5IT9E 1UEBA 5J26A 2HL5C 2B86A 3FJ5A 1M1KR 2P0PA 1PSFA 2JUFA 2EBPA 3OY9A 2Y4YA 1HYOA 3UA7A 4XAXB 1ZUKA 2AT1B 2QDYB 4KULA 3M55A 5I2MA 1GXIE 1RI9A 1IB8A 3H0HA 1G3TA 3JB9I 2JS0A 4EMKC 1X01A 1ZC1A 1Q86C 2MCNA 4E7SA 4EMKA 3KUFA 2K2VA 4C92C 1ZUYA 2IG0A 4XK8E 2K7AA 4C92A 2C0TA 4ZTFA 1XQHA 3E2UA 2OTJA 4JLGA 5FU7B 1VQ5A 4M77D 4F17A 5KE3A 1OX8A 1OV3A 3VKIA 1XJWB 2I2LA 4J9GA 2RK2A 4GY5A 1Q81C 4JLIA 1WXTA 3NFCA 1A0NB 2E6ZA 2KSSA 5IXBA 5LJ5e 4J7IA 2ATCB 1M90U 1W4SA 3CCMT 2IIMA 1MNEA 4MDXA 3OYEA 1U5SA 4RTTA 1D3BA 1TXQA 2XDPA 2QQBA 2RHZA 2CP0A 4M7DE 4X9CA 1UHFA 4ZGJB 4BDYA 4R55A 4PLIA 3HP9A 1ZSZC 1VQMA 4J6WA 4DBHA 1OEBA 5I11A 2NUTA 1JJ2A 1I5LA 4RTWA 2JM9A 3QZ5B 5DY9A 1ARKA 1VYVA 3LWIA 4FU6A 4M75D 2MK5A 1VQ6T 1M3AA 1NJIR 2HKNA 2MMPA 2F69A 2VV5A 1K0XA 1Y96A 2DL8A 3G6EA 3QG1A 5FW9A 4LDXA 3H8ZA 1B34A 4PL6A 1AVZC 3H0FA 1WNLA 1VQNT 2M0OA 1RAEB 1PRLC 2VWFA 1RACB 3QWYA 2LMJA 2FO0A 5DLOA 1EZZB 4RG2A 3VS4A 5C0MA 1H3ZA 4X9DA 2LT4A 5CCBA 4P5NA 1FX7A 3X25B 2EWNA 1XNIA 1RADB 2FB7A 5LJ5f 5FTMA 2HQEA 3SD4A 3EG2A 1QVGS 2RJCA 5LJ3h 2K57A 3OYHA 2KXCA 4ME7A 2JMAA 3QJYA 2DD5A 2JJ9A 2P0KA 2KK4A 2J7IA 4LDYA 3CCJT 4PK4A 2LTOA 5CKFA 3L2RA 1BIBA 1UECA 3M56A 1Y71A 3G4SQ 4C5HA 2XD0A 1H92A 3BDLA 1G3YA 3LGAA 1PD0A 5FU7C 1VQ7T 3I56T 3DKMA 2HAXA 3R6OA 3G71Q 1JBMA 3KFVA 1PSEA 2M9UA 3HU2A 3I55A 2EVRA 4HT9A 1TH7A 1GCPA 4HVWA 4ATOA 2E70A 3QJ6A 1I9GA 2D8JA 2GBQA 3NHNA 1IRXA 1G5VA 1IXDA 3JSCA 4RTYA 2YSQA 2ZAEA 3MCAB 3OS2A 4E2FB 2JOYA 3WVEB 1FMVA 1K8AC 1OPKA 4C0FA 5GMKe 5GANh 1K73R 2PVOB 4M7AD 1BYMA 2HKQB 2QA4A 4FSSA 3S3MA 1YP5A 1YJ9T 4DOWA 3GLXA 3CCEA 5GAOr 2FPDA 2WACA 3VRYA 1P92A 1V76A 2HZYA 5D6XA 2OI3A 2FZCB 3EG9B 2LCLA 5CKDA 4M77B 1TSFA 2DL4A 3RMQA 3OYGA 2OTJQ 3LLRA 2HNIA 2RF0A 4MMLA 4LE9A 6AT1B 4IUPA 1Q86R 1EIFA 4F16A 2YUJA 4NL2A 1JJ2P 3JCMP 4E47A 2QTXA 3CC4A 2GGRA 3MO8A 2RD1A 1X6OA 4KLNA 1NG2A 3J80E 4OGEA 5CCAA 1NEGA 1QVPA 1QWEA 3O8VA 8AT1B 2Q1DX 3V8LA 2LC4A 3CBOA 1Q81R 1K76A 3I5RA 4ARIA 3CMEA 3ULRB 1VQ9A 2FVUA 4F7UE 1KIKA 2CP7A 4M78B 3C12A 4BY6B 3C94A 3J81E 4JRKA 1YJWA 4QKUA 1AZEA 1VQMQ 1RUWA 2NLUA 2JS2A 4AG1C 4PKCC 4A4GA 2YUQA 3JCMQ 1VYUA 1Q7YU 3REBB 2QQ9A 3V8KA 4M75B 2CT3A 4PJJA 1GRIA 3FIFA 2KVQG 1VQ5T 4HXJA 3FB9A 2M16A 1PCXA 1X2QA 2MM0A 3BY7A 2X35A 1GBQA 3CCRA 1X75C 3OW2S 3H0IA 1N8RC 1VQLA 3G6EQ 2L0AA 1ZA2B 2DEQA 3VRZA 4F14A 2K3YA 1QVFA 4C92F 3O5ZA 2W0ZA 3M5AA 1NPRA 1Y57A 2MI6A 1E6HA 2EQKA 1TUCA 2Q18X 3MEWA 4J6YA 3RDVA 3DB4A 4E7LA 3GP8A 2LNVA 4ZN3A 2AKKA 2G3RA 3EFOB 3ZEHA 5FTLA 3L2UA 2SRCA 1Q82C 1CR5A 1MMDA 5B6CA 3RKXA 3QZ9B 4FYWB 1WXUA 4PJOE 4FSXA 2KYBA 1JXMA 1IO6A 2K4YA 2JW4A 5GAMf 4O6JA 2LJ1A 3CD6T 1WI7A 1KQSA 2RO0A 2J05A 2YHTA 5J39A 5FU6C 2HDAA 2EIFA 2FEIA 3CC7A 1DJ7B 4OGCA 3CPWA 4M77C 1ZX6A 3A98A 3EG9A 1NEBA 2DMOA 2DETA 4OB3B 2CP6A 2H3JA 2EW3A 2WSCE 1T3LA 1YJNA 3N5BB 2ZCFB 4R56A 1MGQA 1D0YA 4RTVA 2D6FA 3VS7A 1ZBXA
chains in the Genus database with same CATH topology
3ASKA 3ZBDA 4BACA 2B25A 3JCMW 3M58A 3BQBA 2PUKB 2DXTA 1VQOA 4F7UA 2LW6A 3A5ZB 4C0DC 3L2QA 4XTWA 3QKJA 1M8VA 1M9SA 2JTMA 2DAQA 2C06A 2EQMA 3CD6A 3MEVA 5DYIA 2GFAA 3FDRA 3SDZA 5HK3A 3M59A 3RMSA 2D0QB 5CVIA 3G4SA 2DTOA 2ZPIB 1YI2T 4FL6A 5GAMe 3CC2A 2XIDA 4C0ZA 4M7AB 4LDVA 4M78C 1B34B 4M7AA 4BY6C 2WSFE 3UDCA 2YLCA 3VUBA 3JCMe 4LD9K 5FTKA 5A0GA 4M78A 1VQ8A 5GMKm 3JB9J 4OB0B 1QP2A 5LJ5g 2XDDA 2VXEA 3G71A 2GF7A 5IAYA 2QQRA 4XTYA 3M57A 2O01E 3TEEA 4A4HA 5CKEA 4M75C 5GAOp 4ZGEB 4NS5A 2OTLT 1KC8U 4MDWA 4EMGA 3PFSA 4ZN1A 5FRMA 2R58A 1BI2A 4KDIA 4J5YA 5DM7R 4XQ3A 2DXUA 3SFMA 4IUTA 3JB9G 1K73C 2R57A 3OS0A 5I2SA 2PWYA 2OTJT 2CKKA 3OS5A 2JNGA 1QVFS 1K9MU 4M7DD 5C6SA 5IT9E 1UEBA 4MZPA 5J26A 4Y91A 2E12A 1KHCA 3GF5A 2P0PA 3SB2A 1UGPB 2PU9B 3OMCA 5IN1A 3QSUA 1PSFA 1HXDA 2JUFA 3X28B 3OYMA 1Q7YC 5CIUA 5LL6S 3OY9A 2Y4YA 3LGFA 1W2BA 4JRPA 1YHQT 3A8LB 4XAXB 3VYGA 3E9FA 4E7HA 1WLFA 3QQ7A 3I55T 2QDYB 4N4GA 2HBPA 2XHCA 3M55A 4KULA 2PVDB 5I2MA 3JCMX 5A2QE 1GXIE 3HRTA 2E10A 3OYLA 3GOXA 4V2SA 2E6NA 1QVGA 1G3TA 3JB9I 1I8FA 1N6AA 3ZGZA 4EMKC 2Y4XA 1X01A 4PJOC 2JV2A 3HL8A 1ZC1A 3FLGA 1WJSA 4QQDA 3V7RA 1Q86C 3JCMJ 2ZGWA 2RI2A 2F5TX 3L2ZA 3KUFA 2K2VA 4C92C 4EMKA 2EJ9A 3A8GB 4KT0E 4PJOA 1WQWA 1VQPT 1NE8A 2ZPEB 2VYTA 4M77G 4PNOA 1I4K1 2IG0A 5CR2A 4J8OA 3OYAA 1ZQ1A 4C8QF 2RJDA 3OSVA 4XK8E 4M7DF 4C92A 2EAYA 2RJEA 2E64A 3JCMV 1VQMT 1R7RA 4ZTFA 1XQHA 3FPUA 3OYBA 2OTJA 4E7KA 4JLGA 5FU7B 3CXCS 4M77D 5KE3A 3VYHB 3ER0A 4JS4A 1VQ5A 1KQSS 1I81A 3VKIA 1Q82U 2I2LA 4FT4A 3CMAT 5CD1A 3OB9A 2RK2A 1QCSA 4GY5A 1U1TA 5LJ5j 2LDMA 1WGSA 4A4EA 2MF2A 4F7UG 1YHQA 1Q81C 2BKDN 2CZ0B 3C4SA 3BDUA 3NFCA 4JLIA 3RKWA 2E6ZA 2KSSA 2MWPA 4C8QB 4KUIA 3CPWS 1K8AU 3QPHA 4M7DB 2PJHB 1WJRA 5L8RE 5LJ5e 3S6WA 3PIPA 5GAN5 2O4XB 4J7IA 4VUBA 5KE2A 3CCLT 1QP3A 1M90U 1W4SA 3CCMT 4O5VA 3OA6A 2RJFA 3UT1A 3NTKA 3DLLA 1YBYA 3PMTA 4NL3A 4MDXA 1M1KU 3OYEA 3G6ET 4RCCA 3M9QA 2KY9A 1D3BA 2DXCA 2DK3A 2MWOA 5GLFA 2DZ9A 4Z02A 3CCUT 2XDPA 2QQBA 2RHZA 4C8QE 3FC3A 4M78G 1VQ4T 4M7DE 4HT8A 2IVWA 2K5IA 4X9CA 5AYFA 1VQPA 2LT1A 2ZZDA 3CCLA 1RI0A 5EG2A 4BE1A 4ZGJB 4BDYA 3E9GA 5ERGB 2X4WA 4RCBA 4R55A 4PLIA 3HP9A 3RUXA 5LJ5h 1VQMA 4CQNA 3JCMc 