2XDPA

Crystal structure of the tudor domain of human jmjd2c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
EKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Tudor Domain of Human Jmjd2C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4C
total genus 18
structure length 119
sequence length 119
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xdpA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2xdpA02
1MHNA 3OYNA 4IUUA 4BE1A 2MWPA 4E7JA 3OYGA 3OYKA 3OYBA 4Q5WA 3OS1A 3KUFA 3L2VA 4L59A 4LD6A 2BKDN 2LTOA 2LVMA 2NLUA 3OQ5A 3META 2XDPA 2L3RA 2EQUA 4QQDA 4C5IA 1OI1A 2QQSA 5IAYA 2F5KA 2LCCA 3SD4A 4PLLA 3LLRA 2RHXA 3Q1JA 5FRNA 4Z02A 3O8VA 3F70A 4QW2A 3PMTA 4OVAA 5IN1A 1KHCA 1H3ZA 2L89A 3S3NA 2RJDA 2JTFA 3BDLA 3UT1A 2RI5A 2MWOA 3OYIA 4IUVA 2RHIA 1SSFA 3E9FA 4BDYA 4IUPA 2K3YA 2GF7A 2M1HA 3PNWC 4NS5A 5D6XA 5KE3A 4E7KA 3OYAA 4E7LA 2WACA 4B9XA 2RI3A 4FL6A 5KH6A 1RI0A 5D6YA 3L2UA 3OMGA 3FEOA 2EQJA 3L42A 2RHZA 3OMCA 3LGFA 2EFIA 2GFAA 4IUTA 1XNIA 3C4SA 4E7HA 4N4IA 3QIIA 4E7IA 5J26A 4CRIA 2YRVA 4BACA 4ZTFA 3L2WA 3MP8A 3MEWA 2M0OA 2RHYA 3M9QA 2HQXA 3MEUA 3MP6A 1WGSA 3H8ZA 3NTIA 4N4HA 3MP1A 4II1A 4BD3A 5J39A 2RO0A 5C0MA 1G5VA 3MO8A 5KE2A 3OYFA 2R5MA 2D9TA 3L2RA 3QJ6A 2M16A 2E5QA 3OYLA 4A4HA 3OYCA 2EKOA 2LRQA 4BE2A 2DIQA 4IUQA 2X4WA 3P8HA 4RG2A 3LYIA 2DIGA 3ZEHA 2CKKA 4C5GA 2IG0A 4B9WA 2JZ2A 3LX7A 5D6WA 4HCZA 2R57A 3LGLA 5KCHA 3OS2A 3MEVA 2G3RA 3ME9A 3OYHA 2B8AA 2PQWA 3L2QA 2X4YA 3EAEA 3FDRA 4PLIA 4EDUA 3OS0A 1N27A 2FHDA 2L8DA 2BUDA 2LDMA 3NTHA 5FROA 5CIUA 4C5EA 4QVZA 3OYEA 3S3OA 1WJRA 3FLGA 3LH0A 2BIVA 4FU6A 3OYMA 4QQ6A 3UWNA 2RJEA 3ASKA 3OYDA 2X4XA 3CEYA 3P8DA 1WJQA 4IKFA 4ZTJA 3PMIA 2R5AA 3OYJA 2X35A 2EQKA 3DB3A 3OY9A 3GOXA 3MEAA 1OYXA 4A4EA 2RJFA 2XK0A 4UC4A 3OB9A 1OZ3A 5KCOA 3E9GA 1OZ2A 4A4FA 2P0KA 4IURA 3S6WA 2QQRA 3NTKA 3FC3A 4BE0A 3QBYA 4C5HA 2O4XB 4PL6A 4A4GA 5C6SA 2DAQA 2RI2A 2EQMA 3QKJA 4X34A 3OA6A 4BDZA 3PFSA 4GY5A 5FRMA 1WJSA 2K3XA 2R58A 2RHUA 4QQGA 3S3MA 2RJCA 2GFUA 3DLMA 2O4XA 2E6NA 3DB4A 5M9OA 3H6ZA 2HQEA 2VYTA 4N4GA
chains in the Genus database with same CATH superfamily
2FG0A 2DA9A 1OPKA 2RMOA 2YLCA 1M1KU 2C06A 1VYUA 4M77C 2LCCA 5HCKA 3M0TA 3Q1JA 4C0FA 3KBGA 1IREB 1K8AU 2ZPHB 5CAIA 4JLIA 2LQNA 2GTJA 3CCUQ 3HU2A 2FL7A 2YUJA 3G71T 1YITA 2MM0A 3CC4T 3J80E 5GLFA 3L42A 4L6V5 5GMKj 3WXMB 1TG0A 1XNIA 4M78D 4RTVA 2M51A 2VUBA 5LJ3f 2B86A 1KK7A 3CPFA 1VQNT 3H0HA 4RTUA 3MP6A 1SKUB 2HSPA 1BU1A 1IZ6A 2RO0A 1B34B 3HFNA 3GBQA 3CCRT 4J9DA 3M4GA 1I0CA 2FPEA 1VQ4A 2MF2A 2RA2A 3CPWP 1RLPC 4XK8E 4ELYC 3JCMW 3OS0A 4PLIA 2ROTA 1BCOA 1UJYA 3X26B 2BIVA 1AHJB 4OP0A 4FW2A 1ZHIA 4RUGA 2Q1CX 1D1CA 2EYXA 3I9QA 2R5AA 1XTDA 3V8KA 3QWXX 1JQQA 4RTWA 4IIOA 4C0GA 1Y96A 3JV3A 3MEAA 4XU3A 1RAEB 2RJFA 2KDSA 4FT2A 1VQOT 2DERA 1G8XA 1YIJT 2E3HA 2QQRA 1ZUYA 4ARIA 3T9NA 4QQGA 1VQ6A 5GAMg 3DB4A 1LCKA 1ZSGA 3BFMA 4GLKA 2P84A 2A7YA 2HCKA 5KYNA 3OYNA 5KYXB 5LJ5f 1ZUUA 1GBQA 3JB9I 4E7JA 5GAN4 3CCLT 2X3XD 1YP5A 5IAYA 2QQSA 2EQIA 4HT9A 3EFRA 3CPWA 1ZSZB 1XJWB 3F70A 3PMTA 2V8IA 5CKFA 2EAYA 4F04B 3N5BB 3A5ZB 4PK4A 2CP2A 2A08A 3WVEB 2KI7A 3A8OB 3RDVA 5HK0A 3CMET 2K5IA 1X69A 4J6WA 4JLGA 1W6XA 4XU1A 3VS1A 4B9XA 4CC7A 2EQJA 1KD1U 3UA7A 3A98A 2YRVA 1K73C 1M2VA 4AFUC 3MP8A 2YUQA 1EIFA 1U5SA 2DL8A 1UG1A 1D1BA 4AMCA 5C0MA 2EW3A 3MO8A 4M75D 5FU6C 2KXCA 4Z89A 4J8OA 4OB1B 3LX7A 1UGSB 1UFFA 4KULA 4LDUA 3EAEA 1Q82R 4C8QF 3NTHA 3CMAQ 2FPDA 4EMHA 3A8HB 3I55A 1UGRB 4C92B 1X43A 1CKAA 1M5Q1 2OX7A 5FW9A 4A4FA 2PVOB 2DXBA 2WSFE 3NTKA 1QVGA 1D0YA 3M0RA 2NYSA 4PL6A 2JTMA 4M7AG 2CDTA 1ZA1B 3LHDA 4PKCC 3HL8A 1VQKQ 3M0SA 2ZPGB 3DLMA 1B34A 2K5LA 5FTLA 5M9OA 4RCCA 1FMVA 3CQTA 3OYGA 4Q5WA 1WXBA 2DXUA 2HZYA 2JMCA 1VQ7A 1YI2A 1R77A 3M53A 1VQMT 1LNXA 2ATCB 2YSQA 2AZVA 1PHTA 5FRNA 3MJXA 2JS0A 2ZPFB 4ELZC 4FSXA 3VS3A 2LX9A 2LW6A 4VUBA 5CKHA 3QC8A 2PU9B 5D6XA 1OU9A 1NE8A 2AHJB 2WACA 4RMOA 2VASA 2RQRA 3KXTA 4NL3A 1VQ9Q 4E7IA 2P0PA 3VS4A 1Q7YU 1BB9A 4PJLA 2LCSA 1QP2A 4LDWA 5KE2A 3I5SA 1NJIU 1WHHA 2E5QA 1OQKA 3EG3A 3CC7A 1NLOC 2CH4A 1LOJA 4LDVA 3LGLA 4FIBA 3MEVA 2QEXA 2VWFA 2G3RA 4PFZA 1GL5A 2CUDA 4DEYA 4EDUA 3HSBA 2BUDA 2GCXA 1WHGA 2V1QA 2RH2A 4DQ2A 3U23A 1ZA2B 1MUZA 2MOXA 4OMPA 2RJEA 2Z0WA 1VQOQ 1MMGA 3OBYA 1Y0MA 1QW1A 4PJOB 1VQPA 1WA7A 4OMMA 3EGXB 2J6KA 2ZAEA 1AEYA 1X6OA 3EFSA 3A8LB 2LT4A 1QVFA 5C1BA 3JCMd 3FC3A 2HL3A 2DMOA 2QGFB 2XHCA 4PJNA 2K3XA 5KYUA 3THKA 2O9SA 1NPPA 2RJCA 2E3IA 1U1TA 1TSFA 4D8KA 4PJOG 3V8JA 1O75A 2LP5A 2EPDA 3CCMT 4IUUA 3TEEA 3V7RA 1EX4A 3L2VA 1PWTA 3H0FA 5GAOp 4DBHA 3CD6T 4J6YA 1WX6A 3QJYA 4FSSA 1KIKA 1H3ZA 1I1JA 3CMAA 3S3NA 2QG9B 1BYMA 2MMPA 5GANh 4M78G 2RB6A 3OYIA 1BI0A 3QQ8A 1H3HA 2NUTB 4FW1A 3CCUT 2DTHA 3PNWC 3CCUA 4A63B 3VRZA 2KMTA 2EYQA 1H641 2DL3A 3QIIA 3TCJA 4BACA 3L2WA 4J5YA 3QO3A 5DLQE 2RK2A 4M7DG 1CZ5A 2YRCA 4N4HA 4DOWA 1YBYA 1UGVA 3JB9G 4BB7A 3EGDB 4M77E 4J7IA 3MB5A 5GANf 2QEXT 4LD9K 4D8DA 2KQWA 3CBMA 4C5GA 2PNIA 1W70A 1YJWQ 3CCJA 1I4K1 2D8JA 1JJ2S 5CCAA 2FYKA 3CCQQ 4OMOA 3E1SA 4C92C 3S3OA 2RN8A 1QDNA 1YCYA 1DJ7B 1RUWA 3ASKA 4J9GA 4MMKA 1VUBA 3A1PA 3P8DA 2KGTA 2OJ2A 4C8QC 1KC8C 1WHMA 2HAXA 4A4EA 4ZGDB 1WZOA 2DILA 4D6WA 2EBPA 5IHNA 1GFDA 3BQBA 1WYXA 3CCST 2LJ1A 1M90C 2EVRA 2QAZA 2AK5A 1BKBA 2DAQA 2ESWA 1TOVA 1YJ9Q 2D1XA 4F7UG 2EGAA 4C92G 3X25B 3HTRA 5AT1B 5GAMj 5LJ5g 1UHCA 2KT8A 3O5ZA 3CD6A 4E47A 1GCQA 3VUZA 3META 5LJ3h 2XKOC 1HYOA 3EGUA 1UDLA 1OV3A 4DEXA 3PGGA 3R6NA 4C8QB 1N8RU 2P0QA 3JCMP 2FRYA 4M78A 4N0AA 1F1BB 1RLQC 1Y7XA 2LC4A 4JRQA 2C0OA 2SRCA 2OAWA 1VQ9T 1VYTA 1NPRA 2P4RA 2DEUA 1NZ9A 2AKKA 1W1FA 2A36A 2SEMA 2P4TA 2OTLA 2A0FB 4E7HA 3C4SA 3EH2A 1VQLT 2I0NA 2EWNA 2DPPB 4LXCA 1WGSA 3H8ZA 3GF5A 4CC2A 1TWBA 1Y57A 3VV0A 3MHXA 3A8MB 3OYFA 2B25A 2DXCA 3VKIA 3BE3A 2M16A 2CP5A 2QK0A 4A4HA 3LYIA 2DIGA 2CKKA 4J9IA 4F7UE 1YIJQ 4R56A 3HRSA 1RADB 4J9HA 4AT1B 2QQBA 4PJJA 1K9MU 1RACB 2V8KA 3REAB 4M7DC 1X2QA 2FPFA 2W10A 1YNZA 2QDLA 3PVLA 4ZTJA 1X01A 1QLYA 4LUEA 3I56Q 1VQNQ 3OY9A 3CCSA 3WVDB 2KVQG 3G6ET 5B6CA 3LWIA 3E9GA 2O01E 2P0KA 3FPRA 2QYZA 3FPTA 2RQWA 3FIFA 4C92D 4PJOD 1VYVA 3CCMQ 5EG2A 2COZA 1MMAA 1RAAB 4JRIA 3MKDA 4R0KA 2JS2A 2Y90A 3OSSC 2BE9B 3TU4K 1M3CA 1VQ6T 1JB0E 1TU0B 3CC7T 2K79A 4M78E 1M30A 1UJ0A 4EIKA 1KQ2A 1WFWA 3SWNC 1QVFS 2RQVA 4M7DE 4HCKA 3GIBA 2EYZA 1G2BA 3X20B 2JNGA 1M3AA 4PLLA 5GAOm 2LQWA 5GAOr 3QZ5B 3CC2T 1MV3A 4PJOC 4Z02A 2MYSA 3UATA 4ORZA 3ULRB 2HD0A 1GRIA 4KH0B 2VB6A 2DLPA 1U8RA 5CCXA 1SSFA 4M75A 3M0QA 3CC4A 3E2UA 1SRLA 3LGAA 3FJ5A 4AFZC 1QP3A 3FEOA 1FXXA 3CCLQ 3RKXA 1M3BA 1JJ2A 1GXIE 5L23A 1LJOA 2JTEA 1TXQA 2D8HA 2EYWA 3G1JA 3H41A 3MP1A 2MK5A 2CUBA 2L3SA 3JCMV 1IGUA 1P92A 5A0LA 3MCAB 1M8VA 2DIQA 4P5NA 4LDYA 3CCJQ 1WQWA 2BZYA 1T0HA 4HKEA 5KYWB 2R57A 4ZNXA 1BIAA 3LH5A 3QPHA 1C1AA 3M55A 3LWHA 1Q82C 2EGEA 1NEBA 2LDMA 3FPUA 4QVZA 1IRXA 4M77F 1VQ5T 2A28A 5GAN6 2GGRA 4C92A 5CQYA 3EG9A 4ANJA 1VQOA 1XQHA 1QKWA 1YITQ 3UPUA 2LQ8A 4MDXA 1QVPA 3UDCA 1KQSS 3TSWA 1W2BS 1VQ4Q 