2XDPA

Crystal structure of the tudor domain of human jmjd2c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
b'EKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4C
publication title Crystal Structure of the Tudor Domain of Human Jmjd2C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 18
structure length 119
sequence length 119
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xdpA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2xdpA02
2IG0A 3E9GA 2HQXA 4QQ6A 4NS5A 2NLUA 4QQDA 4IUPA 2X4XA 4C5GA 3MEUA 1OYXA 2EQMA 2G3RA 2L3RA 2XDPA 4II1A 2M0OA 4X34A 2QQRA 2RJCA 3QIIA 5CIUA 3MEVA 3NTHA 3QBYA 3META 3MEWA 2X35A 4C5EA 3MP8A 3NTKA 4FU6A 3OYCA 3OYKA 2E6NA 3OYDA 4E7KA 1XNIA 3PFSA 2RHXA 3ZEHA 3LGFA 4N4IA 4A4GA 2O4XA 3FDRA 3ME9A 2B8AA 2RHYA 3LH0A 4BD3A 5IAYA 3QJ6A 2D9TA 5FRMA 4IKFA 3P8DA 5KH6A 5IN1A 2X4YA 5J39A 3L2VA 3FLGA 3OMGA 2LCCA 3BDLA 2GFUA 4UC4A 2RHIA 4IURA 2YRVA 2PQWA 4IUQA 1MHNA 5KE2A 3E9FA 4CRIA 1N27A 1OZ3A 2RI3A 3PMTA 4QQGA 3L2UA 2WACA 4QW2A 3OMCA 1WJQA 5D6YA 2HQEA 3CEYA 3OS1A 3H8ZA 3ASKA 2DAQA 3MEAA 2F5KA 5KCHA 3LYIA 2RJEA 4ZTFA 3KUFA 3OYFA 3L2WA 4GY5A 2XK0A 4QVZA 5FROA 2R57A 3SD4A 4N4HA 5M9OA 4A4FA 3OYHA 2QQSA 2LTOA 5D6WA 2CKKA 3S6WA 3H6ZA 2BKDN 4PLIA 3OS0A 3OA6A 2LRQA 2VYTA 4FL6A 3OYMA 3OYNA 2EQJA 3L2QA 3OYAA 4A4EA 3OYEA 1SSFA 2GF7A 3OQ5A 2RJDA 3L2RA 4N4GA 5D6XA 1H3ZA 2DIQA 2E5QA 2RI2A 3QKJA 4PLLA 3OYIA 4BE2A 1WJRA 2JTFA 4RG2A 3S3MA 2BUDA 2BIVA 3O8VA 4LD6A 2RHZA 5FRNA 3OYBA 2GFAA 3OY9A 2K3XA 3UWNA 4Q5WA 4ZTJA 2LDMA 4HCZA 3UT1A 4C5IA 2M16A 3F70A 4Z02A 2MWOA 4BDYA 1OI1A 3S3OA 2MWPA 3PNWC 4EDUA 2FHDA 2O4XB 2P0KA 3DB4A 3L42A 3NTIA 4OVAA 4BACA 3DLMA 4B9XA 2RI5A 2JZ2A 1WJSA 3FC3A 3S3NA 4BE1A 4IUTA 4PL6A 3MP6A 4IUUA 4A4HA 1KHCA 4E7IA 2RJFA 4E7LA 1G5VA 2L89A 3OYLA 3LLRA 5C0MA 5C6SA 3C4SA 2RO0A 5J26A 2LVMA 4BE0A 2EFIA 4E7HA 2RHUA 3GOXA 3EAEA 1RI0A 3OB9A 4BDZA 1WGSA 3MO8A 2EQUA 1OZ2A 2EKOA 3M9QA 2EQKA 2R5MA 3PMIA 4C5HA 5KCOA 4B9WA 4L59A 2DIGA 2R5AA 2M1HA 2X4WA 3DB3A 3FEOA 5KE3A 3OS2A 3OYGA 3LX7A 3LGLA 4E7JA 4IUVA 2L8DA 2R58A 3Q1JA 3OYJA 3P8HA 2K3YA 3MP1A
chains in the Genus database with same CATH superfamily
4HXJA 2CGHA 4PFOA 5CIUA 1RLPC 2QQRA 1TTHB 2F1LA 2E12A 2EPDA 2COWA 2VKNA 3ZBDA 5LJ5h 4FU6A 1Q81U 1WHLA 4M78D 1OU9A 4HCBA 2KVQG 3QC8A 3EG1A 3CCEA 2VUBA 2B8AA 2FPEA 2QASA 4Z8AA 2JW4A 1A0NB 1LJOA 5KH6A 2X4YA 1RAIB 3FLGA 1OULA 3CBPA 2DD4A 3EGDB 1X43A 2LQ8A 1WHMA 2EYXA 2HBWA 2DTOA 3PIPA 2DXCA 3H41A 2QQAA 2JTEA 5FROA 4XU3A 3PIOA 5KYXB 3VV0A 3M0QA 4ESRA 4AMCA 1SHFA 1JQQA 3G1JA 4MDWA 3ZL7C 2GF7A 3OQ5A 4D8KA 5CKDA 2CUDA 2RI2A 2BUDA 2K7AA 4ZTJA 2LDMA 2RA2A 1QCFA 2DRMA 5GAMf 3S3OA 1KJWA 2FHDA 1ZQ1A 2CZ6B 3DLMA 3QQ7A 1BU1A 1YN8A 2KYMA 4BE1A 4IUTA 1P92A 4JJNK 1UJ0A 2L89A 2J05A 4PK4A 1Q82R 2JT4A 3HSBA 1RI0A 5GAMe 2YRCA 2EQUA 2ZPBB 4M75B 3I5SA 2OJ2A 3DB3A 3CMAQ 1VQPA 1WNLA 3EFSA 3CCUT 2CSQA 2HBPA 2NWMA 5GAN2 2DBMA 3SWNB 2HD0A 2X4XA 2XDPA 1VQ5A 2OTLT 3I35A 5I22A 1D1BA 1WPYA 3JCMJ 1UEBA 2E70A 3ULRB 5LJ5g 4M7AG 1BKBA 2SRCA 4ME7A 5GANf 4KRTA 1WYXA 4E7KA 1B7TA 1X75C 1M8VA 3CCEQ 1UGSB 3JAME 1D3BA 1D1CA 2QI2A 1ZBJA 2QXFA 3MPUB 1VQ4Q 2XIDA 1YJ9Q 2L5QA 3TSWA 2PVOB 2RK2A 2LCCA 1SKUB 2DZ9A 2ATCB 4EPCA 5GANe 1RI9A 5KYWA 1HD3A 1KK7A 3MKDA 2KY9A 1I8FA 3UF4A 4AFUC 2LQWA 3V7RA 1ZBXA 1ZC1A 5GAOn 5FTJA 2XD0A 2ZPEB 2J6OA 2MM2A 5ERGB 1KC8R 2XICA 2LJ0A 4Z89A 3HRUA 4VUBA 2J6KA 1VQ8T 4J7FA 5HY6A 4JLIA 4HCZA 2LCSA 4DBFA 2M16A 2E5KA 1ZUUA 2LMJA 2YSQA 4Y92A 4Z02A 1VQOQ 1VQNA 2MPXC 5FTLA 2JN0A 5FU7C 5CCAA 2HCKA 1C0MA 2V26A 2W10A 3X28B 3H0HA 4C8QC 4M7DC 2P0PA 4FT2A 1K9MU 1PSFA 3JB9F 2CP6A 1TXQA 2O9SA 3C4SA 2QQBA 3EGXA 2YVLA 4MZMA 2P4TA 1JXMA 3OB9A 4BDZA 4XAXB 4X9DA 1Q82U 4C5HA 1OZ2A 1IHVA 1KQ1A 4PJOF 3PMIA 2QGGA 2A08A 3VS6A 5IT9E 4JS4A 1VQPQ 1MV3A 4KO8A 1R0BG 2EJGA 5L8RE 3Q1JA 2A36A 4QQ6A 1VQ5Q 2P4RA 2G3RA 3PTAA 2L3RA 1KC8C 2DXBA 5GAMg 1QLYA 1BI3A 1CZ4A 1BCOA 1JU5C 4J7IA 3QXEB 2CP5A 2OI3A 4RUGA 3NMZC 2J7IA 2WSCE 3MJXA 5AYFA 2DBKA 4KT0E 4XTWA 1B34A 4N4IA 1D0ZA 1Z9QA 6AT1B 5IH2A 3M58A 2RHYA 5GJWB 5GMKm 1YI2Q 4HA8A 4EMKC 1WHHA 5LJ3h 1QKWA 5LJ5d 1G8XA 2D1XA 1SG5A 2QAZA 1T0HA 3JB9J 2L0AA 4IUQA 1IO6A 4CRIA 4KBMB 1TUCA 5GMKe 1GL5A 4AG2C 2HQEA 1O54A 2YUOA 2HEQA 1G3SA 1IHWA 2JS2A 1WQ7A 1QP2A 3WXMB 4DA4A 4ZGDB 1KHIA 3EHRA 4LE9A 5GANg 2Q1DX 3JB9I 3CC7T 1AWJA 5CCBA 1BK2A 2LP5A 2FZKB 1ZUKA 3CD6A 3CPWS 4F14A 2CSIA 5GAOm 2NYSA 2PUKB 3OYIA 4XU0A 1JXOA 2E6ZA 4J9DA 4PJLA 1BCMA 4P5NA 2LZ6B 5L23A 4JRPA 4D8DA 3HKSA 3FPTA 1WQWA 1N9RA 1RAFB 2OAWA 4C92F 3CQTA 3GPLA 4DEXA 2YT6A 1KD1R 5GAN3 2DZCA 4C0DB 1U5SA 2FRWA 4OB2B 4C8QA 2CZ1B 