4J6WA 2RM4A 3FEOA 4B9XA 1NZ9A 3TREA 1JJ2A 3LGLA 1I5LA 4BI3A 4M75G 4HCBA 3UWNA 3J7AF 2X4XA 1WPYA 3BW1A 4HKEA 3OYIA 3QZ5B 4LDUA 3CCVT 5DY9A 2MM2A 3LWIA 1U1SA 3INZA 4FU6A 1KQ1A 1M1GA 1VQKA 5GMKh 4M75D 1JB0E 4BD3A 3M4YA 1VQ6T 2CZ1B 2K3XA 2DIGA 3HFNA 3ME9A 3URGA 4A54A 2AHJB 3RIRA 5GAN3 3OYJA 3A8OB 2MMPA 5GAN6 2F69A 2VV5A 5M9OA 3OYCA 3CCMA 4M7AC 1Y96B 2CZ6B 1Y96A 2V8KA 5DLQE 4BB7A 3V8JA 4C5GA 3QG1A 3G6EA 4E7JA 3S3OA 4KBMB 4LDXA 3LYIA 1UGQB 2FL7A 3CBMA 4J6XA 3H8ZA 1B34A 3CCUA 4PL6A 5LJ3j 3S3NA 5GANg 3OMGA 4M77E 1WNLA 3FJPA 1VQNT 1O54A 2M0OA 5CO7A 3T9NA 3VV0A 2P4TA 2MAMA 1HK9A 3ZFJA 5DLOA 4C5EA 3PGGA 3QIIA 4PJOG 1KD1U 2LX9A 4RG2A 3OYNA 2E1HA 4RKUE 1KG1A 1FWZA 5CKHA 4MZTA 2ZPGB 2X4JA 5C0MA 4X9DA 4C92G 1H3ZA 1W2BS 2LT4A 5CCBA 2Q19X 4P5NA 4OVAA 3X26B 1QW1A 2EJGA 3CCVA 1OZ3A 1FX7A 4IUUA 4OP0A 3X25B 3LHDA 3MEAA 2EWNA 1XNIA 2EKOA 2FB7A 3HFOA 4C92D 4IURA 2EFIA 3GNFB 5LJ5f 5FTMA 1SSFA 2HQEA 3SD4A 1BKBA 3JB9D 1QVGS 2RJCA 4BUGA 3LW5E 2K57A 2LQKA 1H641 3E19A 5LJ3h 2RHYA 3EFRA 1KC8C 1VQ6A 3CF2A 5C1BA 3OYHA 1YITA 4ME7A 4BE0A 3OBYA 1LJOA 2L3RA 2YLBA 5A0DA 1YI2A 4C0GA 3GIBA 3QUIA 3QJYA 2DD5A 1BI0A 1VIEA 2P0KA 1N8RU 2KK4A 3QXEB 1K9MC 3JCMb 4LDYA 4DA4A 5LJ5d 1S72T 3MP1A 1Y7XA 3CCJT 3QC8A 1VQNA 2LTOA 1UB4A 5KCHA 2DZCA 4XTXA 5CKFA 5CK9A 3DB3A 4JRQA 2FYKA 4MMKA 1BIBA 2CZ7B 3M56A 3VUZA 1Y71A 5GAN7 3L2RA 1NJIU 5EQJB 5CKBA 4C5HA 2XD0A 3BDLA 2OTLA 3JB9H 1G3YA 4M75E 3QYGB 3L1AA 3LGAA 3M54A 3CEYA 3MEUA 4OB1B 3EAEA 5FU7C 2QA4T 1CZ5A 4ELZC 4BDZA 2A7YA 3QQ8A 3META 3OYKA 1VQ7T 4D6WA 3I56T 3JB9F 3MP6A 3DKMA 5GANj 2HAXA 3R6OA 3CCET 4L59A 5CCXA 1JRIA 2VUBA 5LJ3g 1JBMA 2LVMA 3OW2A 4N0AA 2QEXT 2ZPHB 3CC7T 4BI8B 2RH2A 4C8QC 1OYXA 2FHDA 5GANe 4M7DC 1PSEA 5HY6A 3ZJTA 2M9UA 1XOVA 3FRNA 3HU2A 3I55A 1BI1A 2Y90A 4C8QA 4HT9A 1TH7A 3WVDB 4M7DA 3MHXA 4QVDA 3CCST 4ATOA 2E70A 2GFUA 2ZPBB 2O4XA 1E32A 3MB5A 3QJ6A 1I9GA 1S72A 4JRIA 3PIOA 3CCJA 3JRZA 5LJ3f 1AHJB 5GAN2 1G5VA 5A0LA 3TIWA 2VC8A 3JSCA 5GMKj 4M7AG 1O9SA 4Q5WA 2R5AA 3MCAB 3OS2A 1YIJT 3M4GA 2JOYA 1JJ2S 1YCYA 3H6ZA 3HRSA 3SWNB 3WVEB 4OB2B 2HD0A 1K8AC 1BIAA 3M53A 4C0FA 3CC4T 5GMKe 5GANh 3V7CA 3OS1A 2A3LA 4QVZA 2PVOB 1VQOT 4M7AD 4YTLA 2QI2A 2RHUA 3NTHA 1M90C 1BYMA 4M77F 1VUBA 4LD6A 2QA4A 5KH6A 3S3MA 2RI5A 1Y07A 2QXFA 4M78D 3WXMB 1KQ2A 4FT2A 5LJ3d 1M1KC 4L5GA 1VQ7A 1YJ9T 2DIQA 3DLMA 4FIBA 4A53A 3GLXA 4DOWA 3CMAA 2KMTA 3CCEA 5GAOr 4RV0A 2WACA 1P92A 3CMET 1VQ9T 2R5MA 3A8MB 5D6XA 1G3WA 4FM4B 5GAOm 4XTUA 4KDLA 3G7ZA 2LCLA 2M1HA 2X4YA 5CKDA 4F7UF 1KHIA 1YJWT 4M77B 4KUDK 1CZ4A 2D9TA 2HQXA 2V8IA 4QQGA 4M77A 2XG8D 3RMQA 3E1SA 3OYGA 3BFMA 3LLRA 2HNIA 3LX7A 4MMLA 4PLLA 4IUPA 4HCZA 3UPUA 1EIFA 1N9SA 3HPWA 4XU0A 4ARCA 2YUJA 4KODA 2DTIA 2RA2A 2KDSA 4NL2A 3LWHA 4X34A 5GMKl 3JCMP 2L89A 4E47A 2QTXA 5GAN8 2GQVA 3EFSA 4GLKA 1BI3A 5CQYA 2P0QA 5J3BA 3GPLA 3PNWC 1VQ4A 4RG8A 3CC4A 4F7UB 4A4KA 4XU1A 3MO8A 4M78F 4C5IA 2RD1A 4N4IA 1X6OA 1XTDA 2CGHA 2CS7A 3VU3C 5FLXE 2DXBA 5LJ3e 4KLNA 4KO8A 4AQ7A 3J80E 3CCRT 2RB6A 5GAMj 2K5LA 4C0DB 4OGEA 4B9WA 5CQXA 1QVPA 5CCAA 3O8VA 2Q1DX 3V8LA 2LC4A 3CBOA 1YJ9A 1VQLT 1IZ6A 2B8AA 5GANf 3A8HB 3X20B 4PJOD 4ARIA 4M75F 3CMEA 1VQ9A 2FVUA 4F7UE 2XKOC 4ELYC 2Q1CX 3CPFA 3OQ5A 4XU3A 2OAUA 4M78B 3C12A 1VIFA 4XTVA 4EDUA 1K73U 4BY6B 3CBPA 2QQAA 3C94A 4DOVA 4JRKA 3J81E 1YJWA 1KD1C 4Y28E 3FPRA 4XU2A 4EMHA 2NLUA 5HK0A 4JJNK 2DO3A 1R8OB 2E5QA 1U8RA 4PKCC 2RI3A 2DD4A 4A4GA 1N27A 3JCMQ 2LRQA 4LDWA 3PTAA 4C8QG 1Q7YU 2LQ8A 4M7AE 2DPPB 4EPCA 4RMOA 5GANd 4M7DG 4N4HA 3QDRB 2QQ9A 4IUVA 3X24B 3QWZA 3V8KA 4M75B 3LH0A 5GAMh 3RESA 4M78E 4M75A 3L42A 3KBGA 4ZTJA 2EQUA 2Q1AX 5C18A 2YRVA 2DJZA 3FIFA 2KVQG 4C8QD 4A4FA 5GMKi 3JCMh 1VQ5T 2JVVA 3FB9A 4HCCA 1FXXA 2M16A 3VJPA 1G3SA 2MM0A 3BY7A 2RHIA 2XI9A 2X35A 3RERA 3CCRA 3OSSC 2DTHA 3Q1JA 4BI4A 3OBWA 4CI0C 1X75C 4PJOF 3P8DA 3OW2S 1Q86U 1N8RC 1VQLA 5D6WA 1M4ZA 1N9RA 1QDNA 2ZPFB 3OYFA 4JUVA 2E65A 5GAN4 2DEQA 1UGSB 2K3YA 3CCQT 1QVFA 2RK1A 2WSEE 4C92F 4HA8A 3AHUA 3RKYA 5DYGA 3OYDA 3M5AA 1NPRA 1WJQA 1M5Q1 4N0AC 5HKCA 2EQJA 2F5KA 4CRIA 2MI6A 1NJIC 2EQKA 2Q18X 2DKGA 1O75A 4JDSA 4DQ2A 4UC4A 3MEWA 4J6YA 3QBYA 4E7IA 3P8HA 3DB4A 4EMKB 1UGRB 4J7FA 4PJOB 4E7LA 4TVRA 3PMIA 2RHXA 3GP8A 4BE2A 2LNVA 4NOYA 2QQSA 4ZN3A 3QYHB 1LNXA 2G3RA 2E41A 1Q81U 2XK0A 5GAMg 4C92B 1RL2A 3ZEHA 5GAOq 5FTLA 4WF2A 3L2WA 4OMFB 1YJNT 3L2UA 3HU3A 2JZ2A 1Q82C 3JCMg 1CR5A 3JAME 5B6CA 1M1FA 3RKXA 3SWNC 3QZ9B 3HHTB 2GCXA 4PJOE 3HSBA 3V7SA 3HU1A 3NTIA 4QVCA 4FSXA 2PQWA 4II1A 4IKFA 5FRNA 3MP8A 3SWNA 2K4YA 2JTFA 4C92E 1OI1A 5D6YA 3GNGA 5GAMf 1VQKT 1MHNA 4O6JA 2XU8A 3TCJA 2JN0A 3CXCA 5GAOn 3JCMf 3CCQA 3CD6T 1IREB 1KQSA 4QQ6A 2PVGB 2RO0A 4J83A 4QW2A 4XTZA 4JS5A 4MZMA 5EPPA 3HRUA 3I56A 2DVEA 2YHTA 5J39A 2EYQA 1WQ7A 5KCOA 2VXFA 3G4ST 3QHSA 5GAOl 5FU6C 2XDBA 3ZJVA 3QO3A 2K5FA 3CC2T 2EIFA 3PT9A 2VGNA 5I21A 1D3BB 5FTNA 2BUDA 2QEXA 5CAIA 3CC7A 5FU6B 1DJ7B 1V29B 3C95A 4IUQA 4M77C 3HKSA 4OGCA 5GAMd 3CPWA 2VGMA 3KXTA 2LCCA 1ZHIA 1VQ8T 2CYZB 2V8JA 3F70A 5FROA 3JCMd 3P8BB 5FTJA 2KAFA 1LOJA 1NPPA 4OB3B 2H3JA 4L6V5 1S3SA 2PUOB 3G71T 2L8DA 3CCSA 2WSCE 3TU4K 1OZ2A 4AS1A 1YITT 4OF1A 1YJNA 3N5BB 2ZCFB 2YVLA 4R56A 3ZJUA 2XICA 2L5QA 1MGQA 3L2VA 2KQWA 2D6FA 4ZGDB 2EJFA 3OYYA 1YIJA 3FPTA 2BIVA 4M7AF 1ZBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIB A;  2KY9 A; 