1D0ZA 4IURA 4FYWB 2PZ1A 1YJWA 1OEBA 2RI2A 2XD0A 1OU8A 1KG1A 2R58A 2Y4YA 1JJ2P 2LQKA 4FM4B 3NHNA 1M2VB 4X9CA 2CT3A 2JOYA 5FU7C 2DX1A 1ZC1A 3G4ST 3OS1A 4A53A 2PUKB 4RTTA 1YI2T 1OI1A 1YWOA 3EGXA 3BW1A 3UF4A 1WXUA 1SHGA 5LJ3d 1ACMB 1M27C 5DLOA 1R0BG 4M7AA 5IXBA 4J6XA 4C0DC 2E70A 2QA4T 4M7AC 4EMKA 3OW2P 1CKBA 1W2BP 3E9FA 2CSQA 1Q81C 4AFSC 1T3LA 1QKXA 4E7KA 4C8QD 3JB9D 1X27A 4ESRA 3CC7Q 1YJNA 1CZ4A 3CCQA 1HSQA 1M4ZA 3CCQT 2JJ9A 1S3SA 4OMLA 1K9AA 4ARCA 3NTIA 4EMGA 3MPUB 4J7FA 4BD3A 5J39A 5KYYB 1Q86C 4EPCA 1PG5B 1WHJA 2LJ0A 2DRKA 2OI3A 4IUQA 2X4WA 3GP8A 2IVWA 4WTOB 3EG0A 4C5EA 5CIUA 3QDRB 3HFOA 3HP9A 4X9DA 2FEIA 4C0ZA 3LH0A 4M75C 4FU6A 1IGQA 2KT1A 2KRNA 3I35A 1NG2A 1Q95G 2GQVA 3REBB 4KBMB 1T0JA 1O9SA 2A37A 2EQKA 1ZSZC 2K5FA 2L5QA 2HSEB 4JZ4A 1CSKA 4HVUA 5I22A 5LJ5e 5CK9A 1M1KC 1Q86R 4DA4A 1GCPA 2FB7A 3JCMQ 3CXCP 2K6DA 3HU1A 3EFOB 2EQMA 4LDXA 1BCMA 2VXFA 1VQPQ 2HQEA 2D0NA 3SHWA 1QCOA 4CI0C 4JRKA 1IHWA 2MWPA 4HVVA 1VQ7Q 2BKDN 5ECAA 2NUPA 2J06A 2XDPA 5I2MA 1WQ7A 2F5KA 3SD4A 2ROLA 4JRPA 3GLXA 3QDFA 1QWFA 2F2WA 2L89A 1WNLA 2H3JA 1S72T 2KE9A 2DBMA 5GMKl 4KGXB 1NM7A 2D0QB 2X9HA 1K0XA 3VYHB 2KR3A 1VOMA 3OMGA 4XTZA 3NPFA 1B07A 1VQ9A 2K9GA 5GJWB 4HXJA 1JO8A 4KRTA 5GAMe 3BY7A 5FU7B 2M0OA 1R7RA 3HRTA 4OMNA 2O88A 1YFNA 1I81A 3PIPA 5GAMd 2WSCE 1UECA 5GMKi 1PD0A 3CC2A 4B9WA 2PTKA 2ZGWA 1KQSA 3M0UA 5LJ3g 1VQ7T 1VQMA 1Y07A 3GPLA 2X4JA 1I8FA 2K3BA 4KH1B 3RMQA 5FROA 3JCMg 4RTZA 5EPPA 4EMKB 2Q1DX 1NBEB 5FWCA 2X35A 3BDUA 3DLLA 2KNBB 5GANd 4GBQA 1KFZA 1FYNA 3QG1A 3GNFB 2BZXA 4C8QE 4CC3A 3S6WA 3G71Q 5AYFA 1RAHB 2YUNA 1YJNT 2EIFA 2IPOB 7AT1B 2DRMA 3EHQA 1I5OB 2E65A 1KQ1A 5KYYA 2AIRB 2E6NA 2AT1B 4JZ3A 4WF2A 1MHNA 1E32A 1I07A 1T3SA 5CVIA 3JCMc 4BE1A 4KUIA 3CC2Q 2LVMA 1EFNA 4X1VA 2AKLA 4C5IA 4RCBA 2L3QA 5FTMA 3C0CA 5IN1A 1KQSP 1K73U 3JCMX 1U1SA 4NL2A 4EMKC 2QTXA 2RK1A 1N6AA 3BDLA 3M4YA 2V26A 1VQ6Q 2EJFA 5EC7A 3C94A 1CR5A 4F7UB 4PJMA 2K3YA 4AG2C 1HXDA 4NS5A 3URGA 5CO7A 3RR6A 2C0IA 1YJNQ 4MZPA 1TUDA 2K2VA 2CZ7B 1G83A 1OX9A 2QASA 4E2FB 3KFVA 1AD5A 2YUPA 3GNGA 2GFAA 4IUTA 4Y28E 1VQ8Q 5FTNA 1UHFA 1ZQ1A 1KD1R 6AT1B 2ZCFB 4M7AD 2YLBA 5DM7R 1BI1A 1N8RC 5GANg 5IT9E 2XI9A 2FZGB 3CMEQ 2EKOA 1VQ4T 1K0SA 5D6WA 4HCZA 3CCVA 1U3OA 3G4SQ 1TTHB 3IQLA 2B8AA 3ZL7C 1D1AA 1WJRA 2ENMA 2JN0A 1PD1A 2V1RA 2QA4Q 1VQKA 1BBZA 1WI7A 1VQ5Q 4ZGEB 3VS7A 4M7DB 1O54A 2K2MA 1AT1B 1Q81R 1G3SA 5GAOl 2NUZA 2L3PA 3EG1A 3QKJA 1Q7YR 3JCMh 1WJSA 2RHUA 3S3MA 1YJWT 3E19A 4A54A 1NJIR 1K9MC 5GMKh 1FMKA 1N9SA 3OYMA 2CT4A 1MV0B 4XTUA 2LT1A 2X3WD 1WXTA 2YVLA 3OYBA 1Y96B 4K11A 5EQJB 2LTOA 2LZ6B 5FWBA 4ZN1A 3EFOA 2Q1AX 3CCJT 1H8KA 4RTXA 2E4HA 4F7UA 2E10A 2Q19X 1K8AR 1H92A 5GMKe 1KHCA 2J05A 1YJ9A 3AHUA 4M75B 4IUVA 2DYIA 3CMEA 4BDYA 1MMDA 4QKUA 3OYAA 4E6RA 3CCEQ 4M4ZA 2D6FA 1OPLA 2E1HA 1UGQB 2DKGA 3VUBA 1ABQA 1C6VX 3EG2A 2RD1A 2DM1A 1PC0A 4PJOF 2Q18X 3ZBDA 1AWJA 4OMQA 5FTJA 1N5ZA 1TH7A 5CQXA 4QVCA 3L2RA 1HD3A 2CGHA 1YWPA 5GAN7 2DZ9A 2X51A 4E7SA 3P8BB 3ZEHA 3INZA 1S1NA 3C12A 5IHKA 5HY6A 2JZ2A 5IXFA 4MZMA 2HNIA 4RTYA 4AFQC 2GNCA 1J3TA 2PQWA 3L2QA 4KDLA 2LMJA 5DYGA 3HHTB 1FX7A 4JJCA 1QVGP 5IH2A 2GBQA 4C0DB 1PCXA 4PJOA 3OYDA 1ARKA 2E5KA 1FMWA 1E6GA 1VA7A 1RAGB 2ZPBB 2DETA 3M56A 2YWWA 2QI2A 4XTWA 1MNEA 2F5TX 4RKUE 3VJPA 1Z9QA 4RG8A 3VRYA 5L8RE 2BE7D 4FCYA 1PM3A 1G3YA 1B3QA 2XICA 5C6SA 2DVEA 3H0IA 3TREA 4PNOA 4X34A 3JB9H 4ZN3A 5FRMA 2Y4XA 2RM4A 2DZCA 2O4XA 2DTIA 1SG5A 4L5GA 5LJ5j 1YHQA 2YDLA 4BUGA 2DJZA 1YI2Q 3SB2A 1PNJA 1B7TA 3OQ5A 2EQUA 1SF9A 1UE9A 5GJVB 2RHXA 1UUEA 2DE0X 2EGCA 3JCMb 4OVAA 3RESA 1GBRA 5DY9A 5DYIA 3UT1A 4CQNA 4QVDA 1QCSA 1MGQA 3RUXA 2E6ZA 4IUPA 2M1HA 2DTOA 2ABLA 3DKMA 3X28B 3OMCA 3CCVQ 2DEQA 4KGZB 3EHRA 2E64A 5LJ3e 2F69A 4JDSA 1TS9A 2HKQB 4ME7A 3VS5A 3I56A 1M1KR 3TVTA 5ERGB 3TIWA 3CCEA 2LRQA 3G7ZA 5GAMh 2CYZB 3NFCA 2OTLQ 2J6OA 1V76A 3ME9A 2EJ9A 2HBWA 1V1CA 2DXTA 4BI8B 2X4YA 2KRSA 3OS2A 2FHDA 3I55T 2KK4A 2CZ0B 5GAN3 4QQ6A 2COYA 1Z9ZA 4F14A 1D0XA 3QZ9B 3SDZA 3I55Q 1OYXA 4KO8A 5HK3A 3PTAA 2OTLT 3SWNB 1HJDA 4DOVA 2KXDA 3UA6A 2DO3A 2QEXQ 2DVJA 2F1LA 1ABOA 4FYXB 1LPLA 3QWYA 4TVRA 5A0GA 2CH4W 1TUGB 3CC4Q 3C95A 4M75G 5D7UA 3CXCA 3KUFA 4HT8A 2KAFA 4L59A 1TUCA 4BI4A 3SFMA 1K9MR 3TQ7P 2F2XA 5CCBA 1GFCA 2KBTA 2WSEE 1NEGA 4OGCA 2O9VA 2CREA 4M78B 2L0AA 5CKDA 2PVGB 1N8RR 2FO0A 2RI5A 1C0MA 4M77D 3ER0A 2JT4A 5IHIA 2RQTA 5LJ5d 5GANe 1ZSZA 2KYMA 3R6OA 1YN8A 4XTVA 2RI3A 4Y92A 3NMZC 3J81E 1XOVA 2VXEA 2ED1A 1HK9A 5I21A 4N4IA 4AG1C 1BIBA 1WLFA 4QT7A 1I5LA 4OMFB 3M9QA 2HQXA 1VIEA 4MMLA 1WDXA 2KY9A 4BY6C 3QJ6A 1LVKA 2PWYA 4M7AE 3RKYA 3JB9J 1KHIA 4FYVB 1QWEA 3CD6Q 5KCHA 1UGPB 2LCLA 3FDRA 4ATOA 1N27A 3VS0A 2LNHB 2G6FX 1AWOA 2YHTA 2JXBA 1NJIC 1WJQA 3QHSA 1ZX6A 2H8HA 4OGEA 4HCBA 3GOXA 3L2ZA 1OZ3A 1SPKA 2ED0A 1G3TA 1EZZB 4KDIA 1ZUKA 2E12A 3QXEB 1R0CB 2PVDB 4RV0A 2HQHA 1K8AC 1JXMA 4C92F 3QUIA 4BDZA 2RPNA 4GY5A 2GFUA 1G3WA 5CKEA 2JM9A 4KLNA 2KEAA 2M02A 3OYKA 4PFPA 3I56T 3QWZA 3M5AA 4QQDA 1RI9A 1AWWA 2XU8A 2DFUA 2FZCB 1ZBXA 2VGNA 3NGPA 3CCLA 3RERA 2RQUA 2A3LA 3A8GB 3EH1A 2C0TA 2OTJT 1IB8A 4M78F 4JPBW 1SRMA 4HA8A 2RJDA 2MAMA 4FYYB 2RHIA 2OAUA 1YJ9T 4ZGJB 3M0PA 4NOYA 2V8JA 2VC8A 2J6FA 4E7LA 2AZSA 3CCSQ 2XIDA 1FWZA 2GQIA 2CP3A 1VQLA 3X24B 4CRIA 4BY6B 3CF2A 1U06A 3EGDA 2DL4A 3ZJUA 4II1A 1JU5C 4GLMA 1IXDA 1M1GA 4JS5A 3OBWA 4J83A 4RG2A 1RABB 3CCVT 5I11A 2KYBA 2KRMA 4JS4A 1PRMC 5CD1A 4PJOE 2E41A 3OYHA 2EYYA 4M7DA 8AT1B 1NYGA 2MPXC 2DD5A 4AS1A 2PUOB 5GAN5 4E7ZA 3EG9B 1X2KA 1KSWA 4KODA 1VQKT 4WCIA 2XDDA 3TSZA 1S72A 4A4KA 3HKSA 3CMAT 3PE0A 4M78C 4N0AC 4J9BA 4LNPA 4Y91A 1M90R 1K4US 1VQ8T 4J9EA 2JV2A 4BE0A 2MIOA 3RMSA 1MMNA 4M75E 1NYFA 4F16A 2VV5A 2O2OA 3OA6A 1OULA 4OF1A 5KYXA 1X75C 2O31A 1I9GA 4M7AF 3M54A 3H6ZA 5D6YA 4PFOA 4N4GA 3SWNA 4DBQA 4HCCA 5KYUB 1KD1C 3HU3A 1Q81U 1AVZC 1K76A 1RAFB 3QYHB 1M90U 2QTVA 1KJWA 3VS2A 3V7SA 2I2LA 1RL2A 4Z88A 1A0NB 3RNJA 3JAME 1N9RA 5GAMf 1YITT 3G6EQ 2CZ6B 2RNAA 1Q86U 3CXCS 5FLXE 2HMAA 5KYWA 4O6JA 4O5VA 2EFIA 3CPWS 4HVWA 3M58A 5J26A 5A0DA 2JMAA 4BI3A 4Z8AA 4JJDA 1M2OA 5GANj 2DD4A 2LJ3A 1X6GA 2K4YA 2M9UA 3VS6A 5HKCA 3RBBB 3CCET 3ZFJA 1Y71A 1QMCA 1BI3A 1M8MA 3ZGZA 1VQ5A 3FLGA 3UWNA 2LX7A 5LJ5h 2QGGA 1MNDA 3PMIA 3OYJA 1WPYA 4C8QG 2JW4A 4KUDK 3VU3C 3FB9A 5CR2A 1PKSA 4OB0B 2XK0A 2JM8A 4UC4A 4F17A 2CSIA 5KCOA 1PKTA 3OW2S 1VIFA 2KROA 3QSUA 2K57A 2O4XB 3G71A 9ATCB 2XMFA 2YUOA 1S72Q 2F2VA 3CBOA 4XU0A 1YHQT 2RF0A 3V7CA 3JB9F 4DBFA 1E6HA 3OW2A 2DK3A 2KSSA 1W2BA 1JBMA 1D09B 3ZJTA 4C92E 4DBRA 2DL5A 2BZ8A 4XAXB 3M57A 1NLPC 3JCMe 1W4SA 1Q7YC 1AZEA 3CCRQ 2XDBA 1PSFA 3O8VA 5GMKm 1AZGB 5GAOn 4XQ3A 2CS7A 2JTFA 5CKBA 2BTTA 3LW5E 2QXFA 3JRZA 1SSHA 4IIMA 1IHVA 3RKWA 2GF7A 5KE3A 4C8QA 2NUPB 3J7AF 2W0ZA 3FJPA 5KH6A 1RI0A 1IO6A 3L2UA 4FT4A 4YTLA 5LL6S 1YIJA 3ZJVA 1QQJA 3PT9A 1M1FA 1X6BA 5FU6B 2QQ9A 3MEWA 2RHYA 2JVVA 1UB4A 4M75F 3L1AA 2PJHB 2HEQA 1QCNA 4M7DF 4XTXA 3OYLA 2J7IA 3RIRA 3OYCA 1YHQQ 3P8HA 3V8LA 2IG0A 1PSEA 2OTJA 4JJNK 3JCMf 2CZ1B 3PVQA 4LUDA 4MDWA 