1K73C 4M7DA 2COZA 4EMHA 4C0ZA 2CYZB 1ACMB 1W1FA 3GOXA 3EAEA 1SEMA 2LW6A 4V2SA 4PNOA 4JJCA 2DVEA 1YWPA 2MYSA 3M57A 2XG8D 1VIEA 3A8LB 1VQLT 2M9UA 2EYQA 2KI7A 5KE3A 2NUZA 1BI0A 3ER0A 4KGZB 3A98A 3LX7A 4JS5A 1NJIC 2X4JA 3CPFA 3CXCP 4C8QE 2R58A 3CCRA 3NGPA 1UFFA 4X34A 3G4SA 1PCXA 2HDAA 4M7AF 3CMEA 3MP8A 1AZGB 5KYWB 1FMVA 4J6YA 2M0YA 2O4XA 4JRQA 3NFCA 5GAMd 4ELZC 5LJ3g 2D9TA 2MI6A 4LUDA 4EMKA 5IN1A 1NLPC 2Y90A 1N27A 1VIFA 2RI3A 3PMTA 4DBRA 5IXFA 2GQIA 1JJ2P 4QW2A 4FW2A 1YIJT 2V8IA 5EG2A 1M90R 2YLBA 4M75C 2WSEE 1AOJA 5CQYA 1NLOC 4AG1C 3LYIA 1YFNA 4GY5A 3GNGA 2E65A 3SWNC 7AT1B 3GIBA 1CKAA 4XU1A 4A54A 2P0QA 3CD6Q 2ZPHB 3OYMA 2KXCA 4EMGA 2NUPA 2D8HA 2K4YA 1N9SA 4A4EA 1FMWA 5DY9A 4LDUA 2YUJA 4FIBA 5GANd 2FPDA 3QQ8A 1UG1A 1LVKA 2GFAA 1OX9A 2RK1A 2VV5A 4ELYC 1W70A 1PKTA 3PNWC 2YHTA 1AD5A 2AHJB 2RB6A 3VS0A 2MIOA 4ZN1A 2CT4A 5GMKi 3QWZA 2LNHB 1KD1U 2DYIA 2JMCA 4J9CA 4BE0A 2CP0A 2RQUA 1VQPT 4LD9K 1E7OA 1QW1A 1HSQA 4X1VA 3HRSA 2RMOA 3EH1A 3CCRQ 4IUVA 1Q7YR 4KUIA 2D8JA 3CCQA 3G4SQ 4PFPA 3QZ5B 3V8JA 2CH4W 1X6GA 2V1QA 4OGEA 3MEVA 2DL8A 3NTHA 3QBYA 4DOVA 3L2ZA 2H8HA 1NYFA 3JRZA 3QPHA 3G7ZA 2LX9A 2X51A 4C0GA 5A0LA 5LJ5j 4AFZC 1QQJA 4K11A 4MMLA 1PD1A 1WA7A 3CXCA 1I1JA 2XDBA 2ZCFB 3P8DA 3J7AF 2AT1B 1QVGS 4FW1A 3L1AA 3CCUQ 4J6WA 3RKWA 3FPRA 2QDLA 4KH0B 2PVDB 3BW1A 3BFMA 3QDFA 3OS5A 3OMCA 2QYZA 5LJ3d 2OTLQ 2CS7A 4M75A 1C6VX 3UPUA 3MEAA 2IPOB 3OYFA 2AZVA 1QKXA 1M90U 4XTYA 3CCMA 4D6WA 5M9OA 4A4FA 1Y96B 3OBYA 2LTOA 3SWNA 1WDXA 2F69A 1UGVA 1JO8A 3D7SB 1TG0A 3L2QA 1ZA2B 2EKHA 1JJ2A 4RG8A 4C8QB 5FTKA 2E5QA 4BE2A 3S3MA 3THKA 1VQNT 1TUGB 1X6OA 4FM4B 2YRDA 4QKUA 2DA9A 5FWCA 2EGAA 3OW2P 3DB4A 1IXDA 4PL6A 1RLQC 2ECZA 3C94A 1B07A 2DPPB 1MMAA 1IGQA 1UGPB 4BI4A 3LWHA 5CQXA 2VASA 4BUGA 3VS1A 1VQ8Q 2DIGA 4PJOA 4M78F 1SHGA 3TVTA 3NHNA 4ANJA 3CCQQ 4LDYA 4MZTA 1V76A 5A0DA 2HQXA 2HQHA 5DYIA 1GCPA 4EMKB 1WIEA 1AWOA 3PGGA 3MEWA 1Q7YU 4M7AC 1TSFA 3JB9G 2ROTA 3OYCA 2QK0A 3OYDA 4IIOA 4PJOE 2YXYA 2K2VA 4A4GA 3I56T 3ME9A 3M0RA 4BD3A 4PJOG 4C0DC 4IKFA 4HT9A 2FZGB 1N8RR 4UC4A 5HCKA 1QWFA 1I07A 5KE2A 1CSKA 1MV0B 1SF9A 2NUPB 1YWOA 1VA7A 3O5ZA 1UTIA 3CCVA 5KCHA 1YCSB 4ZNXA 2VGNA 4RTZA 3CC4A 3HFOA 3HU1A 3TSZA 3CD6T 3OA6A 1OQKA 2DL4A 5B6CA 4N4GA 3EHQA 4OB0B 5IHIA 4WTOB 1RUWA 1EZZB 1D0YA 4M77D 1YIJA 2MWOA 1ABQA 5FW9A 3FPUA 2RQVA 2CP7A 2HSPA 4LDWA 4C8QD 3L42A 4M7DD 5GAOq 2JZ2A 3GLXA 3VJPA 2DL7A 3JCMf 3CC7Q 3GP8A 1H3HA 4AQ7A 4FYXB 4ZN3A 2D0QB 3REAB 4RTUA 1B3QA 1V29B 3I5RA 4PJJA 1QWEA 4C92E 3E2UA 3CCRT 2L3PA 3OW2A 1K1ZA 1K9MR 3FIFA 2EGEA 4C92G 3G4ST 2K3YA 2YLCA 2KBTA 5GAN4 3CMET 1OU8A 4OMMA 4J83A 1YNZA 3QO3A 4O6JA 3HPWA 3QIIA 4XK8E 3M56A 4M7AA 1MGQA 1K0SA 3DKMA 1NZ9A 3OSSC 2RF0A 2Y4XA 2K2MA 1Q86R 2PZ1A 1G3YA 1VQLQ 2AKLA 2QTVA 1E6GA 3NPFA 2K3BA 3LW5E 1MHNA 5LJ3j 4M7AE 4MZPA 1IB8A 4JRKA 1NYGA 3V7CA 5GAMh 2XDDA 1N8RU 4JLGA 2MOXA 2F2VA 1OX8A 2KNBB 4A63B 4FYWB 1VYVA 1M5Q1 4OMLA 1OPLA 3JV3A 1TWBA 1IGUA 4N4HA 3RERA 3S6WA 3HHTB 1N5ZA 2BKDN 2GBQA 1K9MC 1Z9ZA 2E3IA 1YITA 1RADB 3A8HB 4X9CA 1QVFP 4J5YA 3VS3A 2D0NA 3BY7A 2GCXA 1KG1A 3FJPA 2RN8A 3QKJA 4J8OA 4RG2A 1UB4A 3R6NA 2LQNA 1Q82C 2BE7D 1YIJQ 4LUEA 3EH2A 2E64A 4E2FB 1BI2A 1R7RA 1YCYA 1KSWA 4L6V5 1AEYA 4EDUA 4DOWA 2KE9A 4HCCA 2X3WD 4BI8B 4PJOB 5GANh 1VQKA 1GXIE 1KHCA 2KXDA 1HXDA 1VOMA 4MDXA 2QA4A 2DVJA 5FTMA 1BI1A 3CF2A 1WGSA 4L59A 3TIWA 2O31A 3CCQT 1E32A 4OP0A 3OYJA 4O5VA 4JJBA 3RKXA 2NLUA 4OGCA 2MM0A 1LCKA 4XQ3A 2NUTB 4C5EA 5GAN8 4FSSA 1X27A 4FCYA 2DO3A 3AHUA 3J81E 3ZEHA 4XU2A 4KULA 5GAN7 2MMPA 3KXTA 2FRYA 3H0FA 3L2VA 1Q86U 5GLFA 2ABLA 2YRVA 4M75D 4F16A 2WACA 4JDSA 2BZXA 2K6DA 1EFNA 3JCMb 1FMKA 1W2BP 3CEYA 3WVDB 3CCMT 3EG2A 1TU0B 3A8GB 1U8RA 3J80E 2DRKA 1Y0MA 3VU3C 4CC4B 1U1SA 3VUBA 1I81A 3FRNA 2KMTA 2LJ1A 1YITQ 3H6ZA 4GBQA 4XTXA 3I56A 2VYTA 1SRMA 4C92B 3C0CA 1SSFA 4TVRA 2ZZDA 2VGMA 5CKEA 3QSUA 2DJQA 1KIKA 2FB7A 1R0CB 3HL8A 3OY9A 2EWNA 4RCBA 3JCMP 5I2MA 4C5IA 1PRLC 2DTHA 4LDXA 4M4ZA 2DL3A 3EG3A 3BDUA 2DXTA 1IZ6A 1WZOA 1QVFA 2KK4A 2RJFA 1LOJA 3CCLA 5GMKh 2LC4A 4AT1B 1N6AA 1M1KR 2KAFA 4JZ4A 2E3HA 2F2WA 2K5LA 4NL3A 3EFOA 4M7AB 1Y96A 1VQNQ 2ZPIB 2HZYA 4J9BA 5GAOr 3GBQA 2FZCB 5CCXA 3HTRA 4PJNA 1FX7A 1FWZA 2X9HA 2HL5C 4AFSC 1UHFA 3JSCA 3M0TA 4KDLA 2CREA 2PWYA 3VYGA 4HVUA 4RTYA 2JM8A 4C0FA 1ZSZC 4M78E 3VS2A 4OMOA 2FPFA 2WSFE 3G6EA 4L5GA 5CK9A 5EPPA 4M78G 2EYZA 3OSVA 1YJWA 2XMFA 2BE9B 4F04B 2GFUA 4IURA 2QEXT 2RQWA 2B86A 2RQTA 4DBHA 1J3TA 3CCVT 4RTVA 5KYYA 2SEMA 3M4YA 3QJYA 1TOVA 2FEIA 8ATCB 3VRYA 3CC4T 2Z0WA 2RJEA 4OMQA 3SD4A 3G71T 2HSEB 3BQBA 4M77G 1PKSA 1VQ7T 1K4US 1D1AA 5D6WA 2CKKA 2KT8A 5A2QE 3I56Q 4PLIA 3VS4A 