#chains in the Genus database with same CATH topology
 3ASK A;  1OX9 A;  4BAC A;  1X69 A;  3M0U A;  1FYN A;  3M58 A;  3JCM W;  1VQO A;  2LW6 A;  1M9S A;  2JTM A;  2EQM A;  3MEV A;  2GFA A;  3FDR A;  1M3C A;  5CVI A;  4C0Z A;  4M7A B;  4M78 C;  1QKW A;  4BY6 C;  3VUB A;  5FTK A;  5L23 A;  4M78 A;  1VQ8 A;  2QA4 Q;  2D0N A;  4LN2 A;  3EHQ A;  3ZL7 C;  2GF7 A;  3M57 A;  4M75 C;  5GAO p;  1TU0 B;  4ZGE B;  3CCE Q;  4EMG A;  3PFS A;  1K8A R;  1QKX A;  4XQ3 A;  4IUT A;  2R57 A;  1M8M A;  5I2S A;  5KYY B;  2J06 A;  1KHC A;  2NUP B;  3SB2 A;  4DEY A;  3QSU A;  2K9G A;  1U3O A;  1HD3 A;  1HXD A;  1BB9 A;  5CIU A;  3LGF A;  3A8L B;  3VYG A;  1LPL A;  4E7H A;  3I55 T;  2HBP A;  2W10 A;  4ESR A;  5A2Q E;  1RAB B;  3HRT A;  2E10 A;  3CC4 Q;  4HVU A;  2HSE B;  3HL8 A;  1H3H A;  3FLG A;  1PHT A;  2EYY A;  2F5T X;  2RI2 A;  4CC7 A;  3A8G B;  1VQP T;  2ZPE B;  2VYT A;  1ZQ1 A;  3EFO A;  3CME Q;  1QCN A;  1VQ9 Q;  2RJE A;  2E64 A;  4E7K A;  1ABQ A;  3CXC S;  1YJW Q;  4JS4 A;  4OMQ A;  1I81 A;  1Q82 U;  5CD1 A;  1QCS A;  1NBE B;  1U1T A;  2LDM A;  1YHQ A;  2BKD N;  2HCK A;  3C4S A;  3RKW A;  1ZA1 B;  5EC7 A;  4OML A;  4M7D B;  4PFO A;  1MMA A;  3PIP A;  2O4X B;  1ABO A;  3EGU A;  1QP3 A;  3CCL T;  5KYU B;  2RJF A;  3RR6 A;  3PMT A;  1M1K U;  4RCC A;  3CCR Q;  2DK3 A;  2DIL A;  2MWO A;  2DZ9 A;  5GLF A;  3CCU T;  3G1J A;  4C8Q E;  2JXB A;  3FC3 A;  1VQL Q;  4HT8 A;  2K5I A;  2EGC A;  2RNA A;  1UFF A;  4BE1 A;  3E9G A;  4OMM A;  1UDL A;  4DBR A;  3TRE A;  3LGL A;  1AT1 B;  3TVT A;  1KQS P;  3M0R A;  4WCI A;  2IPO B;  4HKE A;  4LDU A;  2VB6 A;  3INZ A;  1KQ1 A;  1M1G A;  1VOM A;  1PC0 A;  1TS9 A;  1JB0 E;  2F2W A;  3EG0 A;  2K3X A;  3ME9 A;  4A54 A;  3OYJ A;  1YIT T;  1D09 B;  4M7A C;  1Y96 B;  2CP3 A;  2CZ6 B;  5DLQ E;  4KBM B;  3LYI A;  3S3N A;  5GAN g;  3OMG A;  1RLP C;  3FJP A;  1QQJ A;  1Q82 R;  3VV0 A;  1HK9 A;  4C5E A;  3PGG A;  1KD1 U;  2LX9 A;  1KG1 A;  5CKH A;  2ESW A;  4C92 G;  1W2B S;  1SRL A;  3CC7 Q;  2Q19 X;  3M0Q A;  2E3H A;  3CCV A;  3MEA A;  2LCS A;  2EKO A;  1RLQ C;  2NUP A;  3JB9 D;  1YJN Q;  2LQK A;  1KC8 C;  2RHY A;  5C1B A;  1LJO A;  2L3R A;  4C0G A;  2DYB A;  1VIE A;  1K9M C;  4DA4 A;  5LJ5 d;  1S72 T;  1VQO Q;  3QC8 A;  2E5K A;  2DZC A;  3DB3 A;  1NJI U;  5GAN 7;  5EQJ B;  2OTL A;  4M4Z A;  1PKT A;  2D8H A;  3L1A A;  1AEY A;  2PTK A;  1CZ5 A;  2BTT A;  4OMN A;  3JB9 F;  3MP6 A;  2LQN A;  1VQ8 Q;  5FWC A;  1JRI A;  2LVM A;  3CC7 T;  1OYX A;  5GAN e;  4M7D C;  3FRN A;  2LNH B;  1TWB A;  3WVD B;  4M7D A;  2KRN A;  1KD1 R;  1E32 A;  2O4X A;  5KYU A;  3PIO A;  1WXB A;  5LJ3 f;  1QLY A;  5A0L A;  3TIW A;  3M4G A;  1B7T A;  1MMN A;  2O2O A;  2HD0 A;  3NPF A;  1BIA A;  3M53 A;  2CH4 A;  4QVZ A;  1VQO T;  4YTL A;  4IIM A;  4M77 F;  4PFP A;  2RI5 A;  1Y07 A;  2QXF A;  4M78 D;  3WXM B;  2AK5 A;  4L5G A;  2GNC A;  4Z88 A;  2DVJ A;  4FIB A;  4A53 A;  3CMA A;  2A37 A;  4JJD A;  1M2V B;  5IH2 A;  1AD5 A;  2FPE A;  5ECA A;  2M1H A;  2X4Y A;  2VVK A;  3MKD A;  4KUD K;  1CZ4 A;  5KYX B;  4KGX B;  1WA7 A;  3UPU A;  4CC4 B;  1N9S A;  2MYS A;  2QTV A;  2DTI A;  2EQI A;  1WHK A;  4CC2 A;  5GMK l;  1YHQ Q;  5GAN 8;  4GLK A;  5J3B A;  2P0Q A;  1IHV A;  4F7U B;  4M78 F;  4N4I A;  5FLX E;  2DXB A;  2AKL A;  3U23 A;  4AQ7 A;  1X2K A;  2O9V A;  3REA B;  2KNB B;  1IZ6 A;  1QWF A;  2B8A A;  1ZSG A;  5GAN f;  3X20 B;  4M75 F;  2OAU A;  4KRT A;  1F1B B;  1K73 U;  3TSZ A;  3CBP A;  4Y28 E;  5HK0 A;  2RQV A;  2DD4 A;  2RQR A;  3NMZ C;  2DPP B;  4RMO A;  4N4H A;  3QDR B;  4IUV A;  3RES A;  3L42 A;  3KBG A;  5C18 A;  2YRV A;  2DLP A;  4C8Q D;  1AZG B;  5GMK i;  3JCM h;  2ROL A;  4HCC A;  1G3S A;  2DER A;  2DTH A;  1I5O B;  4BI4 A;  3OBW A;  2JTE A;  4CI0 C;  1Q86 U;  4J9B A;  1OPL A;  2ZPF B;  4JUV A;  1B3Q A;  2P4R A;  1FMW A;  2WSE E;  5DYG A;  3OYD A;  1VQ4 Q;  1M5Q 1;  5HKC A;  2EQJ A;  2DA9 A;  2DKG A;  4JDS A;  1WX6 A;  3VS5 A;  4Y92 A;  2BZX A;  4PJO B;  4TVR A;  1JQQ A;  1W1F A;  2RHX A;  3LH5 A;  4BE2 A;  4NOY A;  4JJC A;  3R6N A;  1Q81 U;  5GAM g;  3CCV Q;  2Z0W A;  3JAM E;  1M1F A;  1RAG B;  3HHT B;  2KBT A;  2GCX A;  1K1Z A;  4Z8A A;  2L2P A;  2PQW A;  5FRN A;  1SRM A;  2F2V A;  1OI1 A;  5D6Y A;  2RQT A;  2X3W D;  1MHN A;  4KGV B;  3TCJ A;  2JN0 A;  3CCQ A;  1IRE B;  4QQ6 A;  5AT1 B;  2G6F X;  3G4S T;  1WQ7 A;  1SEM A;  2KGT A;  4E6R A;  1D0Z A;  5KCO A;  1KC8 R;  2XDB A;  2K5F A;  3EH2 A;  1M2V A;  5FU6 B;  5GAM d;  2OTL Q;  2VGM A;  3KXT A;  2LCC A;  4J9D A;  2V8J A;  1WIE A;  3F70 A;  5KYX A;  1S3S A;  2PUO B;  3G71 T;  2L8D A;  1OZ2 A;  1IGQ A;  2YVL A;  1YWP A;  4JZ4 A;  1ACM B;  3D7S B;  1KK7 A;  2M02 A;  2ED0 A;  4ZGD B;  3OYY A;  3FPT A;  2BIV A;  2C0O A;  4M7A F;  3M0T A;  2B25 A;  2DXT A;  4F7U A;  1M8V A;  2RN8 A;  5DYI A;  3SDZ A;  3M59 A;  3RMS A;  1AWO A;  2DTO A;  3GBQ A;  3EGD B;  2ABL A;  5GAM e;  