1GCQC 4LN2A 1K73R 1VQLQ 1UTIA 1QVFP 1PRLC 2DBKA 3CBPA 8ATCB 3D7SB 2FVUA 4J9CA 1M9SA 2HBPA 4AQ7A 2K7AA 1OX8A 2IIMA 4XU2A 3AT1B 2MM2A 4CC4B 4KT0E 2QDYB 3JSCA 4B6MA 5GAN2 3VYGA 2OTJQ 3QBYA 4C5HA 1Q82U 5FTKA 1JRIA 4M7DD 1YCSB 2HL5C 4XTYA 4JUVA 5A2QE 1ZBJA 1V29B 2DJQA 3CCRA 1OOTA 1WHLA 4MZTA 2DYBA 1WLPB 3OSVA 2VYTA 1SHFA 4F7UF 1AWXA 2VKNA 2ECZA 2YXYA 2JUFA 3PIOA 4LD6A 2NLUA 2ZZDA 1QCFA 2L3RA 1RAIB 2FZKB 2NWMA 2HKNA 3SEMA 1WIEA 5LJ3j 1D3BA 3LLRA 4LE9A 1JXOA 4QW2A 2QA4A 1KC8R 3FRNA 3I5RA 2NUTA 4M7AB 3G6EA 2MWOA 2M0YA 2ZPIB 2CP6A 2DF6A 2CP7A 2XG8D 1AOJA 1D3BB 4FL6A 2EJGA 2MI6A 3JCMJ 2RHZA 1ZLMA 3LGFA 2DNUA 2HDAA 4ZTFA 1E7OA 1KC8U 3MEUA 5GAN8 4OB2B 5J3BA 2QQAA 3HRUA 1VQNA 1G5VA 2R5MA 2D9TA 4M77A 2YT6A 1R8OB 2DL7A 2YRDA 1K1ZA 1JEGA 2COWA 4BE2A 3QQ7A 4KGVB 3G4SA 2CP0A 4V2SA 2MCNA 3OYYA 1QVGS 3M59A 5GAOq 2L8DA 3OYEA 1VQPT 4OB3B 2X4XA 2EKHA 2FRWA 3CEYA 4IKFA 3HPWA 1BK2A 2VVKA 3DB3A 1BI2A 2GTOA 4M77G 3OB9A 1OZ2A 1UEBA 2ZPEB 3H9NA 4M77B 2L2PA 2H3EB 4A4GA 1VQ8A 4R55A 1SEMA 3OS5A 3PFSA 1VQMQ 2LNVA 3CCMA 1WHKA 5I2SA 2VGMA 3QYGB 4JJBA 4J9FA 5C18A
chains in the Genus database with same CATH topology
1MHNA 1E32A 5CVIA 2YLCA 3JCMc 4BE1A 1M1KU 2C06A 4KUIA 4KLNA 3CD6A 3OYKA 3I56T 3QWZA 4M77C 4E47A 2LVMA 3M5AA 4QQDA 3META 5LJ3h 3VUZA 4C5IA 4RCBA 2LCCA 2XKOC 2XU8A 1ZBXA 2VGNA 3CCLA 5FTMA 3RERA 3Q1JA 4C0FA 3PGGA 2A3LA 3A8GB 3KBGA 4C8QB 5IN1A 1N8RU 2OTJT 2P0QA 4M78F 1K73U 3JCMX 1U1SA 4NL2A 4EMKC 2QTXA 4HA8A 2RK1A 1IREB 2RJDA 1N6AA 3BDLA 2ZPHB 2MAMA 3M4YA 5CAIA 4M78A 4N0AA 1K8AU 2EJFA 4JLIA 3C94A 2RHIA 1Y7XA 2LC4A 2OAUA 4JRQA 1YJ9T 1CR5A 4F7UB 4ZGJB 2K3YA 3HU2A 2FL7A 1VQ9T 1HXDA 1NPRA 4NOYA 4NS5A 3URGA 5CO7A 2V8JA 2VC8A 4E7LA 4MZPA 3G71T 2YUJA 1NZ9A 1YITA 2MM0A 2XIDA 2K2VA 3CC4T 3J80E 5GLFA 1FWZA 2CZ7B 3L42A 4L6V5 2P4TA 5GMKj 3WXMB 1VQLA 3GNGA 2GFAA 4IUTA 1XNIA 3C4SA 4Y28E 4E7HA 2OTLA 3X24B 1VQLT 5FTNA 4M78D 1ZQ1A 4CRIA 2VUBA 5LJ3f 4BY6B 3CF2A 2ZCFB 3CPFA 2EWNA 1VQNT 2DPPB 4M7AD 3MP6A 1WGSA 3H8ZA 3GF5A 2YLBA 5DM7R 1BI1A 3ZJUA 3VV0A 1N8RC 4II1A 3MHXA 1IZ6A 2RO0A 5GANg 3A8MB 5IT9E 1B34B 3OYFA 3HFNA 2B25A 3CCRT 2DXCA 3VKIA 2XI9A 2M16A 1M1GA 4JS5A 4A4HA 3OBWA 2EKOA 3M4GA 4J83A 4RG2A 1VQ4A 3LYIA 2DIGA 3CCVT 2CKKA 2MF2A 2RA2A 4F7UE 1VQ4T 5D6WA 4HCZA 3CCVA 4JS4A 4R56A 3HRSA 5CD1A 4XK8E 2QQBA 4PJOE 2E41A 3OYHA 4ELYC 3JCMW 2B8AA 4M7DA 1K9MU 3OS0A 4PLIA 2V8KA 2DD5A 4AS1A 1WJRA 2JN0A 2PUOB 3X26B 2BIVA 4M7DC 1AHJB 5GAN5 1VQKA 4OP0A 1ZHIA 4ZGEB 2Q1CX 4KODA 1VQKT 2XDDA 4ZTJA 2R5AA 1X01A 1S72A 1XTDA 4A4KA 3V8KA 3HKSA 3CMAT 4M7DB 1O54A 4M78C 4N0AC 4C0GA 1Y96A 1G3SA 3MEAA 4XU3A 3WVDB 2KVQG 3OY9A 2RJFA 5GAOl 2KDSA 3G6ET 5B6CA 4FT2A 4Y91A 3LWIA 3E9GA 1VQOT 1VQ8T 2O01E 2JV2A 2P0KA 3FPRA 1YIJT 2QQRA 4BE0A 3FPTA 4ARIA 3FIFA 3RMSA 4C92D 4M75E 4PJOD 3QKJA 2VV5A 5EG2A 3JCMh 3OA6A 4JRIA 1WJSA 3T9NA 2RHUA 4OF1A 1X75C 4QQGA 3S3MA 1YJWT 3E19A 1VQ6A 2Y90A 3OSSC 5GAMg 4A54A 3TU4K 1K9MC 5GMKh 4DQ2A 4M7AF 1N9SA 1VQ6T 3DB4A 1I9GA 1JB0E 3CC7T 3BFMA 3M54A 3H6ZA 5D6YA 3OYMA 4GLKA 4M78E 4N4GA 3SWNA 2A7YA 4HCCA 3OYNA 4XTUA 2LT1A 5LJ5f 1KQ2A 1KD1C 3HU3A 3JB9I 3CCSA 1Q81U 4E7JA 2YVLA 3SWNC 3OYBA 1QVFS 5GAN4 1Y96B 3CCLT 5EQJB 2LTOA 4M7DE 3QYHB 1M90U 5IAYA 3GIBA 4ZN1A 2QQSA 2JNGA 3X20B 2Q1AX 4PLLA 3CCJT 5GAOm 4F7UA 5GAOr 4HT9A 3QZ5B 3V7SA 2E10A 2I2LA 3EFRA 3CPWA 3CC2T 4Z02A 4PJOC 2Q19X 3F70A 3PMTA 5GMKe 1RL2A 2V8IA 1KHCA 5CKFA 2EAYA 1YJ9A 2HD0A 3AHUA 3N5BB 3A5ZB 3JAME 3WVEB 4M75B 1U8RA 5CCXA 4IUVA 3A8OB 1SSFA 1N9RA 4M75A 5GAMf 3CMEA 1YITT 2CZ6B 3CC4A 4BDYA 1Q86U 5HK0A 3CMET 3CXCS 2K5IA 5FLXE 4J6WA 4JLGA 4XU1A 3OYAA 3LGAA 4B9XA 4O6JA 1QP3A 2D6FA 3FEOA 2E1HA 1FXXA 2EQJA 4O5VA 1UGQB 1KD1U 3RKXA 2DKGA 2EFIA 3CPWS 3VUBA 1JJ2A 3M58A 5J26A 2YRVA 5A0DA 1K73C 2RD1A 3MP8A 4BI3A 1GXIE 1EIFA 4PJOF 1LJOA 2Q18X 3ZBDA 3MP1A 5FTJA 5C0MA 1TH7A 5CQXA 3MO8A 4M75D 5FU6C 2DD4A 3JCMV 4QVCA 3L2RA 5GANj 2CGHA 1P92A 5A0LA 5GAN7 3MCAB 2DZ9A 2K4YA 1M8VA 3P8BB 2DIQA 2M9UA 3INZA 4P5NA 4J8OA 3ZEHA 4LDYA 3C12A 1WQWA 5HY6A 2JZ2A 3LX7A 4HKEA 4OB1B 1UGSB 2R57A 4MZMA 5HKCA 1BIAA 2HNIA 4KULA 3CCET 3QPHA 3ZFJA 2PQWA 3L2QA 1Y71A 4KDLA 4LDUA 5DYGA 3M55A 3EAEA 3LWHA 3HHTB 4C8QF 1Q82C 3NTHA 2LDMA 3FPUA 1FX7A 1BI3A 4QVZA 3ZGZA 1VQ5A 3FLGA 4C0DB 4M77F 3UWNA 1VQ5T 4PJOA 3OYDA 5LJ5h 4EMHA 3A8HB 5GAN6 4C92A 3I55A 3PMIA 5CQYA 3OYJA 1WPYA 4C8QG 1VQOA 1XQHA 4KUDK 3VU3C 2ZPBB 3FB9A 5CR2A 1UGRB 4C92B 3M56A 2QI2A 1M5Q1 4OB0B 4XTWA 2XK0A 3UPUA 2LQ8A 4UC4A 2F5TX 4MDXA 1QVPA 4RKUE 5KCOA 3UDCA 4A4FA 2PVOB 3VJPA 3OW2S 1KQSS 1VIFA 2DXBA 4RG8A 1W2BS 2WSFE 4IURA 3NTKA 5L8RE 1QVGA 1G3YA 3QSUA 2K57A 1YJWA 2O4XB 4PL6A 2JTMA 3G71A 2XICA 5C6SA 2DVEA 4M7AG 3TREA 2RI2A 4PNOA 2XD0A 3LHDA 4PKCC 3HL8A 4X34A 1KG1A 3JB9H 4ZN3A 5FRMA 2Y4XA 2R58A 2RM4A 2Y4YA 2LQKA 4FM4B 2ZPGB 3DLMA 1B34A 2DZCA 2K5LA 2DTIA 2O4XA 5FTLA 4X9CA 5M9OA 4RCCA 3CBOA 4XU0A 4L5GA 1YHQT 5LJ5j 3V7CA 3JB9F 1YHQA 2JOYA 5FU7C 1ZC1A 3OYGA 4BUGA 3G4ST 2DJZA 3OW2A 4Q5WA 3OS1A 4A53A 2DK3A 2KSSA 1W2BA 1JBMA 2PUKB 2DXUA 3ZJTA 3SB2A 1YI2T 3OQ5A 4C92E 2EQUA 1VQ7A 1OI1A 4XAXB 3M57A 1YI2A 3M53A 3JCMe 1VQMT 1LNXA 3BW1A 1W4SA 2RHXA 1Q7YC 5FRNA 5LJ3d 2XDBA 1PSFA 3O8VA 2ZPFB 4OVAA 4ELZC 5GMKm 5DLOA 3JCMb 4M7AA 5GAOn 3RESA 4XQ3A 5DY9A 4FSXA 5DYIA 2CS7A 2JTFA 4J6XA 5CKBA 3UT1A 4C0DC 4QVDA 4CQNA 1QCSA 3LW5E 2E70A 2LX9A 2QXFA 3JRZA 2QA4T 1MGQA 4M7AC 2LW6A 4EMKA 4VUBA 3RUXA 2E6ZA 3RKWA 3E9FA 4IUPA 1Q81C 5CKHA 2GF7A 3QC8A 2PU9B 2M1HA 5D6XA 2DTOA 1NE8A 5KE3A 4E7KA 4C8QD 2AHJB 4C8QA 2WACA 4RMOA 3J7AF 3JB9D 3FJPA 5KH6A 1RI0A 3L2UA 1YJNA 4FT4A 4YTLA 1CZ4A 3DKMA 3X28B 3OMCA 5LL6S 3KXTA 2DEQA 3CCQA 1YIJA 3ZJVA 4NL3A 1M4ZA 3PT9A 1M1FA 3CCQT 4E7IA 1S3SA 2E64A 2P0PA 5FU6B 5LJ3e 2F69A 2QQ9A 3MEWA 4JDSA 4ARCA 2RHYA 2JVVA 1UB4A 3NTIA 4EMGA 1Q7YU 4ME7A 4M75F 3L1AA 2PJHB 4J7FA 4BD3A 1QP2A 5J39A 3I56A 4LDWA 5KE2A 1Q86C 1NJIU 5ERGB 4EPCA 4M7DF 4XTXA 3OYLA 2E5QA 3TIWA 3RIRA 3OYCA 3CCEA 2LRQA 3CC7A 3G7ZA 4IUQA 2X4WA 3P8HA 5GAMh 3V8LA 2IVWA 2CYZB 3GP8A 1LOJA 2IG0A 3NFCA 4LDVA 1PSEA 2OTJA 3LGLA 4JJNK 4FIBA 3JCMf 3MEVA 2CZ1B 2QEXA 2G3RA 3ME9A 2EJ9A 4MDWA 2DXTA 4BI8B 2X4YA 4EDUA 3HSBA 3OS2A 2FHDA 2BUDA 4C5EA 3I55T 2GCXA 2KK4A 3QDRB 5CIUA 3CBPA 2CZ0B 2RH2A 3HFOA 3HP9A 4X9DA 3LH0A 4M75C 4FU6A 4C0ZA 5GAN3 4QQ6A 2RJEA 2FVUA 1M9SA 2HBPA 4AQ7A 2GQVA 4XU2A 3OBYA 1O9SA 4KBMB 1QW1A 2EQKA 3QZ9B 4PJOB 1VQPA 2K5FA 3SDZA 2L5QA 2MM2A 1OYXA 5LJ5e 4KO8A 5CK9A 1M1KC 4KT0E 1X6OA 4DA4A 3EFSA 3A8LB 2LT4A 1QVFA 5C1BA 2QDYB 5HK3A 3JSCA 3PTAA 3SWNB 2OTLT 3JCMd 2FB7A 3FC3A 4DOVA 3JCMQ 5GAN2 3VYGA 5FTKA 3QBYA 4C5HA 1Q82U 3HU1A 2DO3A 1JRIA 4M7DD 2XHCA 4XTYA 2EQMA 4JUVA 4LDXA 5A2QE 1V29B 4TVRA 2K3XA 3CCRA 5A0GA 1NPPA 2RJCA 2VXFA 1U1TA 4MZTA 4PJOG 2HQEA 3V8JA 3OSVA 2VYTA 1O75A 3CCMT 4F7UF 3C95A 4CI0C 4IUUA 4JRKA 3TEEA 4M75G 2MWPA 3V7RA 2JUFA 3CXCA 3KUFA 3L2VA 2KAFA 4L59A 3PIOA 4HT8A 4LD6A 2BKDN 2NLUA 2ZZDA 4BI4A 3SFMA 5GAOp 2XDPA 2L3RA 5I2MA 5CCBA 1WQ7A 2F5KA 2WSEE 3CD6T 3SD4A 4J6YA 5LJ3j 