1M3CA 1R77A 2FO0A 1KD1C 3MCAB 2YUNA 2HNIA 1E6HA 1S72T 5D6XA 1MNEA 4PLLA 2JTFA 1W2BA 4LD6A 2RHZA 4Q5WA 2HL3A 4BDYA 4R0KA 1MNDA 4ZGJB 3FC3A 4F7UG 3ZJTA 1I5LA 1NE8A 3RR6A 2DL5A 1JEGA 1BYMA 2EBPA 4IIMA 2LVMA 2RHUA 3RMQA 1ZHIA 3CBOA 4J9HA 2ZPFB 1LNXA 3I55A 1M1KU 5CD1A 3OYYA 1NG2A 2R5MA 1V1CA 5KCOA 2J06A 2VXEA 3LGLA 1KQ2A 5CR2A 4XTVA 1MMGA 3TEEA 1WHKA 1UECA 4M7AD 2CP2A 3UA7A 2KEAA 2RM4A 2V8JA 4B6MA 1YP5A 1UE9A 2KSSA 4ARIA 4RCCA 1YHQA 3NTKA 2GGRA 1M90C 1XNIA 1PRMC 1D09B 1ZSZA 2MCNA 3G6EQ 4PJOC 1JRIA 1M2VA 1HK9A 2LT1A 2QTXA 1QVPA 1I9GA 1M3BA 1SRLA 3CMEQ 5DYGA 2IIMA 1OPKA 3C12A 3R6OA 3X25B 2GTJA 2MK5A 1AWWA 5CKFA 2K5FA 1K8AR 4Y28E 2R57A 1YITT 4ORZA 2OTJA 1TS9A 2X3XD 2LNVA 2YUPA 4J9GA 3OYAA 2VVKA 3L2RA 2RJDA 1YBYA 1NEGA 1X01A 4QT7A 3RUXA 2DEUA 5KYUA 1H3ZA 2DIQA 1VUBA 1O9SA 2A37A 1EIFA 3UWNA 2KRSA 2EVRA 1WLPB 1G83A 3BE3A 2KDSA 3EFOB 5DLQE 1VQKT 1DJ7B 4OVAA 3S3NA 4BACA 5GJVB 3TQ7P 1GBQA 4M78B 5KYNA 4KUDK 5FTNA 2QA4T 1Q7YC 1NPRA 2Q19X 1ARKA 2K5IA 3JCMQ 3I55Q 2JVVA 3QDRB 2MF2A 4LDVA 4PKCC 1G2BA 2ESWA 4C92C 5HK0A 4E7JA 2L8DA 1H8KA 3E9GA 4JJDA 1OYXA 5CKHA 1VQMA 1PSEA 2F5TX 2X35A 5GAOp 3UATA 2JMAA 5KYYB 4J9EA 5DLOA 2K79A 1H92A 3LGFA 4FT4A 3UA6A 4YTLA 4HVVA 3QJ6A 2AIRB 1HJDA 2CDTA 4GLKA 4RTWA 2VB6A 3CPWP 4F7UB 3M0PA 4LXCA 4CC3A 1ABOA 2JV2A 1WJQA 1XJWB 1Q95G 5C18A 2E41A 5HKCA 1UDLA 2F5KA 2LQKA 4CC2A 3KUFA 4R55A 5GAMj 2A7YA 4QVZA 1GBRA 4M77F 2LCLA 3P8BB 1K8AU 2ED0A 5LJ5f 1W6XA 4M7DF 2NUTA 2LRQA 2VWFA 2CH4A 1NEBA 1FXXA 2Q18X 4RTXA 2QEXA 2EIFA 2BIVA 5FRNA 1OOTA 5LJ5e 1BIAA 3CCMQ 3RDVA 2MWPA 4F7UF 3CCLT 3CMAA 3TCJA 1FYNA 2YDLA 1HYOA 3G71A 4A4HA 5FU6B 1VQ7A 2JS0A 2CZ0B 1WXBA 5C6SA 5GANj 2BZYA 2DE0X 2DYBA 3LGAA 2DKGA 3A8OB 4DQ2A 4NL2A 1YJNA 1S72A 2GNCA 1BBZA 3M9QA 4JPBW 1PWTA 2M1HA 1PG5B 5IXBA 1VQ4A 1YJ9A 4C92A 1ZSZB 1WXUA 2IG0A 4ZGEB 4J9FA 4IUPA 4E6RA 1M2VB 1VQMQ 1N8RC 2M0OA 1NPPA 4BY6B 1KQSS 3VRZA 3PVLA 3PFSA 3G6ET 3QYGB 4JZ3A 1G3TA 1YJWT 1ZA1B 2Q1CX 3JCMe 1T3LA 5J39A 4RV0A 1K9AA 3TREA 3CXCS 1VQ6A 3HU2A 4OF1A 4KH1B 3M4GA 2ROLA 4CI0C 5C1BA 3FJ5A 1GFCA 2DTIA 1T3SA 3QG1A 2DEQA 5KYUB 3L2WA 1QDNA 2PNIA 2XK0A 2M51A 2DFUA 3JCMh 4QVDA 1VQOA 3SB2A 2CUBA 2QQSA 3QWYA 3OBWA 3CPWA 4Z88A 5HK3A 2HKQB 4LNPA 2ED1A 3OYNA 3N5BB 4KGXB 1GRIA 1RAAB 2QEXQ 2Q1AX 1AWXA 1WXTA 4OMPA 3CC2A 4JRIA 1Y7XA 3CCVQ 5ECAA 4KDIA 1JJ2S 1ZSGA 2G6FX 4RKUE 3A5ZB 3X26B 3EG0A 3CC4Q 2DM1A 2HMAA 2H3EB 1T0JA 2VC8A 4FSXA 3ZJVA 3NTIA 2C06A 3G71Q 1VQ7Q 2DXUA 1VQ9T 2HKNA 4E7IA 2E1HA 3EGUA 2A3LA 4E7LA 1G5VA 2H3JA 2FYKA 1Y71A 1GFDA 4OMNA 1M8MA 1UGQB 3I55T 2RNAA 4R56A 5GMKj 1YJNQ 1S72Q 2VXFA 1VYUA 2EKOA 2EW3A 2AK5A 2B25A 1QVGP 1Q86C 1YI2A 4AS1A 3M54A 5CVIA 3P8HA 3RNJA 4C5GA 2M02A 4II1A 1YHQT 1QCSA 1CKBA 1XQHA 2F2XA 3HU3A 4M75F 1C1AA 1QMCA 3INZA 3CCST 2E6NA 2PU9B 3V7SA 4OMFB 3FDRA 3C95A 4M78C 3JB9H 2I0NA 2JXBA 5FRMA 3RESA 4ARCA 2I2LA 4HVWA 1VQ6Q 3U23A 2KROA 4HKEA 2L3SA 2PQWA 5GAN6 1UGRB 4PJMA 2ZGWA 1PHTA 5D6YA 3VS5A 3PE0A 3OS1A 2O2OA 2OTJT 4BB7A 2KGTA 3JCMg 1RABB 3ZFJA 4M77C 1R8OB 5D7UA 2DF6A 3M0UA 3OS0A 2JUFA 5I2SA 3REBB 2RD1A 3EG9A 2KRNA 3OYEA 3CC2Q 2ENMA 2DMOA 1SPKA 3CCJA 5LJ3f 1AVZC 2RH2A 2K3XA 3SHWA 1RAGB 2KT1A 2QGFB 2CZ7B 1OI1A 5FWBA 2PJHB 1M27C 1AHJB 2RI5A 1K0XA 4ATOA 5LJ3e 2RPNA 4FYVB 3ZJUA 4N0AC 4A4KA 1I0CA 1RAHB 3M59A 3DLLA 3RIRA 2R5AA 3VYHB 3VS7A 3HP9A 1VQKQ 1K73R 1VQMT 3SDZA 3JB9D 3OW2S 3MEUA 3QYHB 2RJCA 3LHDA 2GTOA 2QA4Q 2DD5A 2EYYA 3H0IA 4GLMA 2J6FA 2E10A 3JCMW 1OV3A 2FVUA 3OYKA 2DJZA 2XHCA 4PJOD 1X69A 4AFQC 1NJIR 3A1PA 1SSHA 1MMNA 1QVGA 2PVGB 4HCKA 5FU6C 4M78A 2CT3A 3PVQA 1XOVA 4PFZA 3OMGA 2ZPGB 1X2KA 4EIKA 1OZ3A 3L2UA 1KC8U 4E47A 3AT1B 3H8ZA 3ASKA 2DAQA 4FYYB 2PTKA 5IHKA 4ZTFA 3SEMA 4LN2A 5GAN5 3MHXA 4M77A 2XI9A 3QHSA 1GCQC 4BY6C 3X20B 1WHGA 4FL6A 1KQSP 2P84A 3JCMd 2QQ9A 3CCJQ 1D0XA 1I4K1 2EGCA 1M1KC 2KQWA 4CQNA 3WVEB 4M77E 3MB5A 3CMAT 2LX7A 3EFRA 4Y91A 3HRTA 4F17A 5CAIA 4JUVA 1QCNA 2O01E 1X2QA 2P0KA 1D3BB 2QDYB 4F7UA 4M7DE 4B9XA 2DILA 2C0OA 2DETA 2L3QA 2V8KA 4IUUA 3E1SA 4C8QG 4M7DG 3LLRA 1M3AA 1UJYA 4N0AA 5J26A 3RBBB 1YJNT 2KYBA 5LL6S 3CCET 2GQVA 3JCMc 1VQ4T 2HAXA 2EQKA 4C92D 1YJ9T 4B9WA 5CKBA 4F7UE 2DNUA 4WCIA 1MUZA 4E7HA 1BIBA 3IQLA 4MMKA 2Y4YA 3CCLQ 5EQJB 4QQDA 1M30A 3CCUA 1KFZA 1LPLA 1M4ZA 5DM7R 1K73U 3META 5AT1B 1VQ9A 4RTTA 2OTLA 2MAMA 3E19A 2RHXA 1W4SA 1WHJA 3M55A 1JBMA 5IAYA 3ZGZA 2EJFA 1VQ6T 4RMOA 2FG0A 3RMSA 1NJIU 2BZ8A 3HFNA 1S3SA 4QQGA 1H641 2RQRA 3EG9B 1U1TA 3I9QA 1ZUYA 3T9NA 1VQOT 3EGXB 4DEYA 3GF5A 2A0FB 1WI7A 1M1FA 2LJ3A 2JTMA 3PT9A 1CR5A 3CCSA 4NOYA 2V1RA 2OX7A 8AT1B 3A8MB 1YJWQ 1GCQA 3EGDA 4E7ZA 3CC2T 2OAUA 3X24B 4J9IA 2DLPA 1MMDA 