3CC2 A;  2YUO A;  2WSF E;  3UDC A;  1TTH B;  2I0N A;  2L3S A;  2DBM A;  1QP2 A;  2VXE A;  5IAY A;  2QQR A;  4XTY A;  2O01 E;  5CKE A;  2OTL T;  4NS5 A;  3CMA Q;  1BCO A;  4MDW A;  2R58 A;  2AIR B;  4J5Y A;  2QEX Q;  5DM7 R;  3JB9 G;  2OTJ T;  1YFN A;  2JNG A;  4M7D D;  4MZP A;  4Y91 A;  3OMC A;  3CCS Q;  3X28 B;  5LL6 S;  1M27 C;  4JRP A;  3E9F A;  1WLF A;  3QQ7 A;  5FWB A;  4N4G A;  1UJ0 A;  1MND A;  2PVD B;  1YIJ Q;  3OYL A;  2DF6 A;  2F1L A;  4JJB A;  4R0K A;  2E6N A;  2EGA A;  1QVG A;  3ZGZ A;  4PJO C;  2JV2 A;  2FG0 A;  1WJS A;  3V7R A;  2K79 A;  3JCM J;  2ZGW A;  2QAZ A;  4PJO A;  2EJ9 A;  1WQW A;  1NE8 A;  4M77 G;  1I4K 1;  1PRM C;  1NYF A;  4M7D F;  2EAY A;  1VQM T;  2YT6 A;  1R7R A;  4PJM A;  2VKN A;  1G2B A;  3VYH B;  2QGF B;  3ER0 A;  3CMA T;  4FT4 A;  1WLP B;  1PKS A;  5LJ5 j;  4KH1 B;  1WGS A;  2MF2 A;  2CZ0 B;  2MWP A;  4C8Q B;  1K8A U;  4KUI A;  3QPH A;  1K4U S;  1WJR A;  2CUD A;  5L8R E;  5KE2 A;  1J3T A;  2YRC A;  4O5V A;  2KXD A;  3NTK A;  2EYW A;  4NL3 A;  3G6E T;  3M9Q A;  2KY9 A;  4B6M A;  4Z02 A;  2QYZ A;  4M78 G;  2KT1 A;  1D1C A;  2LZ6 B;  3EHR A;  5ERG B;  3RUX A;  1Z9Q A;  4B9X A;  5IHK A;  1RAA B;  4J9I A;  4M75 G;  4HCB A;  1WHL A;  3UWN A;  3J7A F;  1WPY A;  3BW1 A;  1U1S A;  1NLO C;  5GMK h;  2CZ1 B;  3HFN A;  2AHJ B;  3RIR A;  3CCM A;  1SKU B;  3A8O B;  2NUZ A;  4OMO A;  5M9O A;  2XMF A;  3EGD A;  4C5G A;  4BB7 A;  3V8J A;  2FZK B;  4E7J A;  1UG1 A;  1OU8 A;  4AMC A;  1UGQ B;  2FL7 A;  3CBM A;  2D1X A;  2DRM A;  1E6G A;  4M77 E;  2GTO A;  1O54 A;  5CO7 A;  3T9N A;  3CCQ Q;  2P4T A;  2MAM A;  4Z89 A;  3MJX A;  8ATC B;  1FWZ A;  4MZT A;  5GJV B;  2ZPG B;  2QGG A;  2J6K A;  2EJG A;  2DL5 A;  4OP0 A;  3LHD A;  4IUU A;  5KYW B;  3VS6 A;  2EFI A;  1BKB A;  2HEQ A;  4BUG A;  1VQ6 A;  1WFW A;  3EGX B;  4AFZ C;  4BE0 A;  2YLB A;  2BZY A;  1YI2 A;  3GIB A;  3QUI A;  1AWW A;  2QDL A;  1BI0 A;  1N8R U;  2J6F A;  3MP1 A;  1Y7X A;  1VQK Q;  1VQN A;  1VYT A;  3M0P A;  2FYK A;  4MMK A;  2HQH A;  5CKB A;  4FYX B;  1TG0 A;  2H3E B;  2JM8 A;  3CC2 Q;  4M75 E;  3QYG B;  3M54 A;  1HSQ A;  3CEY A;  4OB1 B;  3EAE A;  2QA4 T;  4D8K A;  4ELZ C;  4BDZ A;  2A7Y A;  3MET A;  1QVF P;  2NYS A;  3CCE T;  5CCX A;  2VUB A;  5LJ3 g;  3OW2 A;  4N0A A;  1QVG P;  2ZPH B;  4J9F A;  4BI8 B;  2RH2 A;  4C8Q C;  2PZ1 A;  1T0J A;  5HY6 A;  1XOV A;  2DRK A;  1BI1 A;  2Y90 A;  2DFU A;  1C1A A;  4C8Q A;  3MHX A;  4JRI A;  3CCJ A;  3JRZ A;  2LQW A;  2VC8 A;  2HL3 A;  5GMK j;  4M7A G;  1ZBJ A;  3EH1 A;  1JJ2 S;  1YCY A;  3H6Z A;  3HRS A;  3I35 A;  1GL5 A;  3CC4 T;  2QI2 A;  2RHU A;  3NTH A;  1M90 C;  1D0X A;  1Y0M A;  2YRD A;  5LJ3 d;  2GTJ A;  1VQ7 A;  1TOV A;  3DLM A;  4KGZ B;  4RV0 A;  1N8R R;  3QWX X;  3CME T;  1VQ9 T;  3A8M B;  4FM4 B;  4RTU A;  1IGU A;  4KDL A;  1SHF A;  4F7U F;  1YJW T;  3CPW P;  4QQG A;  2V26 A;  2BZ8 A;  3BFM A;  2M51 A;  4QT7 A;  4HCZ A;  4ARC A;  1W70 A;  2KDS A;  2ECZ A;  2COY A;  4X34 A;  4ZNX A;  2L89 A;  5IXF A;  2GQV A;  3EFS A;  5CQY A;  3C0C A;  1VQ4 A;  3H41 A;  3GPL A;  3PNW C;  1C0M A;  4A4K A;  4C5I A;  3VU3 C;  2CGH A;  2VAS A;  4HCK A;  5LJ3 e;  2K6D A;  4KO8 A;  3CCR T;  2MOX A;  5GAM j;  4B9W A;  1GFC A;  1YJ9 A;  1VQL T;  2GQI A;  2LJ3 A;  5HCK A;  3A8H B;  4PJO D;  1MV0 B;  2Q1C X;  3CPF A;  3OQ5 A;  4XU3 A;  5KYW A;  3BQB A;  7AT1 B;  4DOV A;  4DBQ A;  3FPR A;  2EYX A;  3VS2 A;  4EMH A;  1K0S A;  4JJN K;  3EGX A;  2RI3 A;  1N27 A;  1X43 A;  2LRQ A;  4LDW A;  2LQ8 A;  4M7A E;  4M7D G;  1YCS B;  4EPC A;  5GAN d;  3X24 B;  4ORZ A;  2FRY A;  3JV3 A;  4ZTJ A;  2EQU A;  1K9A A;  2E3I A;  3SHW A;  1R0B G;  2XI9 A;  3RER A;  3CCM Q;  2ENM A;  1SSH A;  4D8D A;  3Q1J A;  5IHN A;  4PJO F;  2KEA A;  5D6W A;  1M4Z A;  1U06 A;  1QDN A;  1GFD A;  5GAN 4;  1UGS B;  1YNZ A;  1WJQ A;  4CRI A;  2O9S A;  4UC4 A;  4EIK A;  1D1A A;  4E7I A;  4J7F A;  2KR3 A;  1PM3 A;  2DL7 A;  4CC3 A;  1WZO A;  1TUG B;  3QYH B;  1LNX A;  3TSW A;  4FCY A;  1RL2 A;  5GAO q;  1OU9 A;  1UTI A;  4OMF B;  1YJN T;  3HU3 A;  2JZ2 A;  1PNJ A;  1RAI B;  4F04 B;  3RBB B;  1VQ6 Q;  3NTI A;  3PVQ A;  4QVC A;  3MP8 A;  1SG5 A;  2JTF A;  4C92 E;  1YI2 Q;  1N5Z A;  3OW2 P;  2XU8 A;  3CXC A;  5GAO n;  3JCM f;  2PVG B;  4QW2 A;  4JS5 A;  5EPP A;  3HRU A;  1VQN Q;  2DVE A;  2EYQ A;  2LX7 A;  3QHS A;  3ZJV A;  1H8K A;  4AFQ C;  2RPN A;  2QEX A;  2OJ2 A;  5CAI A;  2COZ A;  4IUQ A;  3HKS A;  2K3B A;  2KI7 A;  1ZHI A;  1VQ8 T;  5FTJ A;  3VS3 A;  3P8B B;  2KAF A;  3CCS A;  4OF1 A;  1NYG A;  3A1P A;  3CQT A;  2XIC A;  2A36 A;  1M30 A;  2KQW A;  1ZSZ A;  1I07 A;  1X6B A;  2EJF A;  3IQL A;  1YIJ A;  3MPU B;  4FW2 A;  1M2O A;  1YN8 A;  3A5Z B;  3QKJ A;  2C06 A;  3CD6 A;  1NM7 A;  5HK3 A;  3CCJ Q;  4AFU C;  4LXC A;  1X27 A;  2RMO A;  2ZPI B;  3THK A;  1YI2 T;  4FL6 A;  2RQU A;  2XID A;  2DL3 A;  1UJY A;  1GBR A;  4PJL A;  1PG5 B;  2YLC A;  3UAT A;  9ATC B;  2COW A;  4AFS C;  4J9C A;  4OB0 B;  2P84 A;  1VQ7 Q;  3UF4 A;  2CP2 A;  3I56 Q;  4A4H A;  2PNI A;  1KC8 U;  1TUD A;  4ZN1 A;  1SF9 A;  1I0C A;  