4OGCA 4M78B 1D3BA 3LLRA 4JRPA 3GLXA 3QJYA 4QW2A 2QA4A 3FRNA 5CKDA 1H3ZA 2L89A 2PVGB 3CMAA 3S3NA 1BYMA 2MMPA 1WNLA 4M7AB 5GANh 2H3JA 2RI5A 2MWOA 4M78G 3G6EA 2RB6A 1S72T 3OYIA 2ZPIB 1BI0A 4M77D 3QQ8A 3ER0A 5GMKl 3CCUT 5LJ5d 5GANe 2DTHA 3PNWC 3CCUA 2XG8D 2D0QB 3R6OA 4XTVA 2RI3A 4FL6A 1D3BB 3VYHB 3J81E 3OMGA 4XTZA 1XOVA 2VXEA 2EJGA 2EYQA 2KMTA 2MI6A 3JCMJ 2RHZA 1VQ9A 1H641 1HK9A 3LGFA 5I21A 5GAMe 4N4IA 3QIIA 3TCJA 1BIBA 4BACA 4ZTFA 1WLFA 3L2WA 1I5LA 3BY7A 3QO3A 4J5YA 5DLQE 2M0OA 4OMFB 2RK2A 5FU7B 3M9QA 2HQXA 1VIEA 3HRTA 3MEUA 4MMLA 5GAN8 4OB2B 1KC8U 4M7DG 1CZ5A 4N4HA 2KY9A 4DOWA 1YBYA 5J3BA 3JB9G 2QQAA 3HRUA 1VQNA 1G5VA 1I81A 4BY6C 2R5MA 2D9TA 4M77A 4BB7A 5GAMd 2WSCE 3QJ6A 3PIPA 4M77E 1R8OB 4J7IA 2PWYA 5GANf 3MB5A 2QEXT 4LD9K 3RKYA 4M7AE 3JB9J 1KHIA 4BE2A 2KQWA 3CBMA 3QQ7A 5GMKi 4C5GA 3G4SA 3CC2A 4B9WA 2ZGWA 5KCHA 1KQSA 3CCJA 1I4K1 1UGPB 1JJ2S 5LJ3g 4V2SA 5CCAA 3OYYA 1VQ7T 1QVGS 3M59A 2LCLA 3JCMP 2FYKA 3FDRA 5GAOq 1VQMA 4ATOA 1N27A 1Y07A 2X4JA 1I8FA 2L8DA 3E1SA 3RMQA 5FROA 3OYEA 3GPLA 4C92C 3S3OA 1VQPT 2YHTA 1QDNA 3JCMg 1YCYA 4OB3B 5EPPA 1DJ7B 3ASKA 2X4XA 1VUBA 3CEYA 4MMKA 4EMKB 3P8DA 1NJIC 1WJQA 3QHSA 4IKFA 2Q1DX 3HPWA 2X35A 4C8QC 1KC8C 4OGEA 4HCBA 3BDUA 3DLLA 3DB3A 1BI2A 3GOXA 2HAXA 5GANd 3L2ZA 4A4EA 4M77G 4ZGDB 3OB9A 1OZ3A 4D6WA 1OZ2A 1UEBA 2ZPEB 3QG1A 1G3TA 3GNFB 3BQBA 4C8QE 4KDIA 4M77B 3S6WA 3CCST 2E12A 3QXEB 5AYFA 1YJNT 1M90C 2EIFA 2PVDB 4RV0A 4A4GA 1BKBA 1K8AC 2DAQA 1VQ8A 1R7RA 4C92F 4R55A 3QUIA 3OS5A 4BDZA 3PFSA 4GY5A 2LNVA 4F7UG 3CCMA 4C92G 2E65A 2GFUA 3X25B 1G3WA 1KQ1A 5I2SA 5GAMj 2E6NA 2VGMA 3QYGB 5LJ5g 5CKEA 4WF2A 5C18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHN A;  3OYN A;  4IUU A;  4BE1 A;  2MWP A;  4E7J A;  3OYG A;  3OYK A;  3OYB A;  4Q5W A;  3OS1 A;  3KUF A;  3L2V A;  4L59 A;  4LD6 A;  2BKD N;  2LTO A;  2LVM A;  2NLU A;  3OQ5 A;  3MET A;  2XDP A;  2L3R A;  2EQU A;  4QQD A;  4C5I A;  1OI1 A;  2QQS A;  5IAY A;  2F5K A;  2LCC A;  3SD4 A;  4PLL A;  3LLR A;  2RHX A;  3Q1J A;  5FRN A;  4Z02 A;  3O8V A;  3F70 A;  4QW2 A;  3PMT A;  4OVA A;  5IN1 A;  1KHC A;  1H3Z A;  2L89 A;  3S3N A;  2RJD A;  2JTF A;  3BDL A;  3UT1 A;  2RI5 A;  2MWO A;  3OYI A;  4IUV A;  2RHI A;  1SSF A;  3E9F A;  4BDY A;  4IUP A;  2K3Y A;  2GF7 A;  2M1H A;  3PNW C;  4NS5 A;  5D6X A;  5KE3 A;  4E7K A;  3OYA A;  4E7L A;  2WAC A;  4B9X A;  2RI3 A;  4FL6 A;  5KH6 A;  1RI0 A;  5D6Y A;  3L2U A;  3OMG A;  3FEO A;  2EQJ A;  3L42 A;  2RHZ A;  3OMC A;  3LGF A;  2EFI A;  2GFA A;  4IUT A;  1XNI A;  3C4S A;  4E7H A;  4N4I A;  3QII A;  4E7I A;  5J26 A;  4CRI A;  2YRV A;  4BAC A;  4ZTF A;  3L2W A;  3MP8 A;  3MEW A;  2M0O A;  2RHY A;  3M9Q A;  2HQX A;  3MEU A;  3MP6 A;  1WGS A;  3H8Z A;  3NTI A;  4N4H A;  3MP1 A;  4II1 A;  4BD3 A;  5J39 A;  2RO0 A;  5C0M A;  1G5V A;  3MO8 A;  5KE2 A;  3OYF A;  2R5M A;  2D9T A;  3L2R A;  3QJ6 A;  2M16 A;  2E5Q A;  3OYL A;  4A4H A;  3OYC A;  2EKO A;  2LRQ A;  4BE2 A;  2DIQ A;  4IUQ A;  2X4W A;  3P8H A;  4RG2 A;  3LYI A;  2DIG A;  3ZEH A;  2CKK A;  4C5G A;  2IG0 A;  4B9W A;  2JZ2 A;  3LX7 A;  5D6W A;  4HCZ A;  2R57 A;  3LGL A;  5KCH A;  3OS2 A;  3MEV A;  2G3R A;  3ME9 A;  3OYH A;  2B8A A;  2PQW A;  3L2Q A;  2X4Y A;  3EAE A;  3FDR A;  4PLI A;  4EDU A;  3OS0 A;  1N27 A;  2FHD A;  2L8D A;  2BUD A;  2LDM A;  3NTH A;  5FRO A;  5CIU A;  4C5E A;  4QVZ A;  3OYE A;  3S3O A;  1WJR A;  3FLG A;  3LH0 A;  2BIV A;  4FU6 A;  3OYM A;  4QQ6 A;  3UWN A;  2RJE A;  3ASK A;  3OYD A;  2X4X A;  3CEY A;  3P8D A;  1WJQ A;  4IKF A;  4ZTJ A;  3PMI A;  2R5A A;  3OYJ A;  2X35 A;  2EQK A;  3DB3 A;  3OY9 A;  3GOX A;  3MEA A;  1OYX A;  4A4E A;  2RJF A;  2XK0 A;  4UC4 A;  3OB9 A;  1OZ3 A;  5KCO A;  3E9G A;  1OZ2 A;  4A4F A;  2P0K A;  4IUR A;  3S6W A;  2QQR A;  3NTK A;  3FC3 A;  4BE0 A;  3QBY A;  4C5H A;  2O4X B;  4PL6 A;  4A4G A;  5C6S A;  2DAQ A;  2RI2 A;  2EQM A;  3QKJ A;  4X34 A;  3OA6 A;  4BDZ A;  3PFS A;  4GY5 A;  5FRM A;  1WJS A;  2K3X A;  2R58 A;  2RHU A;  4QQG A;  3S3M A;  2RJC A;  2GFU A;  3DLM A;  2O4X A;  2E6N A;  3DB4 A;  5M9O A;  3H6Z A;  2HQE A;  2VYT A;  4N4G A; 
#chains in the Genus database with same CATH topology
 2FG0 A;  2DA9 A;  1OPK A;  2RMO A;  2YLC A;  1M1K U;  2C06 A;  1VYU A;  4M77 C;  2LCC A;  5HCK A;  3M0T A;  3Q1J A;  4C0F A;  3KBG A;  1IRE B;  1K8A U;  2ZPH B;  5CAI A;  4JLI A;  2LQN A;  2GTJ A;  3CCU Q;  3HU2 A;  2FL7 A;  2YUJ A;  3G71 T;  1YIT A;  2MM0 A;  3CC4 T;  3J80 E;  5GLF A;  3L42 A;  4L6V 5;  5GMK j;  3WXM B;  1TG0 A;  1XNI A;  4M78 D;  4RTV A;  2M51 A;  2VUB A;  5LJ3 f;  2B86 A;  1KK7 A;  3CPF A;  1VQN T;  3H0H A;  4RTU A;  3MP6 A;  1SKU B;  2HSP A;  1BU1 A;  1IZ6 A;  2RO0 A;  1B34 B;  3HFN A;  3GBQ A;  3CCR T;  4J9D A;  3M4G A;  1I0C A;  2FPE A;  1VQ4 A;  2MF2 A;  2RA2 A;  3CPW P;  1RLP C;  4XK8 E;  4ELY C;  3JCM W;  3OS0 A;  4PLI A;  2ROT A;  1BCO A;  1UJY A;  3X26 B;  2BIV A;  1AHJ B;  4OP0 A;  4FW2 A;  1ZHI A;  4RUG A;  2Q1C X;  1D1C A;  2EYX A;  3I9Q A;  2R5A A;  1XTD A;  3V8K A;  3QWX X;  1JQQ A;  4RTW A;  4IIO A;  4C0G A;  1Y96 A;  3JV3 A;  3MEA A;  4XU3 A;  1RAE B;  2RJF A;  2KDS A;  4FT2 A;  1VQO T;  2DER A;  1G8X A;  1YIJ T;  2E3H A;  2QQR A;  1ZUY A;  4ARI A;  3T9N A;  4QQG A;  1VQ6 A;  5GAM g;  3DB4 A;  1LCK A;  1ZSG A;  3BFM A;  4GLK A;  2P84 A;  2A7Y A;  2HCK A;  5KYN A;  3OYN A;  5KYX B;  5LJ5 f;  1ZUU A;  1GBQ A;  3JB9 I;  4E7J A;  5GAN 4;  3CCL T;  2X3X D;  1YP5 A;  5IAY A;  2QQS A;  2EQI A;  4HT9 A;  3EFR A;  3CPW A;  1ZSZ B;  1XJW B;  3F70 A;  3PMT A;  2V8I A;  5CKF A;  2EAY A;  4F04 B;  3N5B B;  3A5Z B;  4PK4 A;  2CP2 A;  2A08 A;  3WVE B;  2KI7 A;  3A8O B;  3RDV A;  5HK0 A;  3CME T;  2K5I A;  1X69 A;  4J6W A;  4JLG A;  1W6X A;  4XU1 A;  3VS1 A;  4B9X A;  4CC7 A;  2EQJ A;  1KD1 U;  3UA7 A;  3A98 A;  2YRV A;  1K73 C;  1M2V A;  4AFU C;  3MP8 A;  2YUQ A;  1EIF A;  1U5S A;  2DL8 A;  1UG1 A;  1D1B A;  4AMC A;  5C0M A;  2EW3 A;  3MO8 A;  4M75 D;  5FU6 C;  2KXC A;  4Z89 A;  4J8O A;  4OB1 B;  3LX7 A;  1UGS B;  1UFF A;  4KUL A;  4LDU A;  3EAE A;  1Q82 R;  4C8Q F;  3NTH A;  3CMA Q;  2FPD A;  4EMH A;  3A8H B;  3I55 A;  1UGR B;  4C92 B;  1X43 A;  1CKA A;  1M5Q 1;  2OX7 A;  5FW9 A;  4A4F A;  2PVO B;  2DXB A;  2WSF E;  3NTK A;  1QVG A;  1D0Y A;  3M0R A;  2NYS A;  4PL6 A;  2JTM A;  4M7A G;  2CDT A;  1ZA1 B;  3LHD A;  4PKC C;  3HL8 A;  1VQK Q;  3M0S A;  2ZPG B;  3DLM A;  1B34 A;  2K5L A;  5FTL A;  5M9O A;  4RCC A;  1FMV A;  3CQT A;  3OYG A;  4Q5W A;  1WXB A;  2DXU A;  2HZY A;  2JMC A;  1VQ7 A;  1YI2 A;  1R77 A;  3M53 A;  1VQM T;  1LNX A;  2ATC B;  2YSQ A;  2AZV A;  1PHT A;  5FRN A;  3MJX A;  2JS0 A;  2ZPF B;  4ELZ C;  4FSX A;  3VS3 A;  2LX9 A;  2LW6 A;  4VUB A;  5CKH A;  3QC8 A;  2PU9 B;  5D6X A;  1OU9 A;  1NE8 A;  2AHJ B;  2WAC A;  4RMO A;  2VAS A;  2RQR A;  3KXT A;  4NL3 A;  1VQ9 Q;  4E7I A;  2P0P A;  3VS4 A;  1Q7Y U;  1BB9 A;  4PJL A;  