3GNFB 3UDCA 5KYXA 3CBMA 1NM7A 3UT1A 3F70A 2K9GA 1VQ8A 1B34B 1VQ5T 2ZAEA 4XTUA 1QCOA 1WJSA 1WX6A 3MP6A 3LH5A 1KQSA 3M5AA 1TH7A 3JCMX 3OYLA 2PUOB 1QVFS 1G3WA 1UUEA 2LT4A 4BI3A 2DX1A 1AZEA 2C0TA 1Y57A 2L2PA 1YI2T 5I11A 4OB3B 5GMKl 4XTZA 2X4WA 1F1BB 3FEOA 2EAYA 2FL7A 4WF2A 3MP1A 3OS2A 3KBGA 4NS5A 2E4HA 1Y07A 2KR3A 2EQMA 3VUZA 5A0GA 1Q81R 1VQ9Q 4KODA 1OEBA 2CP3A 2JM9A 5IHNA 2COYA 2AKKA 4KGVB 1PC0A 2W0ZA 1ZLMA 3RKYA 4QVCA 1CZ5A 1O75A 3KFVA 1RACB 2AZSA 1K8AC 3LH0A 1X6BA 2DK3A 2A28A 1TUDA 4M77B 5FU7B 3BDLA 3FB9A 2RHIA 3M53A 1IRXA 4A53A 1BB9A 3E9FA 5GAOl 4M75E 2XU8A 1WFWA 4M7DB 1VYTA 1YHQQ 5CO7A 9ATCB 2XKOC 2BTTA 2QG9B 4M75G 1IREB 3QUIA 3CCSQ 3VKIA 3LWIA 1PNJA 1NBEB 1UHCA 2IVWA 3V8KA 4CC7A 4OB1B 4KLNA 1I5OB 2JOYA 1EX4A 3QWXX 3M0SA 3CCJT 2EQJA 2YWWA 2O88A 2EYWA 3CC7A 1M1GA 1Q81C 1AT1B 4E7SA 1XTDA 3URGA 1WJRA 3O8VA 1S1NA 5FLXE 1RL2A 2EQIA 3OYBA 2JNGA 1PD0A 3TU4K 2JJ9A 1W2BS 1M2OA 2OTJQ 1M9SA 2YUQA 1WLFA 2C0IA 5J3BA 2O4XB 3H9NA 4J6XA 3V8LA 4C8QF 1QP3A 2KRMA 2EJ9A 5I21A 2DERA 4DBQA 5C0MA 2D6FA 2RO0A 3JCMV 1U3OA 3SFMA 2EFIA 2K57A 1JB0E 4HT8A 1RAEB 3QZ9B 1K76A 3MO8A 1ZX6A 5EC7A 1PM3A 1U06A 3OYGA 2O9VA 3OYHA 1VQLA
chains in the Genus database with same CATH topology
3CCQA 4M7AG 3JSCA 2CGHA 3QZ5B 4C5GA 1GXIE 3V8JA 4II1A 5CIUA 1YHQT 1QCSA 2QQRA 1XQHA 3HU3A 4OGEA 3MEVA 2E12A 3NTHA 3QBYA 4KDLA 4DOVA 3L2ZA 4M75F 3ZBDA 2PWYA 3JRZA 3QPHA 3G7ZA 3VYGA 4FU6A 3INZA 5LJ5h 3CCST 2E6NA 1Q81U 2LX9A 2PU9B 4C0FA 3V7SA 4M78D 4C0GA 4M78E 4OMFB 5A0LA 4HCBA 2KVQG 3QC8A 3FDRA 5LJ5j 3C95A 3CCEA 2VUBA 4MMLA 2B8AA 2WSFE 4M78C 3JB9H 3G6EA 3CXCA 4L5GA 5FRMA 5CK9A 2XDBA 2ZCFB 3P8DA 3RESA 4M78G 1LJOA 5KH6A 2X4YA 3OSVA 1YJWA 3J7AF 4ARCA 3FLGA 2I2LA 1QVGS 2GFUA 3L1AA 4IURA 2QEXT 4HKEA 4J6WA 3RKWA 2PQWA 5GAN6 3FPRA 3CBPA 2DD4A 3CCVT 1UGRB 2PVDB 2LQ8A 3BW1A 2ZGWA 3BFMA 3OS5A 3OMCA 5D6YA 5LJ3d 2CS7A 3M4YA 3QJYA 3OS1A 4M75A 3CC4T 3MEAA 2DTOA 3UPUA 2RJEA 3PIPA 3OYFA 2OTJT 2DXCA 4BB7A 3JCMg 2QQAA 3ZFJA 1M90U 4M77C 4XTYA 5FROA 3CCMA 3SD4A 4XU3A 4D6WA 5M9OA 4A4FA 3PIOA 3VV0A 3G71T 1Y96B 4M77G 1VQ7T 3BQBA 3OBYA 2LTOA 1R8OB 2CKKA 5D6WA 3SWNA 5A2QE 2F69A 4PLIA 3OS0A 2JUFA 5I2SA 4MDWA 2RD1A 3L2QA 3OYEA 1KD1C 2GF7A 3OQ5A 3MCAB 1JJ2A 5CKDA 2HNIA 1S72T 4RG8A 5D6XA 2RI2A 2E5QA 4C8QB 5FTKA 4PLLA 5LJ3f 3CCJA 4BE2A 2JTFA 3S3MA 1W2BA 2BUDA 4LD6A 1VQNT 2RHZA 2RH2A 2K3XA 4Q5WA 4ZTJA 2LDMA 2RA2A 1X6OA 4FM4B 2CZ7B 4BDYA 5GAMf 1OI1A 3S3OA 2FHDA 1ZQ1A 2CZ6B 3DB4A 2PJHB 3DLMA 4ZGJB 1AHJB 2RI5A 4F7UG 3FC3A 4ATOA 3QQ7A 4BE1A 4IUTA 1P92A 4PL6A 4JJNK 5LJ3e 3ZJTA 1I5LA 4ARIA 2L89A 1NE8A 3C94A 3ZJUA 2DPPB 4N0AC 1BYMA 1UGPB 2LVMA 4A4KA 4BI4A 3LWHA 3HSBA 2RHUA 3RMQA 1ZHIA 5CQXA 1RI0A 3CBOA 5GAMe 2ZPFB 1LNXA 3I55A 1M1KU 5CD1A 3OYYA 4BUGA 2EQUA 2ZPBB 3M59A 4M75B 2R5MA 3DLLA 3RIRA 5KCOA 2DIGA 2R5AA 4PJOA 4M78F 3VYHB 3DB3A 1VQPA 3HP9A 1WNLA 3EFSA 2VXEA 3LGLA 3CCUT 1KQ2A 5CR2A 2HBPA 4LDYA 4MZTA 4XTVA 5GAN2 1VQMT 5A0DA 2HQXA 3SWNB 5DYIA 3TEEA 2HD0A 3SDZA 3JB9D 3OW2S 4M7AD 2X4XA 3MEUA 2XDPA 4EMKB 1VQ5A 2RM4A 2V8JA 2OTLT 3QYHB 2RJCA 3LHDA 3PGGA 1WPYA 3JCMJ 3MEWA 1Q7YU 4M7AC 2DD5A 1UEBA 2E70A 5LJ5g 2KSSA 3JB9G 4RCCA 2E10A 3NTKA 3JCMW 1BKBA 3OYCA 2FVUA 4ME7A 5GANf 3OYKA 1YHQA 3OYDA 2DJZA 2XHCA 4E7KA 1M90C 4PJOD 1XNIA 4PJOE 1X75C 1M8VA 1UGSB 2K2VA 4A4GA 3JAME 1D3BA 3I56T 3ME9A 4PJOC 2QI2A 1QVGA 1JRIA 2QXFA 2PVGB 4BD3A 2XIDA 4PJOG 2L5QA 5FU6C 4C0DC 4M78A 2PVOB 4IKFA 1HK9A 2LT1A 2QTXA 2RK2A 4HT9A 1XOVA 1QVPA 3OMGA 2LCCA 1I9GA 2ZPGB 2DZ9A 4UC4A 1VQLT 4EPCA 5GANe 5KE2A 1OZ3A 3L2UA 5DYGA 1KC8U 2KY9A 4E47A 3C12A 3R6OA 1I8FA 3X25B 3CCVA 3H8ZA 3ASKA 2DAQA 3V7RA 5KCHA 4ZTFA 5CKFA 2K5FA 1ZBXA 2VGNA 5GAN5 1ZC1A 4Y28E 3CC4A 2R57A 3MHXA 1YITT 4M77A 3OYHA 2XI9A 3HFOA 2OTJA 3QHSA 5GAOn 3HU1A 5FTJA 2XD0A 3CD6T 2ZPEB 1YJ9T 4BY6C 3OA6A 2MM2A 5ERGB 3X20B 4FL6A 2LNVA 2XICA 3OYAA 3JCMd 2QQ9A 3L2RA 2RJDA 1YBYA 3HRUA 1X01A 3RUXA 5B6CA 4N4GA 1H3ZA 2DIQA 1I4K1 1VUBA 4OB0B 1M1KC 1O9SA 4VUBA 1VQ8T 1EIFA 4J7FA 3UWNA 5HY6A 2KQWA 4HCZA 4JLIA 4M77D 3WVEB 4M77E 3MB5A 4CQNA 1YIJA 3CMAT 2M16A 4Z02A 2MWOA 3EFRA 4Y91A 1VQNA 3HRTA 5FTLA 2KDSA 2JN0A 5DLQE 5FU7C 1VQKT 3FPUA 5CAIA 4JUVA 1DJ7B 4LDWA 2O01E 4C8QD 5CCAA 2P0KA 1D3BB 2QDYB 3L42A 4OVAA 4F7UA 5GAOq 4B9XA 4BACA 3S3NA 2JZ2A 4M7DD 4M7DE 3X28B 2V8KA 3GLXA 4C8QC 4M78B 4IUUA 3E1SA 4KUDK 4M7DC 2P0PA 4FT2A 3VJPA 1PSFA 4C8QG 2QA4T 3JCMf 1NPRA 1Q7YC 1K9MU 4M7DG 3JB9F 3LLRA 3GP8A 4AQ7A 3C4SA 2QQBA 2YVLA 4N0AA 5J26A 1YJNT 4MZMA 2Q19X 4ZN3A 2D0QB 2K5IA 3JCMQ 5LL6S 3CCET 2P4TA 3OB9A 2JVVA 2GQVA 4BDZA 4XAXB 3QDRB 2MF2A 4LDVA 4PKCC 4X9DA 3JCMc 1VQ4T 1Q82U 4C5HA 1OZ2A 