2DXU A;  3SFM A;  2HSP A;  1M90 R;  3SEM A;  1QVF S;  1K9M U;  1V1C A;  2E12 A;  3GF5 A;  4J9E A;  1UGP B;  1CKB A;  2PU9 B;  5IN1 A;  3OYM A;  1Q7Y C;  1W2B A;  1YHQ T;  1BCM A;  2DM1 A;  2XHC A;  3JCM X;  4AT1 B;  1G8X A;  1UUE A;  2EYZ A;  4JZ3 A;  3GOX A;  4V2S A;  2KYM A;  4A63 B;  1I8F A;  1N6A A;  2Y4X A;  2AZV A;  2NWM A;  4LNP A;  4QQD A;  1NLP C;  3L2Z A;  1YJ9 Q;  4KT0 E;  4PNO A;  3OYA A;  2E4H A;  3TQ7 P;  5CR2 A;  1WHG A;  4J8O A;  4C8Q F;  2RJD A;  3OSV A;  3JCM V;  1JEG A;  3FPU A;  3OYB A;  1KQS S;  1E7O A;  3BE3 A;  2SEM A;  1GCQ C;  3OB9 A;  1R0C B;  5I22 A;  4A4E A;  4F7U G;  3BDU A;  2H8H A;  1GCQ A;  2KRS A;  3CPW S;  2PJH B;  3S6W A;  5GAN 5;  4VUB A;  3OA6 A;  4OMP A;  3UT1 A;  3DLL A;  1YBY A;  5IHI A;  2A08 A;  1D1B A;  2DXC A;  1VQ4 T;  4IIO A;  3H9N A;  1K9M R;  2IVW A;  2F2X A;  5AYF A;  1VQP A;  2LT1 A;  2ZZD A;  1RI0 A;  5EG2 A;  1QCF A;  2X4W A;  3PVL A;  4RCB A;  3NGP A;  5LJ5 h;  4CQN A;  3JCM c;  2RM4 A;  3FEO A;  3I5S A;  2FZG B;  1NZ9 A;  2QAS A;  2M0Y A;  3CXC P;  4BI3 A;  1JXO A;  2HMA A;  1AWX A;  2X4X A;  3OYI A;  3CCV T;  2MM2 A;  2CRE A;  1PWT A;  1UGV A;  1VQK A;  2DE0 X;  4JPB W;  1KJW A;  2YDL A;  4BD3 A;  3M4Y A;  1BBZ A;  5GAN 3;  2DIG A;  3URG A;  3CCL A;  1VQ5 Q;  5GAN 6;  3OYC A;  1Q95 G;  4DEX A;  2V8K A;  1SPK A;  2ED1 A;  3S3O A;  3HTR A;  4J6X A;  3CCU A;  2LJ0 A;  5LJ3 j;  4AG2 C;  4WTO B;  2L3Q A;  3ZFJ A;  3QII A;  4PJO G;  1WHM A;  1QCO A;  3OYN A;  2E1H A;  4RKU E;  2X4J A;  2MPX C;  4OVA A;  5GJW B;  2A28 A;  3X26 B;  1QW1 A;  1OZ3 A;  4PFZ A;  3EG3 A;  1WYX A;  3HFO A;  4C92 D;  4IUR A;  3GNF B;  1SSF A;  3LW5 E;  1H64 1;  3E19 A;  3CF2 A;  3EFR A;  1YIT A;  4KH0 B;  3OBY A;  2JMC A;  5A0D A;  2V1R A;  3QXE B;  2ROT A;  3JCM b;  2X9H A;  1UE9 A;  2DYI A;  3CD6 Q;  1UB4 A;  5KCH A;  1OQK A;  2C0I A;  4XTX A;  5CK9 A;  4JRQ A;  1I1J A;  2V1Q A;  3VUZ A;  2CZ7 B;  3JB9 H;  1HJD A;  3MEU A;  2KRO A;  1W2B P;  1YWO A;  2YXY A;  3QQ8 A;  3OYK A;  2FRW A;  4D6W A;  1T0H A;  1VA7 A;  2CT4 A;  5GAN j;  4L59 A;  2CSQ A;  2QEX T;  1ZUU A;  2FHD A;  3ZJT A;  4QVD A;  3CCS T;  3MB5 A;  2GFU A;  2ZPB B;  1S72 A;  5GAN 2;  1AHJ B;  1JU5 C;  5D7U A;  4FYY B;  1O9S A;  3I9Q A;  4Q5W A;  2R5A A;  2O88 A;  1YIJ T;  1BK2 A;  2AZS A;  3SWN B;  1FMK A;  4OB2 B;  2OAW A;  3V7C A;  3OS1 A;  2A3L A;  1LCK A;  3RNJ A;  1KSW A;  1R77 A;  1QMC A;  1VUB A;  4LD6 A;  5KH6 A;  1KQ2 A;  2CH4 W;  4FT2 A;  1M1K C;  1CSK A;  1Q7Y R;  2DIQ A;  4PJN A;  2A0F B;  1KFZ A;  2DNU A;  2KMT A;  1MUZ A;  4FW1 A;  2R5M A;  4J9H A;  1G3W A;  2BE9 B;  5GAO m;  4XTU A;  2KT8 A;  3G7Z A;  1JO8 A;  1T3S A;  4LUD A;  1KHI A;  1M3B A;  2D9T A;  2HQX A;  2V8I A;  4M77 A;  5KYN A;  2XG8 D;  3E1S A;  3VS1 A;  3LX7 A;  4LUE A;  4PLL A;  2EPD A;  3HPW A;  4XU0 A;  4KOD A;  2CSI A;  2RA2 A;  4RTX A;  3LWH A;  1AOJ A;  1BI3 A;  4RG8 A;  3I55 Q;  4XU1 A;  3QDF A;  1LVK A;  1XTD A;  2CS7 A;  2QK0 A;  1UHC A;  2RB6 A;  2RQW A;  2K5L A;  4C0D B;  5CQX A;  1X6G A;  1CKA A;  2XKO C;  4ELY C;  1VQP Q;  4XTV A;  1VIF A;  2X3X D;  2YUN A;  3PE0 A;  4EDU A;  2QG9 B;  2QQA A;  1KD1 C;  2JT4 A;  4XU2 A;  2DO3 A;  1R8O B;  2E5Q A;  1U8R A;  1RAH B;  3PTA A;  4C8Q G;  1ZLM A;  1WHJ A;  3QWZ A;  3LH0 A;  5GAM h;  4M78 E;  4M75 A;  2Q1A X;  2KRM A;  2DJZ A;  4GBQ A;  4A4F A;  3EG1 A;  2JVV A;  2OX7 A;  4RUG A;  1FXX A;  3VJP A;  1SHG A;  1OOT A;  2RHI A;  3CCL Q;  4ANJ A;  3OSS C;  3UA6 A;  2MIO A;  4FYV B;  3P8D A;  4E7Z A;  1N9R A;  4HVV A;  3OYF A;  2E65 A;  2KE9 A;  3CCQ T;  2RK1 A;  2YWW A;  3CCU Q;  4HA8 A;  3AHU A;  3RKY A;  2FPF A;  2BE7 D;  4N0A C;  1AWJ A;  3M0S A;  1WHH A;  2F5K A;  1NJI C;  1O75 A;  4DQ2 A;  3QBY A;  3P8H A;  1Z9Z A;  4EMK B;  1UGR B;  1WDX A;  3PMI A;  2YUP A;  4K11 A;  2QQS A;  1MMG A;  2E41 A;  2XK0 A;  4C92 B;  4WF2 A;  3L2W A;  1MV3 A;  2O31 A;  3JCM g;  1B07 A;  3SWN C;  4RTZ A;  2CUB A;  3HSB A;  3V7S A;  3HU1 A;  4IKF A;  4II1 A;  1YIT Q;  3SWN A;  2J6O A;  3GNG A;  1VQK T;  2DBK A;  4J83 A;  4XTZ A;  4MZM A;  3I56 A;  2VXF A;  5GAO l;  3QO3 A;  3CC2 T;  5I21 A;  3PT9 A;  2VGN A;  1D3B B;  5FTN A;  2BUD A;  2X51 A;  1V29 B;  3C95 A;  1PD1 A;  2CYZ B;  5FRO A;  3JCM d;  1LOJ A;  1NPP A;  3AT1 B;  4L6V 5;  4AS1 A;  1G83 A;  3TU4 K;  3VS0 A;  2NUT B;  1RAF B;  2EKH A;  1EX4 A;  3ZJU A;  2L5Q A;  1ZSZ B;  2CP5 A;  3L2V A;  2DJQ A;  2DEU A;  3ZBD A;  2K2M A;  2PUK B;  1EFN A;  4C0D C;  3L2Q A;  4XTW A;  2DAQ A;  4DBF A;  1BU1 A;  1S72 Q;  4GLM A;  2DX1 A;  2D0Q B;  3G4S A;  2HBW A;  4LDV A;  1B34 B;  4M7A A;  3JCM e;  4LD9 K;  2L3P A;  5A0G A;  4X1V A;  5GMK m;  3JB9 J;  5LJ5 g;  2XDD A;  3G71 A;  1IHW A;  2LP5 A;  2EGE A;  3TEE A;  1C6V X;  5FRM A;  4KDI A;  1BI2 A;  1W6X A;  1S1N A;  1K73 C;  3OS0 A;  2PWY A;  2CDT A;  2CKK A;  3OS5 A;  5KYY A;  1OUL A;  5C6S A;  5IT9 E;  1UEB A;  5J26 A;  2HL5 C;  2B86 A;  3FJ5 A;  1M1K R;  2P0P A;  1PSF A;  2JUF A;  2EBP A;  3OY9 A;  2Y4Y A;  1HYO A;  3UA7 A;  4XAX B;  1ZUK A;  2AT1 B;  2QDY B;  4KUL A;  