2LCS A;  1QP2 A;  4LDW A;  5KE2 A;  3I5S A;  1NJI U;  1WHH A;  2E5Q A;  1OQK A;  3EG3 A;  3CC7 A;  1NLO C;  2CH4 A;  1LOJ A;  4LDV A;  3LGL A;  4FIB A;  3MEV A;  2QEX A;  2VWF A;  2G3R A;  4PFZ A;  1GL5 A;  2CUD A;  4DEY A;  4EDU A;  3HSB A;  2BUD A;  2GCX A;  1WHG A;  2V1Q A;  2RH2 A;  4DQ2 A;  3U23 A;  1ZA2 B;  1MUZ A;  2MOX A;  4OMP A;  2RJE A;  2Z0W A;  1VQO Q;  1MMG A;  3OBY A;  1Y0M A;  1QW1 A;  4PJO B;  1VQP A;  1WA7 A;  4OMM A;  3EGX B;  2J6K A;  2ZAE A;  1AEY A;  1X6O A;  3EFS A;  3A8L B;  2LT4 A;  1QVF A;  5C1B A;  3JCM d;  3FC3 A;  2HL3 A;  2DMO A;  2QGF B;  2XHC A;  4PJN A;  2K3X A;  5KYU A;  3THK A;  2O9S A;  1NPP A;  2RJC A;  2E3I A;  1U1T A;  1TSF A;  4D8K A;  4PJO G;  3V8J A;  1O75 A;  2LP5 A;  2EPD A;  3CCM T;  4IUU A;  3TEE A;  3V7R A;  1EX4 A;  3L2V A;  1PWT A;  3H0F A;  5GAO p;  4DBH A;  3CD6 T;  4J6Y A;  1WX6 A;  3QJY A;  4FSS A;  1KIK A;  1H3Z A;  1I1J A;  3CMA A;  3S3N A;  2QG9 B;  1BYM A;  2MMP A;  5GAN h;  4M78 G;  2RB6 A;  3OYI A;  1BI0 A;  3QQ8 A;  1H3H A;  2NUT B;  4FW1 A;  3CCU T;  2DTH A;  3PNW C;  3CCU A;  4A63 B;  3VRZ A;  2KMT A;  2EYQ A;  1H64 1;  2DL3 A;  3QII A;  3TCJ A;  4BAC A;  3L2W A;  4J5Y A;  3QO3 A;  5DLQ E;  2RK2 A;  4M7D G;  1CZ5 A;  2YRC A;  4N4H A;  4DOW A;  1YBY A;  1UGV A;  3JB9 G;  4BB7 A;  3EGD B;  4M77 E;  4J7I A;  3MB5 A;  5GAN f;  2QEX T;  4LD9 K;  4D8D A;  2KQW A;  3CBM A;  4C5G A;  2PNI A;  1W70 A;  1YJW Q;  3CCJ A;  1I4K 1;  2D8J A;  1JJ2 S;  5CCA A;  2FYK A;  3CCQ Q;  4OMO A;  3E1S A;  4C92 C;  3S3O A;  2RN8 A;  1QDN A;  1YCY A;  1DJ7 B;  1RUW A;  3ASK A;  4J9G A;  4MMK A;  1VUB A;  3A1P A;  3P8D A;  2KGT A;  2OJ2 A;  4C8Q C;  1KC8 C;  1WHM A;  2HAX A;  4A4E A;  4ZGD B;  1WZO A;  2DIL A;  4D6W A;  2EBP A;  5IHN A;  1GFD A;  3BQB A;  1WYX A;  3CCS T;  2LJ1 A;  1M90 C;  2EVR A;  2QAZ A;  2AK5 A;  1BKB A;  2DAQ A;  2ESW A;  1TOV A;  1YJ9 Q;  2D1X A;  4F7U G;  2EGA A;  4C92 G;  3X25 B;  3HTR A;  5AT1 B;  5GAM j;  5LJ5 g;  1UHC A;  2KT8 A;  3O5Z A;  3CD6 A;  4E47 A;  1GCQ A;  3VUZ A;  3MET A;  5LJ3 h;  2XKO C;  1HYO A;  3EGU A;  1UDL A;  1OV3 A;  4DEX A;  3PGG A;  3R6N A;  4C8Q B;  1N8R U;  2P0Q A;  3JCM P;  2FRY A;  4M78 A;  4N0A A;  1F1B B;  1RLQ C;  1Y7X A;  2LC4 A;  4JRQ A;  2C0O A;  2SRC A;  2OAW A;  1VQ9 T;  1VYT A;  1NPR A;  2P4R A;  2DEU A;  1NZ9 A;  2AKK A;  1W1F A;  2A36 A;  2SEM A;  2P4T A;  2OTL A;  2A0F B;  4E7H A;  3C4S A;  3EH2 A;  1VQL T;  2I0N A;  2EWN A;  2DPP B;  4LXC A;  1WGS A;  3H8Z A;  3GF5 A;  4CC2 A;  1TWB A;  1Y57 A;  3VV0 A;  3MHX A;  3A8M B;  3OYF A;  2B25 A;  2DXC A;  3VKI A;  3BE3 A;  2M16 A;  2CP5 A;  2QK0 A;  4A4H A;  3LYI A;  2DIG A;  2CKK A;  4J9I A;  4F7U E;  1YIJ Q;  4R56 A;  3HRS A;  1RAD B;  4J9H A;  4AT1 B;  2QQB A;  4PJJ A;  1K9M U;  1RAC B;  2V8K A;  3REA B;  4M7D C;  1X2Q A;  2FPF A;  2W10 A;  1YNZ A;  2QDL A;  3PVL A;  4ZTJ A;  1X01 A;  1QLY A;  4LUE A;  3I56 Q;  1VQN Q;  3OY9 A;  3CCS A;  3WVD B;  2KVQ G;  3G6E T;  5B6C A;  3LWI A;  3E9G A;  2O01 E;  2P0K A;  3FPR A;  2QYZ A;  3FPT A;  2RQW A;  3FIF A;  4C92 D;  4PJO D;  1VYV A;  3CCM Q;  5EG2 A;  2COZ A;  1MMA A;  1RAA B;  4JRI A;  3MKD A;  4R0K A;  2JS2 A;  2Y90 A;  3OSS C;  2BE9 B;  3TU4 K;  1M3C A;  1VQ6 T;  1JB0 E;  1TU0 B;  3CC7 T;  2K79 A;  4M78 E;  1M30 A;  1UJ0 A;  4EIK A;  1KQ2 A;  1WFW A;  3SWN C;  1QVF S;  2RQV A;  4M7D E;  4HCK A;  3GIB A;  2EYZ A;  1G2B A;  3X20 B;  2JNG A;  1M3A A;  4PLL A;  5GAO m;  2LQW A;  5GAO r;  3QZ5 B;  3CC2 T;  1MV3 A;  4PJO C;  4Z02 A;  2MYS A;  3UAT A;  4ORZ A;  3ULR B;  2HD0 A;  1GRI A;  4KH0 B;  2VB6 A;  2DLP A;  1U8R A;  5CCX A;  1SSF A;  4M75 A;  3M0Q A;  3CC4 A;  3E2U A;  1SRL A;  3LGA A;  3FJ5 A;  4AFZ C;  1QP3 A;  3FEO A;  1FXX A;  3CCL Q;  3RKX A;  1M3B A;  1JJ2 A;  1GXI E;  5L23 A;  1LJO A;  2JTE A;  1TXQ A;  2D8H A;  2EYW A;  3G1J A;  3H41 A;  3MP1 A;  2MK5 A;  2CUB A;  2L3S A;  3JCM V;  1IGU A;  1P92 A;  5A0L A;  3MCA B;  1M8V A;  2DIQ A;  4P5N A;  4LDY A;  3CCJ Q;  1WQW A;  2BZY A;  1T0H A;  4HKE A;  5KYW B;  2R57 A;  4ZNX A;  1BIA A;  3LH5 A;  3QPH A;  1C1A A;  3M55 A;  3LWH A;  1Q82 C;  2EGE A;  1NEB A;  2LDM A;  3FPU A;  4QVZ A;  1IRX A;  4M77 F;  1VQ5 T;  2A28 A;  5GAN 6;  2GGR A;  4C92 A;  5CQY A;  3EG9 A;  4ANJ A;  1VQO A;  1XQH A;  1QKW A;  1YIT Q;  3UPU A;  2LQ8 A;  4MDX A;  1QVP A;  3UDC A;  1KQS S;  3TSW A;  1W2B S;  1VQ4 Q;  1D0Z A;  4IUR A;  4FYW B;  2PZ1 A;  1YJW A;  1OEB A;  2RI2 A;  2XD0 A;  1OU8 A;  1KG1 A;  2R58 A;  2Y4Y A;  1JJ2 P;  2LQK A;  4FM4 B;  3NHN A;  1M2V B;  4X9C A;  2CT3 A;  2JOY A;  5FU7 C;  2DX1 A;  1ZC1 A;  3G4S T;  3OS1 A;  4A53 A;  2PUK B;  4RTT A;  1YI2 T;  1OI1 A;  1YWO A;  3EGX A;  3BW1 A;  3UF4 A;  1WXU A;  1SHG A;  5LJ3 d;  1ACM B;  1M27 C;  5DLO A;  1R0B G;  4M7A A;  5IXB A;  4J6X A;  4C0D C;  2E70 A;  2QA4 T;  4M7A C;  4EMK A;  3OW2 P;  1CKB A;  1W2B P;  3E9F A;  2CSQ A;  1Q81 C;  4AFS C;  1T3L A;  1QKX A;  4E7K A;  4C8Q D;  3JB9 D;  1X27 A;  4ESR A;  3CC7 Q;  1YJN A;  1CZ4 A;  3CCQ A;  1HSQ A;  1M4Z A;  3CCQ T;  2JJ9 A;  1S3S A;  4OML A;  1K9A A;  4ARC A;  3NTI A;  4EMG A;  3MPU B;  4J7F A;  4BD3 A;  5J39 A;  5KYY B;  1Q86 C;  4EPC A;  1PG5 B;  1WHJ A;  2LJ0 A;  2DRK A;  2OI3 A;  4IUQ A;  2X4W A;  3GP8 A;  2IVW A;  4WTO B;  3EG0 A;  4C5E A;  5CIU A;  3QDR B;  3HFO A;  3HP9 A;  4X9D A;  2FEI A;  4C0Z A;  3LH0 A;  4M75 C;  4FU6 A;  1IGQ A;  2KT1 A;  2KRN A;  3I35 A;  1NG2 A;  1Q95 G;  2GQV A;  3REB B;  4KBM B;  1T0J A;  1O9S A;  2A37 A;  2EQK A;  1ZSZ C;  2K5F A;  2L5Q A;  2HSE B;  4JZ4 A;  1CSK A;  4HVU A;  5I22 A;  5LJ5 e;  5CK9 A;  1M1K C;  1Q86 R;  4DA4 A;  1GCP A;  2FB7 A;  3JCM Q;  3CXC P;  2K6D A;  3HU1 A;  3EFO B;  2EQM A;  4LDX A;  1BCM A;  2VXF A;  1VQP Q;  2HQE A;  2D0N A;  3SHW A;  1QCO A;  4CI0 C;  4JRK A;  1IHW A;  2MWP A;  4HVV A;  1VQ7 Q;  2BKD N;  5ECA A;  2NUP A;  2J06 A;  2XDP A;  5I2M A;  1WQ7 A;  2F5K A;  3SD4 A;  2ROL A;  4JRP A;  3GLX A;  3QDF A;  1QWF A;  2F2W A;  2L89 A;  1WNL A;  2H3J A;  1S72 T;  2KE9 A;  2DBM A;  5GMK l;  4KGX B;  1NM7 A;  2D0Q B;  2X9H A;  1K0X A;  3VYH B;  2KR3 A;  1VOM A;  3OMG A;  4XTZ A;  3NPF A;  1B07 A;  1VQ9 A;  2K9G A;  5GJW B;  4HXJ A;  1JO8 A;  4KRT A;  5GAM e;  3BY7 A;  5FU7 B;  2M0O A;  1R7R A;  3HRT A;  4OMN A;  2O88 A;  1YFN A;  1I81 A;  3PIP A;  5GAM d;  2WSC E;  1UEC A;  5GMK i;  1PD0 A;  3CC2 A;  4B9W A;  2PTK A;  2ZGW A;  1KQS A;  3M0U A;  5LJ3 g;  1VQ7 T;  1VQM A;  1Y07 A;  3GPL A;  2X4J A;  1I8F A;  2K3B A;  4KH1 B;  3RMQ A;  5FRO A;  3JCM g;  4RTZ A;  5EPP A;  4EMK B;  2Q1D X;  1NBE B;  5FWC A;  2X35 A;  3BDU A;  3DLL A;  2KNB B;  5GAN d;  4GBQ A;  1KFZ A;  1FYN A;  3QG1 A;  3GNF B;  2BZX A;  4C8Q E;  4CC3 A;  3S6W A;  3G71 Q;  5AYF A;  1RAH B;  2YUN A;  1YJN T;  2EIF A;  2IPO B;  7AT1 B;  2DRM A;  3EHQ A;  1I5O B;  2E65 A;  1KQ1 A;  5KYY A;  