2HAXA 1KQ1A 2EQKA 3PMIA 4PJOF 4C92D 1V29B 4B9WA 4C92E 5IT9E 5CKBA 4JS4A 3TIWA 4F7UE 3CCRT 4KO8A 3OW2A 4C92C 5HK0A 1VQOA 4E7JA 2EJGA 5L8RE 2L8DA 3Q1JA 3FIFA 4C92G 3G4ST 1BIBA 4E7HA 2K3YA 4MMKA 2Y4YA 3E9GA 4QQ6A 2YLCA 3CMET 5GAN4 4QQDA 5EQJB 3CCUA 4J83A 3QO3A 1OYXA 2G3RA 4O6JA 2L3RA 3PTAA 1KC8C 2DXBA 1M4ZA 3HPWA 5CKHA 3QIIA 1PSEA 4XK8E 5GAMg 1VQMA 5DM7R 1BI3A 3M56A 3META 2F5TX 2X35A 3QXEB 4J7IA 1K73U 1VQ9A 4M7AA 1MGQA 5GAOp 3DKMA 2WSCE 2OTLA 5AYFA 2MAMA 1NZ9A 3OSSC 5DLOA 2Y4XA 4KT0E 3E19A 4XTWA 1B34A 2RHXA 1W4SA 3LGFA 4N4IA 4FT4A 4YTLA 1G3YA 3M58A 2RHYA 3M55A 5GMKm 1JBMA 5IAYA 3QJ6A 4HA8A 4EMKC 3ZGZA 5LJ3h 2EJFA 5LJ5d 1VQ6T 4GLKA 4RMOA 3RMSA 1NJIU 4F7UB 3JB9J 3HFNA 4IUQA 3LW5E 1MHNA 5CVIA 5LJ3j 4M7AE 1S3SA 4CRIA 4MZPA 4KBMB 4QQGA 1H641 4JRKA 3V7CA 2XDDA 5GAMh 5GMKe 1N8RU 1U1TA 4JLGA 2JV2A 1WJQA 3T9NA 2HQEA 1O54A 5C18A 1VQOT 2E41A 5HKCA 2LQKA 2F5KA 3GF5A 3KUFA 4R55A 1M1FA 5GAMj 1G3SA 1M5Q1 2A7YA 4QVZA 2JTMA 4M77F 2LCLA 3PT9A 1WQ7A 1QP2A 4N4HA 3WXMB 3CCSA 4DA4A 4ZGDB 3RERA 1CR5A 1KHIA 3P8BB 4NOYA 3S6WA 1K8AU 3A8MB 5LJ5f 3HHTB 5GANg 2Q1DX 2BKDN 3JB9I 1K9MC 1YITA 4M7DF 3CC7T 2LRQA 5CCBA 3A8HB 4X9CA 3CC2T 4J5YA 2OAUA 3CD6A 3X24B 3CPWS 3BY7A 2GCXA 1KG1A 3FJPA 5GAOm 1FXXA 2PUKB 3QKJA 4XU0A 3OYIA 2Q18X 4J8OA 2E6ZA 4RG2A 1UB4A 2EIFA 3GNFB 2BIVA 2QEXA 1Q82C 5FRNA 3UDCA 4P5NA 4JRPA 3CBMA 3UT1A 2E64A 5LJ5e 1BI2A 1BIAA 3HKSA 1R7RA 3F70A 3FPTA 1WQWA 1N9RA 1YCYA 1VQ8A 4L6V5 4C92F 5FTNA 1B34B 2MWPA 4EDUA 4F7UF 1VQ5T 3CCLT 3CMAA 4DOWA 3TCJA 4HCCA 3GPLA 4XTUA 4BI8B 1WJSA 4PJOB 5GANh 1VQKA 5GAN3 2DZCA 3MP6A 4A4HA 4C0DB 1KHCA 1TH7A 3M5AA 4OB2B 5FU6B 4C8QA 3G71A 2CZ1B 1K73C 1KQSA 1VQ7A 4M7DA 2CZ0B 4EMHA 4C0ZA 1HXDA 3JCMX 5C6SA 3OYLA 5GANj 2PUOB 1QVFS 1G3WA 4MDXA 2CYZB 2LT4A 4BI3A 2QA4A 3LGAA 2DKGA 3GOXA 3EAEA 2LW6A 3A8OB 4DQ2A 1BI1A 4NL2A 5FTMA 3CF2A 1YJNA 4V2SA 1WGSA 4PNOA 1S72A 1YI2T 3M9QA 2DVEA 3M57A 2XG8D 4L59A 1VIEA 4OB3B 2M1HA 3A8LB 5GMKl 2M9UA 2EYQA 2X4WA 4XTZA 3FEOA 3ER0A 1BI0A 5KE3A 3CCQT 3LX7A 4JS5A 1VQ4A 2EAYA 1NJIC 1E32A 2X4JA 3CPFA 2FL7A 4WF2A 4OP0A 4C8QE 2R58A 4C92A 3OYJA 4O5VA 1YJ9A 3MP1A 3OS2A 2IG0A 3KBGA 3RKXA 4ZGEB 4NS5A 3CCRA 2NLUA 4IUPA 1Y07A 4OGCA 2MM0A 2EQMA 3VUZA 4XQ3A 5A0GA 1N8RC 2M0OA 4X34A 3G4SA 4KODA 1NPPA 4BY6B 4M7AF 4C5EA 5GAN8 3CMEA 3MP8A 1KQSS 2DO3A 3AHUA 3PFSA 3J81E 3RKYA 3G6ET 4J6YA 3ZEHA 3QYGB 4QVCA 1CZ5A 1O75A 4XU2A 1G3TA 2O4XA 4KULA 3NFCA 5GAMd 4JRQA 1YJWT 5GAN7 1K8AC 3LH0A 4ELZC 5LJ3g 2D9TA 2Q1CX 2DK3A 2MI6A 2MMPA 3KXTA 4EMKA 3JCMe 5IN1A 5J39A 3L2VA 1Q86U 4M77B 5FU7B 4RV0A 3BDLA 5GLFA 3FB9A 2RHIA 2YRVA 3TREA 3CXCS 3M53A 4A53A 1VQ6A 3HU2A 2Y90A 3E9FA 4M75D 1N27A 1VIFA 2RI3A 2XU8A 3M4GA 3PMTA 2WACA 4M75E 4OF1A 4JDSA 4QW2A 4CI0C 1YIJT 4M7DB 5C1BA 2V8IA 5CO7A 2DTIA 5EG2A 2YLBA 4M75C 3JCMb 2WSEE 3QG1A 2XKOC 3CEYA 5CQYA 3WVDB 3CCMT 4M75G 2DEQA 3LYIA 1IREB 3A8GB 3QUIA 1U8RA 3L2WA 4GY5A 3J80E 1QDNA 2XK0A 3VU3C 3GNGA 1U1SA 3JCMh 1I81A 2E65A 3FRNA 2KMTA 3VKIA 3SB2A 3VUBA 4QVDA 3LWIA 3SWNC 3V8KA 2IVWA 2QQSA 3GIBA 4OB1B 4KLNA 3H6ZA 3OBWA 4XU1A 3CPWA 4XTXA 5HK3A 3I56A 4A54A 2P0QA 5GAOl 2VYTA 2JOYA 2ZPHB 4C92B 3OYNA 3OYMA 3CCJT 2EQJA 4EMGA 3N5BB 4A4EA 2K4YA 1N9SA 1SSFA 4TVRA 2ZZDA 2VGMA 5CKEA 3CC7A 2Q1AX 1M1GA 1Q81C 3QSUA 3CC2A 4JRIA 1XTDA 2FB7A 5DY9A 1Y7XA 3URGA 1WJRA 4LDUA 4FIBA 5GANd 2YUJA 4KDIA 3O8VA 3HL8A 3QQ8A 5FLXE 1RL2A 3OYBA 2GFAA 2EWNA 3OY9A 1JJ2S 4RCBA 3JCMP 2JNGA 4RKUE 3A5ZB 5I2MA 3X26B 4C5IA 2RK1A 2VV5A 3TU4K 1W2BS 4ELYC 2DTHA 4LDXA 1M9SA 2VC8A 4FSXA 1WLFA 5J3BA 3PNWC 3ZJVA 2YHTA 2O4XB 3BDUA 3NTIA 2AHJB 2DXTA 2C06A 1IZ6A 4J6XA 3V8LA 2RB6A 4C8QF 2DXUA 1QP3A 1VQ9T 1QVFA 2EJ9A 2KK4A 4ZN1A 4E7IA 2E1HA 2RJFA 1LOJA 2A3LA 4E7LA 5GMKh 2H3JA 5I21A 2LC4A 3CCLA 1G5VA 1CZ4A 2FYKA 1Y71A 1N6AA 5C0MA 5GMKi 2KAFA 2D6FA 2RO0A 3QWZA 1UGQB 3I55T 1KD1U 3JCMV 3SFMA 4BE0A 4R56A 2EFIA 5GMKj 5EPPA 2K57A 1JB0E 4HT8A 2K5LA 3QZ9B 2VXFA 4NL3A 4M7AB 3MO8A 1VQPT 1Y96A 2EKOA 2B25A 2ZPIB 4LD9K 1QW1A 5GAOr 3OYGA 1Q86C 3HRSA 1YI2A 4AS1A 4IUVA 5CCXA 3M54A 3P8HA 1FX7A 1FWZA 1VQLA 4KUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IG0 A;  3E9G A;  2HQX A;  4QQ6 A;  4NS5 A;  2NLU A;  4QQD A;  4IUP A;  2X4X A;  4C5G A;  3MEU A;  1OYX A;  2EQM A;  2G3R A;  2L3R A;  2XDP A;  4II1 A;  2M0O A;  4X34 A;  2QQR A;  2RJC A;  3QII A;  5CIU A;  3MEV A;  3NTH A;  3QBY A;  3MET A;  3MEW A;  2X35 A;  4C5E A;  3MP8 A;  3NTK A;  4FU6 A;  3OYC A;  3OYK A;  2E6N A;  3OYD A;  4E7K A;  1XNI A;  3PFS A;  2RHX A;  3ZEH A;  3LGF A;  4N4I A;  4A4G A;  2O4X A;  3FDR A;  3ME9 A;  2B8A A;  2RHY A;  3LH0 A;  4BD3 A;  5IAY A;  3QJ6 A;  