3M55 A;  5I2M A;  1GXI E;  1RI9 A;  1IB8 A;  3H0H A;  1G3T A;  3JB9 I;  2JS0 A;  4EMK C;  1X01 A;  1ZC1 A;  1Q86 C;  2MCN A;  4E7S A;  4EMK A;  3KUF A;  2K2V A;  4C92 C;  1ZUY A;  2IG0 A;  4XK8 E;  2K7A A;  4C92 A;  2C0T A;  4ZTF A;  1XQH A;  3E2U A;  2OTJ A;  4JLG A;  5FU7 B;  1VQ5 A;  4M77 D;  4F17 A;  5KE3 A;  1OX8 A;  1OV3 A;  3VKI A;  1XJW B;  2I2L A;  4J9G A;  2RK2 A;  4GY5 A;  1Q81 C;  4JLI A;  1WXT A;  3NFC A;  1A0N B;  2E6Z A;  2KSS A;  5IXB A;  5LJ5 e;  4J7I A;  2ATC B;  1M90 U;  1W4S A;  3CCM T;  2IIM A;  1MNE A;  4MDX A;  3OYE A;  1U5S A;  4RTT A;  1D3B A;  1TXQ A;  2XDP A;  2QQB A;  2RHZ A;  2CP0 A;  4M7D E;  4X9C A;  1UHF A;  4ZGJ B;  4BDY A;  4R55 A;  4PLI A;  3HP9 A;  1ZSZ C;  1VQM A;  4J6W A;  4DBH A;  1OEB A;  5I11 A;  2NUT A;  1JJ2 A;  1I5L A;  4RTW A;  2JM9 A;  3QZ5 B;  5DY9 A;  1ARK A;  1VYV A;  3LWI A;  4FU6 A;  4M75 D;  2MK5 A;  1VQ6 T;  1M3A A;  1NJI R;  2HKN A;  2MMP A;  2F69 A;  2VV5 A;  1K0X A;  1Y96 A;  2DL8 A;  3G6E A;  3QG1 A;  5FW9 A;  4LDX A;  3H8Z A;  1B34 A;  4PL6 A;  1AVZ C;  3H0F A;  1WNL A;  1VQN T;  2M0O A;  1RAE B;  1PRL C;  2VWF A;  1RAC B;  3QWY A;  2LMJ A;  2FO0 A;  5DLO A;  1EZZ B;  4RG2 A;  3VS4 A;  5C0M A;  1H3Z A;  4X9D A;  2LT4 A;  5CCB A;  4P5N A;  1FX7 A;  3X25 B;  2EWN A;  1XNI A;  1RAD B;  2FB7 A;  5LJ5 f;  5FTM A;  2HQE A;  3SD4 A;  3EG2 A;  1QVG S;  2RJC A;  5LJ3 h;  2K57 A;  3OYH A;  2KXC A;  4ME7 A;  2JMA A;  3QJY A;  2DD5 A;  2JJ9 A;  2P0K A;  2KK4 A;  2J7I A;  4LDY A;  3CCJ T;  4PK4 A;  2LTO A;  5CKF A;  3L2R A;  1BIB A;  1UEC A;  3M56 A;  1Y71 A;  3G4S Q;  4C5H A;  2XD0 A;  1H92 A;  3BDL A;  1G3Y A;  3LGA A;  1PD0 A;  5FU7 C;  1VQ7 T;  3I56 T;  3DKM A;  2HAX A;  3R6O A;  3G71 Q;  1JBM A;  3KFV A;  1PSE A;  2M9U A;  3HU2 A;  3I55 A;  2EVR A;  4HT9 A;  1TH7 A;  1GCP A;  4HVW A;  4ATO A;  2E70 A;  3QJ6 A;  1I9G A;  2D8J A;  2GBQ A;  3NHN A;  1IRX A;  1G5V A;  1IXD A;  3JSC A;  4RTY A;  2YSQ A;  2ZAE A;  3MCA B;  3OS2 A;  4E2F B;  2JOY A;  3WVE B;  1FMV A;  1K8A C;  1OPK A;  4C0F A;  5GMK e;  5GAN h;  1K73 R;  2PVO B;  4M7A D;  1BYM A;  2HKQ B;  2QA4 A;  4FSS A;  3S3M A;  1YP5 A;  1YJ9 T;  4DOW A;  3GLX A;  3CCE A;  5GAO r;  2FPD A;  2WAC A;  3VRY A;  1P92 A;  1V76 A;  2HZY A;  5D6X A;  2OI3 A;  2FZC B;  3EG9 B;  2LCL A;  5CKD A;  4M77 B;  1TSF A;  2DL4 A;  3RMQ A;  3OYG A;  2OTJ Q;  3LLR A;  2HNI A;  2RF0 A;  4MML A;  4LE9 A;  6AT1 B;  4IUP A;  1Q86 R;  1EIF A;  4F16 A;  2YUJ A;  4NL2 A;  1JJ2 P;  3JCM P;  4E47 A;  2QTX A;  3CC4 A;  2GGR A;  3MO8 A;  2RD1 A;  1X6O A;  4KLN A;  1NG2 A;  3J80 E;  4OGE A;  5CCA A;  1NEG A;  1QVP A;  1QWE A;  3O8V A;  8AT1 B;  2Q1D X;  3V8L A;  2LC4 A;  3CBO A;  1Q81 R;  1K76 A;  3I5R A;  4ARI A;  3CME A;  3ULR B;  1VQ9 A;  2FVU A;  4F7U E;  1KIK A;  2CP7 A;  4M78 B;  3C12 A;  4BY6 B;  3C94 A;  3J81 E;  4JRK A;  1YJW A;  4QKU A;  1AZE A;  1VQM Q;  1RUW A;  2NLU A;  2JS2 A;  4AG1 C;  4PKC C;  4A4G A;  2YUQ A;  3JCM Q;  1VYU A;  1Q7Y U;  3REB B;  2QQ9 A;  3V8K A;  4M75 B;  2CT3 A;  4PJJ A;  1GRI A;  3FIF A;  2KVQ G;  1VQ5 T;  4HXJ A;  3FB9 A;  2M16 A;  1PCX A;  1X2Q A;  2MM0 A;  3BY7 A;  2X35 A;  1GBQ A;  3CCR A;  1X75 C;  3OW2 S;  3H0I A;  1N8R C;  1VQL A;  3G6E Q;  2L0A A;  1ZA2 B;  2DEQ A;  3VRZ A;  4F14 A;  2K3Y A;  1QVF A;  4C92 F;  3O5Z A;  2W0Z A;  3M5A A;  1NPR A;  1Y57 A;  2MI6 A;  1E6H A;  2EQK A;  1TUC A;  2Q18 X;  3MEW A;  4J6Y A;  3RDV A;  3DB4 A;  4E7L A;  3GP8 A;  2LNV A;  4ZN3 A;  2AKK A;  2G3R A;  3EFO B;  3ZEH A;  5FTL A;  3L2U A;  2SRC A;  1Q82 C;  1CR5 A;  1MMD A;  5B6C A;  3RKX A;  3QZ9 B;  4FYW B;  1WXU A;  4PJO E;  4FSX A;  2KYB A;  1JXM A;  1IO6 A;  2K4Y A;  2JW4 A;  5GAM f;  4O6J A;  2LJ1 A;  3CD6 T;  1WI7 A;  1KQS A;  2RO0 A;  2J05 A;  2YHT A;  5J39 A;  5FU6 C;  2HDA A;  2EIF A;  2FEI A;  3CC7 A;  1DJ7 B;  4OGC A;  3CPW A;  4M77 C;  1ZX6 A;  3A98 A;  3EG9 A;  1NEB A;  2DMO A;  2DET A;  4OB3 B;  2CP6 A;  2H3J A;  2EW3 A;  2WSC E;  1T3L A;  1YJN A;  3N5B B;  2ZCF B;  4R56 A;  1MGQ A;  1D0Y A;  4RTV A;  2D6F A;  3VS7 A;  1ZBX A; 
#chains in the Genus database with same CATH homology
 3ASK A;  3ZBD A;  4BAC A;  2B25 A;  3JCM W;  3M58 A;  3BQB A;  2PUK B;  2DXT A;  1VQO A;  4F7U A;  2LW6 A;  3A5Z B;  4C0D C;  3L2Q A;  4XTW A;  3QKJ A;  1M8V A;  1M9S A;  2JTM A;  2DAQ A;  2C06 A;  2EQM A;  3CD6 A;  3MEV A;  5DYI A;  2GFA A;  3FDR A;  3SDZ A;  5HK3 A;  3M59 A;  3RMS A;  2D0Q B;  5CVI A;  3G4S A;  2DTO A;  2ZPI B;  1YI2 T;  4FL6 A;  5GAM e;  3CC2 A;  2XID A;  4C0Z A;  4M7A B;  4LDV A;  4M78 C;  1B34 B;  4M7A A;  4BY6 C;  2WSF E;  3UDC A;  2YLC A;  3VUB A;  3JCM e;  4LD9 K;  5FTK A;  5A0G A;  4M78 A;  1VQ8 A;  5GMK m;  3JB9 J;  4OB0 B;  1QP2 A;  5LJ5 g;  2XDD A;  2VXE A;  3G71 A;  2GF7 A;  5IAY A;  2QQR A;  4XTY A;  3M57 A;  2O01 E;  3TEE A;  4A4H A;  5CKE A;  4M75 C;  5GAO p;  4ZGE B;  4NS5 A;  2OTL T;  1KC8 U;  4MDW A;  4EMG A;  3PFS A;  4ZN1 A;  5FRM A;  2R58 A;  1BI2 A;  4KDI A;  4J5Y A;  5DM7 R;  4XQ3 A;  2DXU A;  3SFM A;  4IUT A;  3JB9 G;  1K73 C;  2R57 