2AIR B;  2E6N A;  2AT1 B;  4JZ3 A;  4WF2 A;  1MHN A;  1E32 A;  1I07 A;  1T3S A;  5CVI A;  3JCM c;  4BE1 A;  4KUI A;  3CC2 Q;  2LVM A;  1EFN A;  4X1V A;  2AKL A;  4C5I A;  4RCB A;  2L3Q A;  5FTM A;  3C0C A;  5IN1 A;  1KQS P;  1K73 U;  3JCM X;  1U1S A;  4NL2 A;  4EMK C;  2QTX A;  2RK1 A;  1N6A A;  3BDL A;  3M4Y A;  2V26 A;  1VQ6 Q;  2EJF A;  5EC7 A;  3C94 A;  1CR5 A;  4F7U B;  4PJM A;  2K3Y A;  4AG2 C;  1HXD A;  4NS5 A;  3URG A;  5CO7 A;  3RR6 A;  2C0I A;  1YJN Q;  4MZP A;  1TUD A;  2K2V A;  2CZ7 B;  1G83 A;  1OX9 A;  2QAS A;  4E2F B;  3KFV A;  1AD5 A;  2YUP A;  3GNG A;  2GFA A;  4IUT A;  4Y28 E;  1VQ8 Q;  5FTN A;  1UHF A;  1ZQ1 A;  1KD1 R;  6AT1 B;  2ZCF B;  4M7A D;  2YLB A;  5DM7 R;  1BI1 A;  1N8R C;  5GAN g;  5IT9 E;  2XI9 A;  2FZG B;  3CME Q;  2EKO A;  1VQ4 T;  1K0S A;  5D6W A;  4HCZ A;  3CCV A;  1U3O A;  3G4S Q;  1TTH B;  3IQL A;  2B8A A;  3ZL7 C;  1D1A A;  1WJR A;  2ENM A;  2JN0 A;  1PD1 A;  2V1R A;  2QA4 Q;  1VQK A;  1BBZ A;  1WI7 A;  1VQ5 Q;  4ZGE B;  3VS7 A;  4M7D B;  1O54 A;  2K2M A;  1AT1 B;  1Q81 R;  1G3S A;  5GAO l;  2NUZ A;  2L3P A;  3EG1 A;  3QKJ A;  1Q7Y R;  3JCM h;  1WJS A;  2RHU A;  3S3M A;  1YJW T;  3E19 A;  4A54 A;  1NJI R;  1K9M C;  5GMK h;  1FMK A;  1N9S A;  3OYM A;  2CT4 A;  1MV0 B;  4XTU A;  2LT1 A;  2X3W D;  1WXT A;  2YVL A;  3OYB A;  1Y96 B;  4K11 A;  5EQJ B;  2LTO A;  2LZ6 B;  5FWB A;  4ZN1 A;  3EFO A;  2Q1A X;  3CCJ T;  1H8K A;  4RTX A;  2E4H A;  4F7U A;  2E10 A;  2Q19 X;  1K8A R;  1H92 A;  5GMK e;  1KHC A;  2J05 A;  1YJ9 A;  3AHU A;  4M75 B;  4IUV A;  2DYI A;  3CME A;  4BDY A;  1MMD A;  4QKU A;  3OYA A;  4E6R A;  3CCE Q;  4M4Z A;  2D6F A;  1OPL A;  2E1H A;  1UGQ B;  2DKG A;  3VUB A;  1ABQ A;  1C6V X;  3EG2 A;  2RD1 A;  2DM1 A;  1PC0 A;  4PJO F;  2Q18 X;  3ZBD A;  1AWJ A;  4OMQ A;  5FTJ A;  1N5Z A;  1TH7 A;  5CQX A;  4QVC A;  3L2R A;  1HD3 A;  2CGH A;  1YWP A;  5GAN 7;  2DZ9 A;  2X51 A;  4E7S A;  3P8B B;  3ZEH A;  3INZ A;  1S1N A;  3C12 A;  5IHK A;  5HY6 A;  2JZ2 A;  5IXF A;  4MZM A;  2HNI A;  4RTY A;  4AFQ C;  2GNC A;  1J3T A;  2PQW A;  3L2Q A;  4KDL A;  2LMJ A;  5DYG A;  3HHT B;  1FX7 A;  4JJC A;  1QVG P;  5IH2 A;  2GBQ A;  4C0D B;  1PCX A;  4PJO A;  3OYD A;  1ARK A;  2E5K A;  1FMW A;  1E6G A;  1VA7 A;  1RAG B;  2ZPB B;  2DET A;  3M56 A;  2YWW A;  2QI2 A;  4XTW A;  1MNE A;  2F5T X;  4RKU E;  3VJP A;  1Z9Q A;  4RG8 A;  3VRY A;  5L8R E;  2BE7 D;  4FCY A;  1PM3 A;  1G3Y A;  1B3Q A;  2XIC A;  5C6S A;  2DVE A;  3H0I A;  3TRE A;  4PNO A;  4X34 A;  3JB9 H;  4ZN3 A;  5FRM A;  2Y4X A;  2RM4 A;  2DZC A;  2O4X A;  2DTI A;  1SG5 A;  4L5G A;  5LJ5 j;  1YHQ A;  2YDL A;  4BUG A;  2DJZ A;  1YI2 Q;  3SB2 A;  1PNJ A;  1B7T A;  3OQ5 A;  2EQU A;  1SF9 A;  1UE9 A;  5GJV B;  2RHX A;  1UUE A;  2DE0 X;  2EGC A;  3JCM b;  4OVA A;  3RES A;  1GBR A;  5DY9 A;  5DYI A;  3UT1 A;  4CQN A;  4QVD A;  1QCS A;  1MGQ A;  3RUX A;  2E6Z A;  4IUP A;  2M1H A;  2DTO A;  2ABL A;  3DKM A;  3X28 B;  3OMC A;  3CCV Q;  2DEQ A;  4KGZ B;  3EHR A;  2E64 A;  5LJ3 e;  2F69 A;  4JDS A;  1TS9 A;  2HKQ B;  4ME7 A;  3VS5 A;  3I56 A;  1M1K R;  3TVT A;  5ERG B;  3TIW A;  3CCE A;  2LRQ A;  3G7Z A;  5GAM h;  2CYZ B;  3NFC A;  2OTL Q;  2J6O A;  1V76 A;  3ME9 A;  2EJ9 A;  2HBW A;  1V1C A;  2DXT A;  4BI8 B;  2X4Y A;  2KRS A;  3OS2 A;  2FHD A;  3I55 T;  2KK4 A;  2CZ0 B;  5GAN 3;  4QQ6 A;  2COY A;  1Z9Z A;  4F14 A;  1D0X A;  3QZ9 B;  3SDZ A;  3I55 Q;  1OYX A;  4KO8 A;  5HK3 A;  3PTA A;  2OTL T;  3SWN B;  1HJD A;  4DOV A;  2KXD A;  3UA6 A;  2DO3 A;  2QEX Q;  2DVJ A;  2F1L A;  1ABO A;  4FYX B;  1LPL A;  3QWY A;  4TVR A;  5A0G A;  2CH4 W;  1TUG B;  3CC4 Q;  3C95 A;  4M75 G;  5D7U A;  3CXC A;  3KUF A;  4HT8 A;  2KAF A;  4L59 A;  1TUC A;  4BI4 A;  3SFM A;  1K9M R;  3TQ7 P;  2F2X A;  5CCB A;  1GFC A;  2KBT A;  2WSE E;  1NEG A;  4OGC A;  2O9V A;  2CRE A;  4M78 B;  2L0A A;  5CKD A;  2PVG B;  1N8R R;  2FO0 A;  2RI5 A;  1C0M A;  4M77 D;  3ER0 A;  2JT4 A;  5IHI A;  2RQT A;  5LJ5 d;  5GAN e;  1ZSZ A;  2KYM A;  3R6O A;  1YN8 A;  4XTV A;  2RI3 A;  4Y92 A;  3NMZ C;  3J81 E;  1XOV A;  2VXE A;  2ED1 A;  1HK9 A;  5I21 A;  4N4I A;  4AG1 C;  1BIB A;  1WLF A;  4QT7 A;  1I5L A;  4OMF B;  3M9Q A;  2HQX A;  1VIE A;  4MML A;  1WDX A;  2KY9 A;  4BY6 C;  3QJ6 A;  1LVK A;  2PWY A;  4M7A E;  3RKY A;  3JB9 J;  1KHI A;  4FYV B;  1QWE A;  3CD6 Q;  5KCH A;  1UGP B;  2LCL A;  3FDR A;  4ATO A;  1N27 A;  3VS0 A;  2LNH B;  2G6F X;  1AWO A;  2YHT A;  2JXB A;  1NJI C;  1WJQ A;  3QHS A;  1ZX6 A;  2H8H A;  4OGE A;  4HCB A;  3GOX A;  3L2Z A;  1OZ3 A;  1SPK A;  2ED0 A;  1G3T A;  1EZZ B;  4KDI A;  1ZUK A;  2E12 A;  3QXE B;  1R0C B;  2PVD B;  4RV0 A;  2HQH A;  1K8A C;  1JXM A;  4C92 F;  3QUI A;  4BDZ A;  2RPN A;  4GY5 A;  2GFU A;  1G3W A;  5CKE A;  2JM9 A;  4KLN A;  2KEA A;  2M02 A;  3OYK A;  4PFP A;  3I56 T;  3QWZ A;  3M5A A;  4QQD A;  1RI9 A;  1AWW A;  2XU8 A;  2DFU A;  2FZC B;  1ZBX A;  2VGN A;  3NGP A;  3CCL A;  3RER A;  2RQU A;  2A3L A;  3A8G B;  3EH1 A;  2C0T A;  2OTJ T;  1IB8 A;  4M78 F;  4JPB W;  1SRM A;  4HA8 A;  2RJD A;  2MAM A;  4FYY B;  2RHI A;  2OAU A;  1YJ9 T;  4ZGJ B;  3M0P A;  4NOY A;  2V8J A;  2VC8 A;  2J6F A;  4E7L A;  2AZS A;  3CCS Q;  2XID A;  1FWZ A;  2GQI A;  2CP3 A;  1VQL A;  3X24 B;  4CRI A;  4BY6 B;  3CF2 A;  1U06 A;  3EGD A;  2DL4 A;  3ZJU A;  4II1 A;  1JU5 C;  4GLM A;  1IXD A;  1M1G A;  4JS5 A;  3OBW A;  4J83 A;  4RG2 A;  1RAB B;  3CCV T;  5I11 A;  2KYB A;  2KRM A;  4JS4 A;  1PRM C;  5CD1 A;  4PJO E;  2E41 A;  3OYH A;  2EYY A;  4M7D A;  8AT1 B;  1NYG A;  2MPX C;  2DD5 A;  4AS1 A;  2PUO B;  5GAN 5;  4E7Z A;  3EG9 B;  1X2K A;  1KSW A;  4KOD A;  1VQK T;  4WCI A;  2XDD A;  3TSZ A;  1S72 A;  4A4K A;  3HKS A;  3CMA T;  3PE0 A;  4M78 C;  4N0A C;  4J9B A;  4LNP A;  4Y91 A;  1M90 R;  1K4U S;  1VQ8 T;  4J9E A;  2JV2 A;  4BE0 A;  2MIO A;  3RMS A;  1MMN A;  4M75 E;  1NYF A;  4F16 A;  2VV5 A;  2O2O A;  3OA6 A;  1OUL A;  4OF1 A;  5KYX A;  1X75 C;  2O31 A;  1I9G A;  4M7A F;  3M54 A;  3H6Z A;  5D6Y A;  4PFO A;  4N4G A;  3SWN A;  4DBQ A;  4HCC A;  5KYU B;  1KD1 C;  3HU3 A;  1Q81 U;  1AVZ C;  1K76 A;  1RAF B;  3QYH B;  1M90 U;  2QTV A;  1KJW A;  3VS2 A;  3V7S A;  2I2L A;  1RL2 A;  4Z88 A;  1A0N B;  3RNJ A;  3JAM E;  1N9R A;  5GAM f;  1YIT T;  3G6E Q;  2CZ6 B;  2RNA A;  1Q86 U;  3CXC S;  5FLX E;  2HMA A;  5KYW A;  4O6J A;  4O5V A;  2EFI A;  3CPW S;  4HVW A;  3M58 A;  5J26 A;  5A0D A;  2JMA A;  4BI3 A;  4Z8A A;  4JJD A;  1M2O A;  5GAN j;  2DD4 A;  2LJ3 A;  1X6G A;  2K4Y A;  2M9U A;  3VS6 A;  5HKC A;  3RBB B;  3CCE T;  3ZFJ A;  1Y71 A;  1QMC A;  1BI3 A;  1M8M A;  3ZGZ A;  1VQ5 A;  3FLG A;  3UWN A;  2LX7 A;  5LJ5 h;  2QGG A;  1MND A;  3PMI A;  3OYJ A;  1WPY A;  4C8Q G;  2JW4 A;  4KUD K;  3VU3 C;  3FB9 A;  5CR2 A;  1PKS A;  4OB0 B;  2XK0 A;  2JM8 A;  4UC4 A;  4F17 A;  2CSI A;  5KCO A;  1PKT A;  3OW2 S;  1VIF A;  2KRO A;  