2D9T A;  5FRM A;  4IKF A;  3P8D A;  5KH6 A;  5IN1 A;  2X4Y A;  5J39 A;  3L2V A;  3FLG A;  3OMG A;  2LCC A;  3BDL A;  2GFU A;  4UC4 A;  2RHI A;  4IUR A;  2YRV A;  2PQW A;  4IUQ A;  1MHN A;  5KE2 A;  3E9F A;  4CRI A;  1N27 A;  1OZ3 A;  2RI3 A;  3PMT A;  4QQG A;  3L2U A;  2WAC A;  4QW2 A;  3OMC A;  1WJQ A;  5D6Y A;  2HQE A;  3CEY A;  3OS1 A;  3H8Z A;  3ASK A;  2DAQ A;  3MEA A;  2F5K A;  5KCH A;  3LYI A;  2RJE A;  4ZTF A;  3KUF A;  3OYF A;  3L2W A;  4GY5 A;  2XK0 A;  4QVZ A;  5FRO A;  2R57 A;  3SD4 A;  4N4H A;  5M9O A;  4A4F A;  3OYH A;  2QQS A;  2LTO A;  5D6W A;  2CKK A;  3S6W A;  3H6Z A;  2BKD N;  4PLI A;  3OS0 A;  3OA6 A;  2LRQ A;  2VYT A;  4FL6 A;  3OYM A;  3OYN A;  2EQJ A;  3L2Q A;  3OYA A;  4A4E A;  3OYE A;  1SSF A;  2GF7 A;  3OQ5 A;  2RJD A;  3L2R A;  4N4G A;  5D6X A;  1H3Z A;  2DIQ A;  2E5Q A;  2RI2 A;  3QKJ A;  4PLL A;  3OYI A;  4BE2 A;  1WJR A;  2JTF A;  4RG2 A;  3S3M A;  2BUD A;  2BIV A;  3O8V A;  4LD6 A;  2RHZ A;  5FRN A;  3OYB A;  2GFA A;  3OY9 A;  2K3X A;  3UWN A;  4Q5W A;  4ZTJ A;  2LDM A;  4HCZ A;  3UT1 A;  4C5I A;  2M16 A;  3F70 A;  4Z02 A;  2MWO A;  4BDY A;  1OI1 A;  3S3O A;  2MWP A;  3PNW C;  4EDU A;  2FHD A;  2O4X B;  2P0K A;  3DB4 A;  3L42 A;  3NTI A;  4OVA A;  4BAC A;  3DLM A;  4B9X A;  2RI5 A;  2JZ2 A;  1WJS A;  3FC3 A;  3S3N A;  4BE1 A;  4IUT A;  4PL6 A;  3MP6 A;  4IUU A;  4A4H A;  1KHC A;  4E7I A;  2RJF A;  4E7L A;  1G5V A;  2L89 A;  3OYL A;  3LLR A;  5C0M A;  5C6S A;  3C4S A;  2RO0 A;  5J26 A;  2LVM A;  4BE0 A;  2EFI A;  4E7H A;  2RHU A;  3GOX A;  3EAE A;  1RI0 A;  3OB9 A;  4BDZ A;  1WGS A;  3MO8 A;  2EQU A;  1OZ2 A;  2EKO A;  3M9Q A;  2EQK A;  2R5M A;  3PMI A;  4C5H A;  5KCO A;  4B9W A;  4L59 A;  2DIG A;  2R5A A;  2M1H A;  2X4W A;  3DB3 A;  3FEO A;  5KE3 A;  3OS2 A;  3OYG A;  3LX7 A;  3LGL A;  4E7J A;  4IUV A;  2L8D A;  2R58 A;  3Q1J A;  3OYJ A;  3P8H A;  2K3Y A;  3MP1 A; 
#chains in the Genus database with same CATH topology
 4HXJ A;  2CGH A;  4PFO A;  5CIU A;  1RLP C;  2QQR A;  1TTH B;  2F1L A;  2E12 A;  2EPD A;  2COW A;  2VKN A;  3ZBD A;  5LJ5 h;  4FU6 A;  1Q81 U;  1WHL A;  4M78 D;  1OU9 A;  4HCB A;  2KVQ G;  3QC8 A;  3EG1 A;  3CCE A;  2VUB A;  2B8A A;  2FPE A;  2QAS A;  4Z8A A;  2JW4 A;  1A0N B;  1LJO A;  5KH6 A;  2X4Y A;  1RAI B;  3FLG A;  1OUL A;  3CBP A;  2DD4 A;  3EGD B;  1X43 A;  2LQ8 A;  1WHM A;  2EYX A;  2HBW A;  2DTO A;  3PIP A;  2DXC A;  3H41 A;  2QQA A;  2JTE A;  5FRO A;  4XU3 A;  3PIO A;  5KYX B;  3VV0 A;  3M0Q A;  4ESR A;  4AMC A;  1SHF A;  1JQQ A;  3G1J A;  4MDW A;  3ZL7 C;  2GF7 A;  3OQ5 A;  4D8K A;  5CKD A;  2CUD A;  2RI2 A;  2BUD A;  2K7A A;  4ZTJ A;  2LDM A;  2RA2 A;  1QCF A;  2DRM A;  5GAM f;  3S3O A;  1KJW A;  2FHD A;  1ZQ1 A;  2CZ6 B;  3DLM A;  3QQ7 A;  1BU1 A;  1YN8 A;  2KYM A;  4BE1 A;  4IUT A;  1P92 A;  4JJN K;  1UJ0 A;  2L89 A;  2J05 A;  4PK4 A;  1Q82 R;  2JT4 A;  3HSB A;  1RI0 A;  5GAM e;  2YRC A;  2EQU A;  2ZPB B;  4M75 B;  3I5S A;  2OJ2 A;  3DB3 A;  3CMA Q;  1VQP A;  1WNL A;  3EFS A;  3CCU T;  2CSQ A;  2HBP A;  2NWM A;  5GAN 2;  2DBM A;  3SWN B;  2HD0 A;  2X4X A;  2XDP A;  1VQ5 A;  2OTL T;  3I35 A;  5I22 A;  1D1B A;  1WPY A;  3JCM J;  1UEB A;  2E70 A;  3ULR B;  5LJ5 g;  4M7A G;  1BKB A;  2SRC A;  4ME7 A;  5GAN f;  4KRT A;  1WYX A;  4E7K A;  1B7T A;  1X75 C;  1M8V A;  3CCE Q;  1UGS B;  3JAM E;  1D3B A;  1D1C A;  2QI2 A;  1ZBJ A;  2QXF A;  3MPU B;  1VQ4 Q;  2XID A;  1YJ9 Q;  2L5Q A;  3TSW A;  2PVO B;  2RK2 A;  2LCC A;  1SKU B;  2DZ9 A;  2ATC B;  4EPC A;  5GAN e;  1RI9 A;  5KYW A;  1HD3 A;  1KK7 A;  3MKD A;  2KY9 A;  1I8F A;  3UF4 A;  4AFU C;  2LQW A;  3V7R A;  1ZBX A;  1ZC1 A;  5GAO n;  5FTJ A;  2XD0 A;  2ZPE B;  2J6O A;  2MM2 A;  5ERG B;  1KC8 R;  2XIC A;  2LJ0 A;  4Z89 A;  3HRU A;  4VUB A;  2J6K A;  1VQ8 T;  4J7F A;  5HY6 A;  4JLI A;  4HCZ A;  2LCS A;  4DBF A;  2M16 A;  2E5K A;  1ZUU A;  2LMJ A;  2YSQ A;  4Y92 A;  4Z02 A;  1VQO Q;  1VQN A;  2MPX C;  5FTL A;  2JN0 A;  5FU7 C;  5CCA A;  2HCK A;  1C0M A;  2V26 A;  2W10 A;  3X28 B;  3H0H A;  4C8Q C;  4M7D C;  2P0P A;  4FT2 A;  1K9M U;  1PSF A;  3JB9 F;  2CP6 A;  1TXQ A;  2O9S A;  3C4S A;  2QQB A;  3EGX A;  2YVL A;  4MZM A;  2P4T A;  1JXM A;  3OB9 A;  4BDZ A;  4XAX B;  4X9D A;  1Q82 U;  4C5H A;  1OZ2 A;  1IHV A;  1KQ1 A;  4PJO F;  3PMI A;  2QGG A;  2A08 A;  3VS6 A;  5IT9 E;  4JS4 A;  1VQP Q;  1MV3 A;  4KO8 A;  1R0B G;  2EJG A;  5L8R E;  3Q1J A;  2A36 A;  4QQ6 A;  1VQ5 Q;  2P4R A;  2G3R A;  3PTA A;  2L3R A;  1KC8 C;  2DXB A;  5GAM g;  1QLY A;  1BI3 A;  1CZ4 A;  1BCO A;  1JU5 C;  4J7I A;  