A;  3OS0 A;  5I2S A;  2PWY A;  2OTJ T;  2CKK A;  3OS5 A;  2JNG A;  1QVF S;  1K9M U;  4M7D D;  5C6S A;  5IT9 E;  1UEB A;  4MZP A;  5J26 A;  4Y91 A;  2E12 A;  1KHC A;  3GF5 A;  2P0P A;  3SB2 A;  1UGP B;  2PU9 B;  3OMC A;  5IN1 A;  3QSU A;  1PSF A;  1HXD A;  2JUF A;  3X28 B;  3OYM A;  1Q7Y C;  5CIU A;  5LL6 S;  3OY9 A;  2Y4Y A;  3LGF A;  1W2B A;  4JRP A;  1YHQ T;  3A8L B;  4XAX B;  3VYG A;  3E9F A;  4E7H A;  1WLF A;  3QQ7 A;  3I55 T;  2QDY B;  4N4G A;  2HBP A;  2XHC A;  3M55 A;  4KUL A;  2PVD B;  5I2M A;  3JCM X;  5A2Q E;  1GXI E;  3HRT A;  2E10 A;  3OYL A;  3GOX A;  4V2S A;  2E6N A;  1QVG A;  1G3T A;  3JB9 I;  1I8F A;  1N6A A;  3ZGZ A;  4EMK C;  2Y4X A;  1X01 A;  4PJO C;  2JV2 A;  3HL8 A;  1ZC1 A;  3FLG A;  1WJS A;  4QQD A;  3V7R A;  1Q86 C;  3JCM J;  2ZGW A;  2RI2 A;  2F5T X;  3L2Z A;  3KUF A;  2K2V A;  4C92 C;  4EMK A;  2EJ9 A;  3A8G B;  4KT0 E;  4PJO A;  1WQW A;  1VQP T;  1NE8 A;  2ZPE B;  2VYT A;  4M77 G;  4PNO A;  1I4K 1;  2IG0 A;  5CR2 A;  4J8O A;  3OYA A;  1ZQ1 A;  4C8Q F;  2RJD A;  3OSV A;  4XK8 E;  4M7D F;  4C92 A;  2EAY A;  2RJE A;  2E64 A;  3JCM V;  1VQM T;  1R7R A;  4ZTF A;  1XQH A;  3FPU A;  3OYB A;  2OTJ A;  4E7K A;  4JLG A;  5FU7 B;  3CXC S;  4M77 D;  5KE3 A;  3VYH B;  3ER0 A;  4JS4 A;  1VQ5 A;  1KQS S;  1I81 A;  3VKI A;  1Q82 U;  2I2L A;  4FT4 A;  3CMA T;  5CD1 A;  3OB9 A;  2RK2 A;  1QCS A;  4GY5 A;  1U1T A;  5LJ5 j;  2LDM A;  1WGS A;  4A4E A;  2MF2 A;  4F7U G;  1YHQ A;  1Q81 C;  2BKD N;  2CZ0 B;  3C4S A;  3BDU A;  3NFC A;  4JLI A;  3RKW A;  2E6Z A;  2KSS A;  2MWP A;  4C8Q B;  4KUI A;  3CPW S;  1K8A U;  3QPH A;  4M7D B;  2PJH B;  1WJR A;  5L8R E;  5LJ5 e;  3S6W A;  3PIP A;  5GAN 5;  2O4X B;  4J7I A;  4VUB A;  5KE2 A;  3CCL T;  1QP3 A;  1M90 U;  1W4S A;  3CCM T;  4O5V A;  3OA6 A;  2RJF A;  3UT1 A;  3NTK A;  3DLL A;  1YBY A;  3PMT A;  4NL3 A;  4MDX A;  1M1K U;  3OYE A;  3G6E T;  4RCC A;  3M9Q A;  2KY9 A;  1D3B A;  2DXC A;  2DK3 A;  2MWO A;  5GLF A;  2DZ9 A;  4Z02 A;  3CCU T;  2XDP A;  2QQB A;  2RHZ A;  4C8Q E;  3FC3 A;  4M78 G;  1VQ4 T;  4M7D E;  4HT8 A;  2IVW A;  2K5I A;  4X9C A;  5AYF A;  1VQP A;  2LT1 A;  2ZZD A;  3CCL A;  1RI0 A;  5EG2 A;  4BE1 A;  4ZGJ B;  4BDY A;  3E9G A;  5ERG B;  2X4W A;  4RCB A;  4R55 A;  4PLI A;  3HP9 A;  3RUX A;  5LJ5 h;  1VQM A;  4CQN A;  3JCM c;  4J6W A;  2RM4 A;  3FEO A;  4B9X A;  1NZ9 A;  3TRE A;  1JJ2 A;  3LGL A;  1I5L A;  4BI3 A;  4M75 G;  4HCB A;  3UWN A;  3J7A F;  2X4X A;  1WPY A;  3BW1 A;  4HKE A;  3OYI A;  3QZ5 B;  4LDU A;  3CCV T;  5DY9 A;  2MM2 A;  3LWI A;  1U1S A;  3INZ A;  4FU6 A;  1KQ1 A;  1M1G A;  1VQK A;  5GMK h;  4M75 D;  1JB0 E;  4BD3 A;  3M4Y A;  1VQ6 T;  2CZ1 B;  2K3X A;  2DIG A;  3HFN A;  3ME9 A;  3URG A;  4A54 A;  2AHJ B;  3RIR A;  5GAN 3;  3OYJ A;  3A8O B;  2MMP A;  5GAN 6;  2F69 A;  2VV5 A;  5M9O A;  3OYC A;  3CCM A;  4M7A C;  1Y96 B;  2CZ6 B;  1Y96 A;  2V8K A;  5DLQ E;  4BB7 A;  3V8J A;  4C5G A;  3QG1 A;  3G6E A;  4E7J A;  3S3O A;  4KBM B;  4LDX A;  3LYI A;  1UGQ B;  2FL7 A;  3CBM A;  4J6X A;  3H8Z A;  1B34 A;  3CCU A;  4PL6 A;  5LJ3 j;  3S3N A;  5GAN g;  3OMG A;  4M77 E;  1WNL A;  3FJP A;  1VQN T;  1O54 A;  2M0O A;  5CO7 A;  3T9N A;  3VV0 A;  2P4T A;  2MAM A;  1HK9 A;  3ZFJ A;  5DLO A;  4C5E A;  3PGG A;  3QII A;  4PJO G;  1KD1 U;  2LX9 A;  4RG2 A;  3OYN A;  2E1H A;  4RKU E;  1KG1 A;  1FWZ A;  5CKH A;  4MZT A;  2ZPG B;  2X4J A;  5C0M A;  4X9D A;  4C92 G;  1H3Z A;  1W2B S;  2LT4 A;  5CCB A;  2Q19 X;  4P5N A;  4OVA A;  3X26 B;  1QW1 A;  2EJG A;  3CCV A;  1OZ3 A;  1FX7 A;  4IUU A;  4OP0 A;  3X25 B;  3LHD A;  3MEA A;  2EWN A;  1XNI A;  2EKO A;  2FB7 A;  3HFO A;  4C92 D;  4IUR A;  2EFI A;  3GNF B;  5LJ5 f;  5FTM A;  1SSF A;  2HQE A;  3SD4 A;  1BKB A;  3JB9 D;  1QVG S;  2RJC A;  4BUG A;  3LW5 E;  2K57 A;  2LQK A;  1H64 1;  3E19 A;  5LJ3 h;  2RHY A;  3EFR A;  1KC8 C;  1VQ6 A;  3CF2 A;  5C1B A;  3OYH A;  1YIT A;  4ME7 A;  4BE0 A;  3OBY A;  1LJO A;  2L3R A;  2YLB A;  5A0D A;  1YI2 A;  4C0G A;  3GIB A;  3QUI A;  3QJY A;  2DD5 A;  1BI0 A;  1VIE A;  2P0K A;  1N8R U;  2KK4 A;  3QXE B;  1K9M C;  3JCM b;  4LDY A;  4DA4 A;  5LJ5 d;  1S72 T;  3MP1 A;  1Y7X A;  3CCJ T;  3QC8 A;  1VQN A;  2LTO A;  1UB4 A;  5KCH A;  2DZC A;  4XTX A;  5CKF A;  5CK9 A;  3DB3 A;  4JRQ A;  2FYK A;  4MMK A;  1BIB A;  2CZ7 B;  3M56 A;  3VUZ A;  1Y71 A;  5GAN 7;  3L2R A;  1NJI U;  5EQJ B;  5CKB A;  4C5H A;  2XD0 A;  3BDL A;  2OTL A;  3JB9 H;  1G3Y A;  4M75 E;  3QYG B;  3L1A A;  3LGA A;  3M54 A;  3CEY A;  3MEU A;  4OB1 B;  3EAE A;  5FU7 C;  2QA4 T;  1CZ5 A;  4ELZ C;  4BDZ A;  2A7Y A;  3QQ8 A;  3MET A;  3OYK A;  1VQ7 T;  4D6W A;  3I56 T;  3JB9 F;  3MP6 A;  3DKM A;  5GAN j;  2HAX A;  3R6O A;  3CCE T;  4L59 A;  5CCX A;  1JRI A;  2VUB A;  5LJ3 g;  1JBM A;  2LVM A;  3OW2 A;  4N0A A;  2QEX T;  2ZPH B;  3CC7 T;  4BI8 B;  2RH2 A;  4C8Q C;  1OYX A;  2FHD A;  5GAN e;  4M7D C;  1PSE A;  5HY6 A;  3ZJT A;  2M9U A;  1XOV A;  3FRN A;  3HU2 A;  3I55 A;  1BI1 A;  2Y90 A;  4C8Q A;  4HT9 A;  1TH7 A;  3WVD B;  4M7D A;  3MHX A;  4QVD A;  3CCS T;  4ATO A;  2E70 