3QSU A;  2K57 A;  2O4X B;  3G71 A;  9ATC B;  2XMF A;  2YUO A;  1S72 Q;  2F2V A;  3CBO A;  4XU0 A;  1YHQ T;  2RF0 A;  3V7C A;  3JB9 F;  4DBF A;  1E6H A;  3OW2 A;  2DK3 A;  2KSS A;  1W2B A;  1JBM A;  1D09 B;  3ZJT A;  4C92 E;  4DBR A;  2DL5 A;  2BZ8 A;  4XAX B;  3M57 A;  1NLP C;  3JCM e;  1W4S A;  1Q7Y C;  1AZE A;  3CCR Q;  2XDB A;  1PSF A;  3O8V A;  5GMK m;  1AZG B;  5GAO n;  4XQ3 A;  2CS7 A;  2JTF A;  5CKB A;  2BTT A;  3LW5 E;  2QXF A;  3JRZ A;  1SSH A;  4IIM A;  1IHV A;  3RKW A;  2GF7 A;  5KE3 A;  4C8Q A;  2NUP B;  3J7A F;  2W0Z A;  3FJP A;  5KH6 A;  1RI0 A;  1IO6 A;  3L2U A;  4FT4 A;  4YTL A;  5LL6 S;  1YIJ A;  3ZJV A;  1QQJ A;  3PT9 A;  1M1F A;  1X6B A;  5FU6 B;  2QQ9 A;  3MEW A;  2RHY A;  2JVV A;  1UB4 A;  4M75 F;  3L1A A;  2PJH B;  2HEQ A;  1QCN A;  4M7D F;  4XTX A;  3OYL A;  2J7I A;  3RIR A;  3OYC A;  1YHQ Q;  3P8H A;  3V8L A;  2IG0 A;  1PSE A;  2OTJ A;  4JJN K;  3JCM f;  2CZ1 B;  3PVQ A;  4LUD A;  4MDW A;  1GCQ C;  4LN2 A;  1K73 R;  1VQL Q;  1UTI A;  1QVF P;  1PRL C;  2DBK A;  3CBP A;  8ATC B;  3D7S B;  2FVU A;  4J9C A;  1M9S A;  2HBP A;  4AQ7 A;  2K7A A;  1OX8 A;  2IIM A;  4XU2 A;  3AT1 B;  2MM2 A;  4CC4 B;  4KT0 E;  2QDY B;  3JSC A;  4B6M A;  5GAN 2;  3VYG A;  2OTJ Q;  3QBY A;  4C5H A;  1Q82 U;  5FTK A;  1JRI A;  4M7D D;  1YCS B;  2HL5 C;  4XTY A;  4JUV A;  5A2Q E;  1ZBJ A;  1V29 B;  2DJQ A;  3CCR A;  1OOT A;  1WHL A;  4MZT A;  2DYB A;  1WLP B;  3OSV A;  2VYT A;  1SHF A;  4F7U F;  1AWX A;  2VKN A;  2ECZ A;  2YXY A;  2JUF A;  3PIO A;  4LD6 A;  2NLU A;  2ZZD A;  1QCF A;  2L3R A;  1RAI B;  2FZK B;  2NWM A;  2HKN A;  3SEM A;  1WIE A;  5LJ3 j;  1D3B A;  3LLR A;  4LE9 A;  1JXO A;  4QW2 A;  2QA4 A;  1KC8 R;  3FRN A;  3I5R A;  2NUT A;  4M7A B;  3G6E A;  2MWO A;  2M0Y A;  2ZPI B;  2CP6 A;  2DF6 A;  2CP7 A;  2XG8 D;  1AOJ A;  1D3B B;  4FL6 A;  2EJG A;  2MI6 A;  3JCM J;  2RHZ A;  1ZLM A;  3LGF A;  2DNU A;  2HDA A;  4ZTF A;  1E7O A;  1KC8 U;  3MEU A;  5GAN 8;  4OB2 B;  5J3B A;  2QQA A;  3HRU A;  1VQN A;  1G5V A;  2R5M A;  2D9T A;  4M77 A;  2YT6 A;  1R8O B;  2DL7 A;  2YRD A;  1K1Z A;  1JEG A;  2COW A;  4BE2 A;  3QQ7 A;  4KGV B;  3G4S A;  2CP0 A;  4V2S A;  2MCN A;  3OYY A;  1QVG S;  3M59 A;  5GAO q;  2L8D A;  3OYE A;  1VQP T;  4OB3 B;  2X4X A;  2EKH A;  2FRW A;  3CEY A;  4IKF A;  3HPW A;  1BK2 A;  2VVK A;  3DB3 A;  1BI2 A;  2GTO A;  4M77 G;  3OB9 A;  1OZ2 A;  1UEB A;  2ZPE B;  3H9N A;  4M77 B;  2L2P A;  2H3E B;  4A4G A;  1VQ8 A;  4R55 A;  1SEM A;  3OS5 A;  3PFS A;  1VQM Q;  2LNV A;  3CCM A;  1WHK A;  5I2S A;  2VGM A;  3QYG B;  4JJB A;  4J9F A;  5C18 A; 
#chains in the Genus database with same CATH homology
 1MHN A;  1E32 A;  5CVI A;  2YLC A;  3JCM c;  4BE1 A;  1M1K U;  2C06 A;  4KUI A;  4KLN A;  3CD6 A;  3OYK A;  3I56 T;  3QWZ A;  4M77 C;  4E47 A;  2LVM A;  3M5A A;  4QQD A;  3MET A;  5LJ3 h;  3VUZ A;  4C5I A;  4RCB A;  2LCC A;  2XKO C;  2XU8 A;  1ZBX A;  2VGN A;  3CCL A;  5FTM A;  3RER A;  3Q1J A;  4C0F A;  3PGG A;  2A3L A;  3A8G B;  3KBG A;  4C8Q B;  5IN1 A;  1N8R U;  2OTJ T;  2P0Q A;  4M78 F;  1K73 U;  3JCM X;  1U1S A;  4NL2 A;  4EMK C;  2QTX A;  4HA8 A;  2RK1 A;  1IRE B;  2RJD A;  1N6A A;  3BDL A;  2ZPH B;  2MAM A;  3M4Y A;  5CAI A;  4M78 A;  4N0A A;  1K8A U;  2EJF A;  4JLI A;  3C94 A;  2RHI A;  1Y7X A;  2LC4 A;  2OAU A;  4JRQ A;  1YJ9 T;  1CR5 A;  4F7U B;  4ZGJ B;  2K3Y A;  3HU2 A;  2FL7 A;  1VQ9 T;  1HXD A;  1NPR A;  4NOY A;  4NS5 A;  3URG A;  5CO7 A;  2V8J A;  2VC8 A;  4E7L A;  4MZP A;  3G71 T;  2YUJ A;  1NZ9 A;  1YIT A;  2MM0 A;  2XID A;  2K2V A;  3CC4 T;  3J80 E;  5GLF A;  1FWZ A;  2CZ7 B;  3L42 A;  4L6V 5;  2P4T A;  5GMK j;  3WXM B;  1VQL A;  3GNG A;  2GFA A;  4IUT A;  1XNI A;  3C4S A;  4Y28 E;  4E7H A;  2OTL A;  3X24 B;  1VQL T;  5FTN A;  4M78 D;  1ZQ1 A;  4CRI A;  2VUB A;  5LJ3 f;  4BY6 B;  3CF2 A;  2ZCF B;  3CPF A;  2EWN A;  1VQN T;  2DPP B;  4M7A D;  3MP6 A;  1WGS A;  3H8Z A;  3GF5 A;  2YLB A;  5DM7 R;  1BI1 A;  3ZJU A;  3VV0 A;  1N8R C;  4II1 A;  3MHX A;  1IZ6 A;  2RO0 A;  5GAN g;  3A8M B;  5IT9 E;  1B34 B;  3OYF A;  3HFN A;  2B25 A;  3CCR T;  2DXC A;  3VKI A;  2XI9 A;  2M16 A;  1M1G A;  4JS5 A;  4A4H A;  3OBW A;  2EKO A;  3M4G A;  4J83 A;  4RG2 A;  1VQ4 A;  3LYI A;  2DIG A;  3CCV T;  2CKK A;  2MF2 A;  2RA2 A;  4F7U E;  1VQ4 T;  5D6W A;  4HCZ A;  3CCV A;  4JS4 A;  4R56 A;  3HRS A;  5CD1 A;  4XK8 E;  2QQB A;  4PJO E;  2E41 A;  3OYH A;  4ELY C;  3JCM W;  2B8A A;  4M7D A;  1K9M U;  3OS0 A;  4PLI A;  2V8K A;  2DD5 A;  4AS1 A;  1WJR A;  2JN0 A;  2PUO B;  3X26 B;  2BIV A;  4M7D C;  1AHJ B;  5GAN 5;  1VQK A;  4OP0 A;  1ZHI A;  4ZGE B;  2Q1C X;  4KOD A;  1VQK T;  2XDD A;  4ZTJ A;  2R5A A;  1X01 A;  1S72 A;  1XTD A;  4A4K A;  3V8K A;  3HKS A;  3CMA T;  4M7D B;  1O54 A;  4M78 C;  4N0A C;  4C0G A;  1Y96 A;  1G3S A;  3MEA A;  4XU3 A;  3WVD B;  2KVQ G;  3OY9 A;  2RJF A;  5GAO l;  2KDS A;  3G6E T;  5B6C A;  4FT2 A;  4Y91 A;  3LWI A;  3E9G A;  1VQO T;  1VQ8 T;  2O01 E;  2JV2 A;  2P0K A;  3FPR A;  1YIJ T;  2QQR A;  4BE0 A;  3FPT A;  4ARI A;  3FIF A;  3RMS A;  4C92 D;  4M75 E;  4PJO D;  3QKJ A;  2VV5 A;  5EG2 A;  3JCM h;  3OA6 A;  4JRI A;  1WJS A;  3T9N A;  2RHU A;  4OF1 A;  1X75 C;  4QQG A;  3S3M A;  1YJW T;  3E19 A;  1VQ6 A;  2Y90 A;  3OSS C;  5GAM g;  4A54 A;  3TU4 K;  1K9M C;  5GMK h;  4DQ2 A;  4M7A F;  1N9S A;  1VQ6 T;  3DB4 A;  1I9G A;  1JB0 E;  3CC7 T;  3BFM A;  3M54 A;  3H6Z A;  5D6Y A;  3OYM A;  4GLK A;  4M78 E;  4N4G A;  3SWN A;  2A7Y A;  4HCC A;  3OYN A;  4XTU A;  2LT1 A;  5LJ5 f;  1KQ2 A;  1KD1 C;  3HU3 A;  3JB9 I;  3CCS A;  1Q81 U;  4E7J A;  2YVL A;  3SWN C;  3OYB A;  1QVF S;  5GAN 4;  1Y96 B;  3CCL T;  5EQJ B;  2LTO A;  4M7D E;  3QYH B;  1M90 U;  5IAY A;  3GIB A;  4ZN1 A;  2QQS A;  2JNG A;  3X20 B;  2Q1A X;  4PLL A;  3CCJ T;  5GAO m;  4F7U A;  5GAO r;  4HT9 A;  3QZ5 B;  3V7S A;  2E10 A;  2I2L A;  3EFR A;  3CPW A;  3CC2 T;  4Z02 A;  4PJO C;  2Q19 X;  3F70 A;  3PMT A;  5GMK e;  1RL2 A;  2V8I A;  1KHC A;  5CKF A;  2EAY A;  1YJ9 A;  2HD0 A;  3AHU A;  3N5B B;  3A5Z B;  3JAM E;  3WVE B;  4M75 B;  1U8R A;  5CCX A;  4IUV A;  3A8O B;  1SSF A;  1N9R A;  4M75 A;  5GAM f;  3CME A;  1YIT T;  2CZ6 B;  3CC4 A;  4BDY A;  1Q86 U;  5HK0 A;  3CME T;  3CXC S;  2K5I A;  5FLX E;  4J6W A;  4JLG A;  4XU1 A;  3OYA A;  3LGA A;  4B9X A;  4O6J A;  1QP3 A;  2D6F A;  3FEO A;  2E1H A;  1FXX A;  2EQJ A;  4O5V A;  1UGQ B;  1KD1 U;  3RKX A;  2DKG A;  2EFI A;  3CPW S;  3VUB A;  1JJ2 A;  3M58 A;  5J26 A;  2YRV A;  5A0D A;  1K73 C;  2RD1 A;  3MP8 A;  4BI3 A;  1GXI E;  1EIF A;  4PJO F;  1LJO A;  2Q18 X;  3ZBD A;  3MP1 A;  5FTJ A;  5C0M A;  1TH7 A;  5CQX A;  3MO8 A;  4M75 D;  5FU6 C;  2DD4 A;  3JCM V;  4QVC A;  3L2R A;  5GAN j;  2CGH A;  1P92 A;  5A0L A;  5GAN 7;  3MCA B;  2DZ9 A;  2K4Y A;  1M8V A;  3P8B B;  2DIQ A;  2M9U A;  3INZ A;  4P5N A;  4J8O A;  3ZEH A;  4LDY A;  3C12 