3QXE B;  2CP5 A;  2OI3 A;  4RUG A;  3NMZ C;  2J7I A;  2WSC E;  3MJX A;  5AYF A;  2DBK A;  4KT0 E;  4XTW A;  1B34 A;  4N4I A;  1D0Z A;  1Z9Q A;  6AT1 B;  5IH2 A;  3M58 A;  2RHY A;  5GJW B;  5GMK m;  1YI2 Q;  4HA8 A;  4EMK C;  1WHH A;  5LJ3 h;  1QKW A;  5LJ5 d;  1G8X A;  2D1X A;  1SG5 A;  2QAZ A;  1T0H A;  3JB9 J;  2L0A A;  4IUQ A;  1IO6 A;  4CRI A;  4KBM B;  1TUC A;  5GMK e;  1GL5 A;  4AG2 C;  2HQE A;  1O54 A;  2YUO A;  2HEQ A;  1G3S A;  1IHW A;  2JS2 A;  1WQ7 A;  1QP2 A;  3WXM B;  4DA4 A;  4ZGD B;  1KHI A;  3EHR A;  4LE9 A;  5GAN g;  2Q1D X;  3JB9 I;  3CC7 T;  1AWJ A;  5CCB A;  1BK2 A;  2LP5 A;  2FZK B;  1ZUK A;  3CD6 A;  3CPW S;  4F14 A;  2CSI A;  5GAO m;  2NYS A;  2PUK B;  3OYI A;  4XU0 A;  1JXO A;  2E6Z A;  4J9D A;  4PJL A;  1BCM A;  4P5N A;  2LZ6 B;  5L23 A;  4JRP A;  4D8D A;  3HKS A;  3FPT A;  1WQW A;  1N9R A;  1RAF B;  2OAW A;  4C92 F;  3CQT A;  3GPL A;  4DEX A;  2YT6 A;  1KD1 R;  5GAN 3;  2DZC A;  4C0D B;  1U5S A;  2FRW A;  4OB2 B;  4C8Q A;  2CZ1 B;  1K73 C;  4M7D A;  2COZ A;  4EMH A;  4C0Z A;  2CYZ B;  1ACM B;  1W1F A;  3GOX A;  3EAE A;  1SEM A;  2LW6 A;  4V2S A;  4PNO A;  4JJC A;  2DVE A;  1YWP A;  2MYS A;  3M57 A;  2XG8 D;  1VIE A;  3A8L B;  1VQL T;  2M9U A;  2EYQ A;  2KI7 A;  5KE3 A;  2NUZ A;  1BI0 A;  3ER0 A;  4KGZ B;  3A98 A;  3LX7 A;  4JS5 A;  1NJI C;  2X4J A;  3CPF A;  3CXC P;  4C8Q E;  2R58 A;  3CCR A;  3NGP A;  1UFF A;  4X34 A;  3G4S A;  1PCX A;  2HDA A;  4M7A F;  3CME A;  3MP8 A;  1AZG B;  5KYW B;  1FMV A;  4J6Y A;  2M0Y A;  2O4X A;  4JRQ A;  3NFC A;  5GAM d;  4ELZ C;  5LJ3 g;  2D9T A;  2MI6 A;  4LUD A;  4EMK A;  5IN1 A;  1NLP C;  2Y90 A;  1N27 A;  1VIF A;  2RI3 A;  3PMT A;  4DBR A;  5IXF A;  2GQI A;  1JJ2 P;  4QW2 A;  4FW2 A;  1YIJ T;  2V8I A;  5EG2 A;  1M90 R;  2YLB A;  4M75 C;  2WSE E;  1AOJ A;  5CQY A;  1NLO C;  4AG1 C;  3LYI A;  1YFN A;  4GY5 A;  3GNG A;  2E65 A;  3SWN C;  7AT1 B;  3GIB A;  1CKA A;  4XU1 A;  4A54 A;  2P0Q A;  3CD6 Q;  2ZPH B;  3OYM A;  2KXC A;  4EMG A;  2NUP A;  2D8H A;  2K4Y A;  1N9S A;  4A4E A;  1FMW A;  5DY9 A;  4LDU A;  2YUJ A;  4FIB A;  5GAN d;  2FPD A;  3QQ8 A;  1UG1 A;  1LVK A;  2GFA A;  1OX9 A;  2RK1 A;  2VV5 A;  4ELY C;  1W70 A;  1PKT A;  3PNW C;  2YHT A;  1AD5 A;  2AHJ B;  2RB6 A;  3VS0 A;  2MIO A;  4ZN1 A;  2CT4 A;  5GMK i;  3QWZ A;  2LNH B;  1KD1 U;  2DYI A;  2JMC A;  4J9C A;  4BE0 A;  2CP0 A;  2RQU A;  1VQP T;  4LD9 K;  1E7O A;  1QW1 A;  1HSQ A;  4X1V A;  3HRS A;  2RMO A;  3EH1 A;  3CCR Q;  4IUV A;  1Q7Y R;  4KUI A;  2D8J A;  3CCQ A;  3G4S Q;  4PFP A;  3QZ5 B;  3V8J A;  2CH4 W;  1X6G A;  2V1Q A;  4OGE A;  3MEV A;  2DL8 A;  3NTH A;  3QBY A;  4DOV A;  3L2Z A;  2H8H A;  1NYF A;  3JRZ A;  3QPH A;  3G7Z A;  2LX9 A;  2X51 A;  4C0G A;  5A0L A;  5LJ5 j;  4AFZ C;  1QQJ A;  4K11 A;  4MML A;  1PD1 A;  1WA7 A;  3CXC A;  1I1J A;  2XDB A;  2ZCF B;  3P8D A;  3J7A F;  2AT1 B;  1QVG S;  4FW1 A;  3L1A A;  3CCU Q;  4J6W A;  3RKW A;  3FPR A;  2QDL A;  4KH0 B;  2PVD B;  3BW1 A;  3BFM A;  3QDF A;  3OS5 A;  3OMC A;  2QYZ A;  5LJ3 d;  2OTL Q;  2CS7 A;  4M75 A;  1C6V X;  3UPU A;  3MEA A;  2IPO B;  3OYF A;  2AZV A;  1QKX A;  1M90 U;  4XTY A;  3CCM A;  4D6W A;  5M9O A;  4A4F A;  1Y96 B;  3OBY A;  2LTO A;  3SWN A;  1WDX A;  2F69 A;  1UGV A;  1JO8 A;  3D7S B;  1TG0 A;  3L2Q A;  1ZA2 B;  2EKH A;  1JJ2 A;  4RG8 A;  4C8Q B;  5FTK A;  2E5Q A;  4BE2 A;  3S3M A;  3THK A;  1VQN T;  1TUG B;  1X6O A;  4FM4 B;  2YRD A;  4QKU A;  2DA9 A;  5FWC A;  2EGA A;  3OW2 P;  3DB4 A;  1IXD A;  4PL6 A;  1RLQ C;  2ECZ A;  3C94 A;  1B07 A;  2DPP B;  1MMA A;  1IGQ A;  1UGP B;  4BI4 A;  3LWH A;  5CQX A;  2VAS A;  4BUG A;  3VS1 A;  1VQ8 Q;  2DIG A;  4PJO A;  4M78 F;  1SHG A;  3TVT A;  3NHN A;  4ANJ A;  3CCQ Q;  4LDY A;  4MZT A;  1V76 A;  5A0D A;  2HQX A;  2HQH A;  5DYI A;  1GCP A;  4EMK B;  1WIE A;  1AWO A;  3PGG A;  3MEW A;  1Q7Y U;  4M7A C;  1TSF A;  3JB9 G;  2ROT A;  3OYC A;  2QK0 A;  3OYD A;  4IIO A;  4PJO E;  2YXY A;  2K2V A;  4A4G A;  3I56 T;  3ME9 A;  3M0R A;  4BD3 A;  4PJO G;  4C0D C;  4IKF A;  4HT9 A;  2FZG B;  1N8R R;  4UC4 A;  5HCK A;  1QWF A;  1I07 A;  5KE2 A;  1CSK A;  1MV0 B;  1SF9 A;  2NUP B;  1YWO A;  1VA7 A;  3O5Z A;  1UTI A;  3CCV A;  5KCH A;  1YCS B;  4ZNX A;  2VGN A;  4RTZ A;  3CC4 A;  3HFO A;  3HU1 A;  3TSZ A;  3CD6 T;  3OA6 A;  1OQK A;  2DL4 A;  5B6C A;  4N4G A;  3EHQ A;  4OB0 B;  5IHI A;  4WTO B;  1RUW A;  1EZZ B;  1D0Y A;  4M77 D;  1YIJ A;  2MWO A;  1ABQ A;  5FW9 A;  3FPU A;  2RQV A;  2CP7 A;  2HSP A;  4LDW A;  4C8Q D;  3L42 A;  4M7D D;  5GAO q;  2JZ2 A;  3GLX A;  