A;  2GFU A;  2ZPB B;  2O4X A;  1E32 A;  3MB5 A;  3QJ6 A;  1I9G A;  1S72 A;  4JRI A;  3PIO A;  3CCJ A;  3JRZ A;  5LJ3 f;  1AHJ B;  5GAN 2;  1G5V A;  5A0L A;  3TIW A;  2VC8 A;  3JSC A;  5GMK j;  4M7A G;  1O9S A;  4Q5W A;  2R5A A;  3MCA B;  3OS2 A;  1YIJ T;  3M4G A;  2JOY A;  1JJ2 S;  1YCY A;  3H6Z A;  3HRS A;  3SWN B;  3WVE B;  4OB2 B;  2HD0 A;  1K8A C;  1BIA A;  3M53 A;  4C0F A;  3CC4 T;  5GMK e;  5GAN h;  3V7C A;  3OS1 A;  2A3L A;  4QVZ A;  2PVO B;  1VQO T;  4M7A D;  4YTL A;  2QI2 A;  2RHU A;  3NTH A;  1M90 C;  1BYM A;  4M77 F;  1VUB A;  4LD6 A;  2QA4 A;  5KH6 A;  3S3M A;  2RI5 A;  1Y07 A;  2QXF A;  4M78 D;  3WXM B;  1KQ2 A;  4FT2 A;  5LJ3 d;  1M1K C;  4L5G A;  1VQ7 A;  1YJ9 T;  2DIQ A;  3DLM A;  4FIB A;  4A53 A;  3GLX A;  4DOW A;  3CMA A;  2KMT A;  3CCE A;  5GAO r;  4RV0 A;  2WAC A;  1P92 A;  3CME T;  1VQ9 T;  2R5M A;  3A8M B;  5D6X A;  1G3W A;  4FM4 B;  5GAO m;  4XTU A;  4KDL A;  3G7Z A;  2LCL A;  2M1H A;  2X4Y A;  5CKD A;  4F7U F;  1KHI A;  1YJW T;  4M77 B;  4KUD K;  1CZ4 A;  2D9T A;  2HQX A;  2V8I A;  4QQG A;  4M77 A;  2XG8 D;  3RMQ A;  3E1S A;  3OYG A;  3BFM A;  3LLR A;  2HNI A;  3LX7 A;  4MML A;  4PLL A;  4IUP A;  4HCZ A;  3UPU A;  1EIF A;  1N9S A;  3HPW A;  4XU0 A;  4ARC A;  2YUJ A;  4KOD A;  2DTI A;  2RA2 A;  2KDS A;  4NL2 A;  3LWH A;  4X34 A;  5GMK l;  3JCM P;  2L89 A;  4E47 A;  2QTX A;  5GAN 8;  2GQV A;  3EFS A;  4GLK A;  1BI3 A;  5CQY A;  2P0Q A;  5J3B A;  3GPL A;  3PNW C;  1VQ4 A;  4RG8 A;  3CC4 A;  4F7U B;  4A4K A;  4XU1 A;  3MO8 A;  4M78 F;  4C5I A;  2RD1 A;  4N4I A;  1X6O A;  1XTD A;  2CGH A;  2CS7 A;  3VU3 C;  5FLX E;  2DXB A;  5LJ3 e;  4KLN A;  4KO8 A;  4AQ7 A;  3J80 E;  3CCR T;  2RB6 A;  5GAM j;  2K5L A;  4C0D B;  4OGE A;  4B9W A;  5CQX A;  1QVP A;  5CCA A;  3O8V A;  2Q1D X;  3V8L A;  2LC4 A;  3CBO A;  1YJ9 A;  1VQL T;  1IZ6 A;  2B8A A;  5GAN f;  3A8H B;  3X20 B;  4PJO D;  4ARI A;  4M75 F;  3CME A;  1VQ9 A;  2FVU A;  4F7U E;  2XKO C;  4ELY C;  2Q1C X;  3CPF A;  3OQ5 A;  4XU3 A;  2OAU A;  4M78 B;  3C12 A;  1VIF A;  4XTV A;  4EDU A;  1K73 U;  4BY6 B;  3CBP A;  2QQA A;  3C94 A;  4DOV A;  4JRK A;  3J81 E;  1YJW A;  1KD1 C;  4Y28 E;  3FPR A;  4XU2 A;  4EMH A;  2NLU A;  5HK0 A;  4JJN K;  2DO3 A;  1R8O B;  2E5Q A;  1U8R A;  4PKC C;  2RI3 A;  2DD4 A;  4A4G A;  1N27 A;  3JCM Q;  2LRQ A;  4LDW A;  3PTA A;  4C8Q G;  1Q7Y U;  2LQ8 A;  4M7A E;  2DPP B;  4EPC A;  4RMO A;  5GAN d;  4M7D G;  4N4H A;  3QDR B;  2QQ9 A;  4IUV A;  3X24 B;  3QWZ A;  3V8K A;  4M75 B;  3LH0 A;  5GAM h;  3RES A;  4M78 E;  4M75 A;  3L42 A;  3KBG A;  4ZTJ A;  2EQU A;  2Q1A X;  5C18 A;  2YRV A;  2DJZ A;  3FIF A;  2KVQ G;  4C8Q D;  4A4F A;  5GMK i;  3JCM h;  1VQ5 T;  2JVV A;  3FB9 A;  4HCC A;  1FXX A;  2M16 A;  3VJP A;  1G3S A;  2MM0 A;  3BY7 A;  2RHI A;  2XI9 A;  2X35 A;  3RER A;  3CCR A;  3OSS C;  2DTH A;  3Q1J A;  4BI4 A;  3OBW A;  4CI0 C;  1X75 C;  4PJO F;  3P8D A;  3OW2 S;  1Q86 U;  1N8R C;  1VQL A;  5D6W A;  1M4Z A;  1N9R A;  1QDN A;  2ZPF B;  3OYF A;  4JUV A;  2E65 A;  5GAN 4;  2DEQ A;  1UGS B;  2K3Y A;  3CCQ T;  1QVF A;  2RK1 A;  2WSE E;  4C92 F;  4HA8 A;  3AHU A;  3RKY A;  5DYG A;  3OYD A;  3M5A A;  1NPR A;  1WJQ A;  1M5Q 1;  4N0A C;  5HKC A;  2EQJ A;  2F5K A;  4CRI A;  2MI6 A;  1NJI C;  2EQK A;  2Q18 X;  2DKG A;  1O75 A;  4JDS A;  4DQ2 A;  4UC4 A;  3MEW A;  4J6Y A;  3QBY A;  4E7I A;  3P8H A;  3DB4 A;  4EMK B;  1UGR B;  4J7F A;  4PJO B;  4E7L A;  4TVR A;  3PMI A;  2RHX A;  3GP8 A;  4BE2 A;  2LNV A;  4NOY A;  2QQS A;  4ZN3 A;  3QYH B;  1LNX A;  2G3R A;  2E41 A;  1Q81 U;  2XK0 A;  5GAM g;  4C92 B;  1RL2 A;  3ZEH A;  5GAO q;  5FTL A;  4WF2 A;  3L2W A;  4OMF B;  1YJN T;  3L2U A;  3HU3 A;  2JZ2 A;  1Q82 C;  3JCM g;  1CR5 A;  3JAM E;  5B6C A;  1M1F A;  3RKX A;  3SWN C;  3QZ9 B;  3HHT B;  2GCX A;  4PJO E;  3HSB A;  3V7S A;  3HU1 A;  3NTI A;  4QVC A;  4FSX A;  2PQW A;  4II1 A;  4IKF A;  5FRN A;  3MP8 A;  3SWN A;  2K4Y A;  2JTF A;  4C92 E;  1OI1 A;  5D6Y A;  3GNG A;  5GAM f;  1VQK T;  1MHN A;  4O6J A;  2XU8 A;  3TCJ A;  2JN0 A;  3CXC A;  5GAO n;  3JCM f;  3CCQ A;  3CD6 T;  1IRE B;  1KQS A;  4QQ6 A;  2PVG B;  2RO0 A;  4J83 A;  4QW2 A;  4XTZ A;  4JS5 A;  4MZM A;  5EPP A;  3HRU A;  3I56 A;  2DVE A;  2YHT A;  5J39 A;  2EYQ A;  1WQ7 A;  5KCO A;  2VXF A;  3G4S T;  3QHS A;  5GAO l;  5FU6 C;  2XDB A;  3ZJV A;  3QO3 A;  2K5F A;  3CC2 T;  2EIF A;  3PT9 A;  2VGN A;  5I21 A;  1D3B B;  5FTN A;  2BUD A;  2QEX A;  5CAI A;  3CC7 A;  5FU6 B;  1DJ7 B;  1V29 B;  3C95 A;  4IUQ A;  4M77 C;  3HKS A;  4OGC A;  5GAM d;  3CPW A;  2VGM A;  3KXT A;  2LCC A;  1ZHI A;  1VQ8 T;  2CYZ B;  2V8J A;  3F70 A;  5FRO A;  3JCM d;  3P8B B;  5FTJ A;  2KAF A;  1LOJ A;  1NPP A;  4OB3 B;  2H3J A;  4L6V 5;  1S3S A;  2PUO B;  3G71 T;  2L8D A;  3CCS A;  2WSC E;  3TU4 K;  1OZ2 A;  4AS1 A;  1YIT T;  4OF1 A;  1YJN A;  3N5B B;  2ZCF B;  2YVL A;  4R56 A;  3ZJU A;  2XIC A;  2L5Q A;  1MGQ A;  3L2V A;  2KQW A;  2D6F A;  4ZGD B;  2EJF A;  3OYY A;  1YIJ A;  3FPT A;  2BIV A;  4M7A F;  1ZBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...