A;  1WQW A;  5HY6 A;  2JZ2 A;  3LX7 A;  4HKE A;  4OB1 B;  1UGS B;  2R57 A;  4MZM A;  5HKC A;  1BIA A;  2HNI A;  4KUL A;  3CCE T;  3QPH A;  3ZFJ A;  2PQW A;  3L2Q A;  1Y71 A;  4KDL A;  4LDU A;  5DYG A;  3M55 A;  3EAE A;  3LWH A;  3HHT B;  4C8Q F;  1Q82 C;  3NTH A;  2LDM A;  3FPU A;  1FX7 A;  1BI3 A;  4QVZ A;  3ZGZ A;  1VQ5 A;  3FLG A;  4C0D B;  4M77 F;  3UWN A;  1VQ5 T;  4PJO A;  3OYD A;  5LJ5 h;  4EMH A;  3A8H B;  5GAN 6;  4C92 A;  3I55 A;  3PMI A;  5CQY A;  3OYJ A;  1WPY A;  4C8Q G;  1VQO A;  1XQH A;  4KUD K;  3VU3 C;  2ZPB B;  3FB9 A;  5CR2 A;  1UGR B;  4C92 B;  3M56 A;  2QI2 A;  1M5Q 1;  4OB0 B;  4XTW A;  2XK0 A;  3UPU A;  2LQ8 A;  4UC4 A;  2F5T X;  4MDX A;  1QVP A;  4RKU E;  5KCO A;  3UDC A;  4A4F A;  2PVO B;  3VJP A;  3OW2 S;  1KQS S;  1VIF A;  2DXB A;  4RG8 A;  1W2B S;  2WSF E;  4IUR A;  3NTK A;  5L8R E;  1QVG A;  1G3Y A;  3QSU A;  2K57 A;  1YJW A;  2O4X B;  4PL6 A;  2JTM A;  3G71 A;  2XIC A;  5C6S A;  2DVE A;  4M7A G;  3TRE A;  2RI2 A;  4PNO A;  2XD0 A;  3LHD A;  4PKC C;  3HL8 A;  4X34 A;  1KG1 A;  3JB9 H;  4ZN3 A;  5FRM A;  2Y4X A;  2R58 A;  2RM4 A;  2Y4Y A;  2LQK A;  4FM4 B;  2ZPG B;  3DLM A;  1B34 A;  2DZC A;  2K5L A;  2DTI A;  2O4X A;  5FTL A;  4X9C A;  5M9O A;  4RCC A;  3CBO A;  4XU0 A;  4L5G A;  1YHQ T;  5LJ5 j;  3V7C A;  3JB9 F;  1YHQ A;  2JOY A;  5FU7 C;  1ZC1 A;  3OYG A;  4BUG A;  3G4S T;  2DJZ A;  3OW2 A;  4Q5W A;  3OS1 A;  4A53 A;  2DK3 A;  2KSS A;  1W2B A;  1JBM A;  2PUK B;  2DXU A;  3ZJT A;  3SB2 A;  1YI2 T;  3OQ5 A;  4C92 E;  2EQU A;  1VQ7 A;  1OI1 A;  4XAX B;  3M57 A;  1YI2 A;  3M53 A;  3JCM e;  1VQM T;  1LNX A;  3BW1 A;  1W4S A;  2RHX A;  1Q7Y C;  5FRN A;  5LJ3 d;  2XDB A;  1PSF A;  3O8V A;  2ZPF B;  4OVA A;  4ELZ C;  5GMK m;  5DLO A;  3JCM b;  4M7A A;  5GAO n;  3RES A;  4XQ3 A;  5DY9 A;  4FSX A;  5DYI A;  2CS7 A;  2JTF A;  4J6X A;  5CKB A;  3UT1 A;  4C0D C;  4QVD A;  4CQN A;  1QCS A;  3LW5 E;  2E70 A;  2LX9 A;  2QXF A;  3JRZ A;  2QA4 T;  1MGQ A;  4M7A C;  2LW6 A;  4EMK A;  4VUB A;  3RUX A;  2E6Z A;  3RKW A;  3E9F A;  4IUP A;  1Q81 C;  5CKH A;  2GF7 A;  3QC8 A;  2PU9 B;  2M1H A;  5D6X A;  2DTO A;  1NE8 A;  5KE3 A;  4E7K A;  4C8Q D;  2AHJ B;  4C8Q A;  2WAC A;  4RMO A;  3J7A F;  3JB9 D;  3FJP A;  5KH6 A;  1RI0 A;  3L2U A;  1YJN A;  4FT4 A;  4YTL A;  1CZ4 A;  3DKM A;  3X28 B;  3OMC A;  5LL6 S;  3KXT A;  2DEQ A;  3CCQ A;  1YIJ A;  3ZJV A;  4NL3 A;  1M4Z A;  3PT9 A;  1M1F A;  3CCQ T;  4E7I A;  1S3S A;  2E64 A;  2P0P A;  5FU6 B;  5LJ3 e;  2F69 A;  2QQ9 A;  3MEW A;  4JDS A;  4ARC A;  2RHY A;  2JVV A;  1UB4 A;  3NTI A;  4EMG A;  1Q7Y U;  4ME7 A;  4M75 F;  3L1A A;  2PJH B;  4J7F A;  4BD3 A;  1QP2 A;  5J39 A;  3I56 A;  4LDW A;  5KE2 A;  1Q86 C;  1NJI U;  5ERG B;  4EPC A;  4M7D F;  4XTX A;  3OYL A;  2E5Q A;  3TIW A;  3RIR A;  3OYC A;  3CCE A;  2LRQ A;  3CC7 A;  3G7Z A;  4IUQ A;  2X4W A;  3P8H A;  5GAM h;  3V8L A;  2IVW A;  2CYZ B;  3GP8 A;  1LOJ A;  2IG0 A;  3NFC A;  4LDV A;  1PSE A;  2OTJ A;  3LGL A;  4JJN K;  4FIB A;  3JCM f;  3MEV A;  2CZ1 B;  2QEX A;  2G3R A;  3ME9 A;  2EJ9 A;  4MDW A;  2DXT A;  4BI8 B;  2X4Y A;  4EDU A;  3HSB A;  3OS2 A;  2FHD A;  2BUD A;  4C5E A;  3I55 T;  2GCX A;  2KK4 A;  3QDR B;  5CIU A;  3CBP A;  2CZ0 B;  2RH2 A;  3HFO A;  3HP9 A;  4X9D A;  3LH0 A;  4M75 C;  4FU6 A;  4C0Z A;  5GAN 3;  4QQ6 A;  2RJE A;  2FVU A;  1M9S A;  2HBP A;  4AQ7 A;  2GQV A;  4XU2 A;  3OBY A;  1O9S A;  4KBM B;  1QW1 A;  2EQK A;  3QZ9 B;  4PJO B;  1VQP A;  2K5F A;  3SDZ A;  2L5Q A;  2MM2 A;  1OYX A;  5LJ5 e;  4KO8 A;  5CK9 A;  1M1K C;  4KT0 E;  1X6O A;  4DA4 A;  3EFS A;  3A8L B;  2LT4 A;  1QVF A;  5C1B A;  2QDY B;  5HK3 A;  3JSC A;  3PTA A;  3SWN B;  2OTL T;  3JCM d;  2FB7 A;  3FC3 A;  4DOV A;  3JCM Q;  5GAN 2;  3VYG A;  5FTK A;  3QBY A;  4C5H A;  1Q82 U;  3HU1 A;  2DO3 A;  1JRI A;  4M7D D;  2XHC A;  4XTY A;  2EQM A;  4JUV A;  4LDX A;  5A2Q E;  1V29 B;  4TVR A;  2K3X A;  3CCR A;  5A0G A;  1NPP A;  2RJC A;  2VXF A;  1U1T A;  4MZT A;  4PJO G;  2HQE A;  3V8J A;  3OSV A;  2VYT A;  1O75 A;  3CCM T;  4F7U F;  3C95 A;  4CI0 C;  4IUU A;  4JRK A;  3TEE A;  4M75 G;  2MWP A;  3V7R A;  2JUF A;  3CXC A;  3KUF A;  3L2V A;  2KAF A;  4L59 A;  3PIO A;  4HT8 A;  4LD6 A;  2BKD N;  2NLU A;  2ZZD A;  4BI4 A;  3SFM A;  5GAO p;  2XDP A;  2L3R A;  5I2M A;  5CCB A;  1WQ7 A;  2F5K A;  2WSE E;  3CD6 T;  3SD4 A;  4J6Y A;  5LJ3 j;  4OGC A;  4M78 B;  1D3B A;  3LLR A;  4JRP A;  3GLX A;  3QJY A;  4QW2 A;  2QA4 A;  3FRN A;  5CKD A;  1H3Z A;  2L89 A;  2PVG B;  3CMA A;  3S3N A;  1BYM A;  2MMP A;  1WNL A;  4M7A B;  5GAN h;  2H3J A;  2RI5 A;  2MWO A;  4M78 G;  3G6E A;  2RB6 A;  1S72 T;  3OYI A;  2ZPI B;  1BI0 A;  4M77 D;  3QQ8 A;  3ER0 A;  5GMK l;  3CCU T;  5LJ5 d;  5GAN e;  2DTH A;  3PNW C;  3CCU A;  2XG8 D;  2D0Q B;  3R6O A;  4XTV A;  2RI3 A;  4FL6 A;  1D3B B;  3VYH B;  3J81 E;  3OMG A;  4XTZ A;  1XOV A;  2VXE A;  2EJG A;  2EYQ A;  2KMT A;  2MI6 A;  3JCM J;  2RHZ A;  1VQ9 A;  1H64 1;  1HK9 A;  3LGF A;  5I21 A;  5GAM e;  4N4I A;  3QII A;  3TCJ A;  1BIB A;  4BAC A;  4ZTF A;  1WLF A;  3L2W A;  1I5L A;  3BY7 A;  3QO3 A;  4J5Y A;  5DLQ E;  2M0O A;  4OMF B;  2RK2 A;  5FU7 B;  3M9Q A;  2HQX A;  1VIE A;  3HRT A;  3MEU A;  4MML A;  5GAN 8;  4OB2 B;  1KC8 U;  4M7D G;  1CZ5 A;  4N4H A;  2KY9 A;  4DOW A;  1YBY A;  5J3B A;  3JB9 G;  2QQA A;  3HRU A;  1VQN A;  1G5V A;  1I81 A;  4BY6 C;  2R5M A;  2D9T A;  4M77 A;  4BB7 A;  5GAM d;  2WSC E;  3QJ6 A;  3PIP A;  4M77 E;  1R8O B;  4J7I A;  2PWY A;  5GAN f;  3MB5 A;  2QEX T;  4LD9 K;  3RKY A;  4M7A E;  3JB9 J;  1KHI A;  4BE2 A;  2KQW A;  3CBM A;  3QQ7 A;  5GMK i;  4C5G A;  3G4S A;  3CC2 A;  4B9W A;  2ZGW A;  5KCH A;  1KQS A;  3CCJ A;  1I4K 1;  1UGP B;  1JJ2 S;  5LJ3 g;  4V2S A;  5CCA A;  3OYY A;  1VQ7 T;  1QVG S;  3M59 A;  2LCL A;  3JCM P;  2FYK A;  3FDR A;  5GAO q;  1VQM A;  4ATO A;  1N27 A;  1Y07 A;  2X4J A;  1I8F A;  2L8D A;  3E1S A;  3RMQ A;  5FRO A;  3OYE A;  3GPL A;  4C92 C;  3S3O A;  1VQP T;  2YHT A;  1QDN A;  3JCM g;  1YCY A;  4OB3 B;  5EPP A;  1DJ7 B;  3ASK A;  2X4X A;  1VUB A;  3CEY A;  4MMK A;  4EMK B;  3P8D A;  1NJI C;  1WJQ A;  3QHS A;  4IKF A;  2Q1D X;  3HPW A;  2X35 A;  4C8Q C;  1KC8 C;  4OGE A;  4HCB A;  3BDU A;  3DLL A;  3DB3 A;  1BI2 A;  3GOX A;  2HAX A;  5GAN d;  3L2Z A;  4A4E A;  4M77 G;  4ZGD B;  3OB9 A;  1OZ3 A;  4D6W A;  1OZ2 A;  1UEB A;  2ZPE B;  3QG1 A;  1G3T A;  3GNF B;  3BQB A;  4C8Q E;  4KDI A;  4M77 B;  3S6W A;  3CCS T;  2E12 A;  3QXE B;  5AYF A;  1YJN T;  1M90 C;  2EIF A;  2PVD B;  4RV0 A;  4A4G A;  1BKB A;  1K8A C;  2DAQ A;  1VQ8 A;  1R7R A;  4C92 F;  4R55 A;  3QUI A;  3OS5 A;  4BDZ A;  3PFS A;  4GY5 A;  2LNV A;  4F7U G;  3CCM A;  4C92 G;  2E65 A;  2GFU A;  3X25 B;  1G3W A;  1KQ1 A;  5I2S A;  5GAM j;  2E6N A;  2VGM A;  3QYG B;  5LJ5 g;  5CKE A;  4WF2 A;  5C18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...