3VJP A;  2DL7 A;  3JCM f;  3CC7 Q;  3GP8 A;  1H3H A;  4AQ7 A;  4FYX B;  4ZN3 A;  2D0Q B;  3REA B;  4RTU A;  1B3Q A;  1V29 B;  3I5R A;  4PJJ A;  1QWE A;  4C92 E;  3E2U A;  3CCR T;  2L3P A;  3OW2 A;  1K1Z A;  1K9M R;  3FIF A;  2EGE A;  4C92 G;  3G4S T;  2K3Y A;  2YLC A;  2KBT A;  5GAN 4;  3CME T;  1OU8 A;  4OMM A;  4J83 A;  1YNZ A;  3QO3 A;  4O6J A;  3HPW A;  3QII A;  4XK8 E;  3M56 A;  4M7A A;  1MGQ A;  1K0S A;  3DKM A;  1NZ9 A;  3OSS C;  2RF0 A;  2Y4X A;  2K2M A;  1Q86 R;  2PZ1 A;  1G3Y A;  1VQL Q;  2AKL A;  2QTV A;  1E6G A;  3NPF A;  2K3B A;  3LW5 E;  1MHN A;  5LJ3 j;  4M7A E;  4MZP A;  1IB8 A;  4JRK A;  1NYG A;  3V7C A;  5GAM h;  2XDD A;  1N8R U;  4JLG A;  2MOX A;  2F2V A;  1OX8 A;  2KNB B;  4A63 B;  4FYW B;  1VYV A;  1M5Q 1;  4OML A;  1OPL A;  3JV3 A;  1TWB A;  1IGU A;  4N4H A;  3RER A;  3S6W A;  3HHT B;  1N5Z A;  2BKD N;  2GBQ A;  1K9M C;  1Z9Z A;  2E3I A;  1YIT A;  1RAD B;  3A8H B;  4X9C A;  1QVF P;  4J5Y A;  3VS3 A;  2D0N A;  3BY7 A;  2GCX A;  1KG1 A;  3FJP A;  2RN8 A;  3QKJ A;  4J8O A;  4RG2 A;  1UB4 A;  3R6N A;  2LQN A;  1Q82 C;  2BE7 D;  1YIJ Q;  4LUE A;  3EH2 A;  2E64 A;  4E2F B;  1BI2 A;  1R7R A;  1YCY A;  1KSW A;  4L6V 5;  1AEY A;  4EDU A;  4DOW A;  2KE9 A;  4HCC A;  2X3W D;  4BI8 B;  4PJO B;  5GAN h;  1VQK A;  1GXI E;  1KHC A;  2KXD A;  1HXD A;  1VOM A;  4MDX A;  2QA4 A;  2DVJ A;  5FTM A;  1BI1 A;  3CF2 A;  1WGS A;  4L59 A;  3TIW A;  2O31 A;  3CCQ T;  1E32 A;  4OP0 A;  3OYJ A;  4O5V A;  4JJB A;  3RKX A;  2NLU A;  4OGC A;  2MM0 A;  1LCK A;  4XQ3 A;  2NUT B;  4C5E A;  5GAN 8;  4FSS A;  1X27 A;  4FCY A;  2DO3 A;  3AHU A;  3J81 E;  3ZEH A;  4XU2 A;  4KUL A;  5GAN 7;  2MMP A;  3KXT A;  2FRY A;  3H0F A;  3L2V A;  1Q86 U;  5GLF A;  2ABL A;  2YRV A;  4M75 D;  4F16 A;  2WAC A;  4JDS A;  2BZX A;  2K6D A;  1EFN A;  3JCM b;  1FMK A;  1W2B P;  3CEY A;  3WVD B;  3CCM T;  3EG2 A;  1TU0 B;  3A8G B;  1U8R A;  3J80 E;  2DRK A;  1Y0M A;  3VU3 C;  4CC4 B;  1U1S A;  3VUB A;  1I81 A;  3FRN A;  2KMT A;  2LJ1 A;  1YIT Q;  3H6Z A;  4GBQ A;  4XTX A;  3I56 A;  2VYT A;  1SRM A;  4C92 B;  3C0C A;  1SSF A;  4TVR A;  2ZZD A;  2VGM A;  5CKE A;  3QSU A;  2DJQ A;  1KIK A;  2FB7 A;  1R0C B;  3HL8 A;  3OY9 A;  2EWN A;  4RCB A;  3JCM P;  5I2M A;  4C5I A;  1PRL C;  2DTH A;  4LDX A;  4M4Z A;  2DL3 A;  3EG3 A;  3BDU A;  2DXT A;  1IZ6 A;  1WZO A;  1QVF A;  2KK4 A;  2RJF A;  1LOJ A;  3CCL A;  5GMK h;  2LC4 A;  4AT1 B;  1N6A A;  1M1K R;  2KAF A;  4JZ4 A;  2E3H A;  2F2W A;  2K5L A;  4NL3 A;  3EFO A;  4M7A B;  1Y96 A;  1VQN Q;  2ZPI B;  2HZY A;  4J9B A;  5GAO r;  3GBQ A;  2FZC B;  5CCX A;  3HTR A;  4PJN A;  1FX7 A;  1FWZ A;  2X9H A;  2HL5 C;  4AFS C;  1UHF A;  3JSC A;  3M0T A;  4KDL A;  2CRE A;  2PWY A;  3VYG A;  4HVU A;  4RTY A;  2JM8 A;  4C0F A;  1ZSZ C;  4M78 E;  3VS2 A;  4OMO A;  2FPF A;  2WSF E;  3G6E A;  4L5G A;  5CK9 A;  5EPP A;  4M78 G;  2EYZ A;  3OSV A;  1YJW A;  2XMF A;  2BE9 B;  4F04 B;  2GFU A;  4IUR A;  2QEX T;  2RQW A;  2B86 A;  2RQT A;  4DBH A;  1J3T A;  3CCV T;  4RTV A;  5KYY A;  2SEM A;  3M4Y A;  3QJY A;  1TOV A;  2FEI A;  8ATC B;  3VRY A;  3CC4 T;  2Z0W A;  2RJE A;  4OMQ A;  3SD4 A;  3G71 T;  2HSE B;  3BQB A;  4M77 G;  1PKS A;  1VQ7 T;  1K4U S;  1D1A A;  5D6W A;  2CKK A;  2KT8 A;  5A2Q E;  3I56 Q;  4PLI A;  3VS4 A;  1M3C A;  1R77 A;  2FO0 A;  1KD1 C;  3MCA B;  2YUN A;  2HNI A;  1E6H A;  1S72 T;  5D6X A;  1MNE A;  4PLL A;  2JTF A;  1W2B A;  4LD6 A;  2RHZ A;  4Q5W A;  2HL3 A;  4BDY A;  4R0K A;  1MND A;  4ZGJ B;  3FC3 A;  4F7U G;  3ZJT A;  1I5L A;  1NE8 A;  3RR6 A;  2DL5 A;  1JEG A;  1BYM A;  2EBP A;  4IIM A;  2LVM A;  2RHU A;  3RMQ A;  1ZHI A;  3CBO A;  4J9H A;  2ZPF B;  1LNX A;  3I55 A;  1M1K U;  5CD1 A;  3OYY A;  1NG2 A;  2R5M A;  1V1C A;  5KCO A;  2J06 A;  2VXE A;  3LGL A;  1KQ2 A;  5CR2 A;  4XTV A;  1MMG A;  3TEE A;  1WHK A;  1UEC A;  4M7A D;  2CP2 A;  3UA7 A;  2KEA A;  2RM4 A;  2V8J A;  4B6M A;  1YP5 A;  1UE9 A;  2KSS A;  4ARI A;  4RCC A;  1YHQ A;  3NTK A;  2GGR A;  1M90 C;  1XNI A;  1PRM C;  1D09 B;  1ZSZ A;  2MCN A;  3G6E Q;  4PJO C;  1JRI A;  1M2V A;  1HK9 A;  2LT1 A;  2QTX A;  1QVP A;  1I9G A;  1M3B A;  1SRL A;  3CME Q;  5DYG A;  2IIM A;  1OPK A;  3C12 A;  3R6O A;  3X25 B;  2GTJ A;  2MK5 A;  1AWW A;  5CKF A;  2K5F A;  1K8A R;  4Y28 E;  2R57 A;  1YIT T;  4ORZ A;  2OTJ A;  1TS9 A;  2X3X D;  2LNV A;  2YUP A;  4J9G A;  3OYA A;  2VVK A;  3L2R A;  2RJD A;  1YBY A;  1NEG A;  1X01 A;  4QT7 A;  3RUX A;  2DEU A;  5KYU A;  1H3Z A;  2DIQ A;  1VUB A;  1O9S A;  2A37 A;  1EIF A;  3UWN A;  2KRS A;  2EVR A;  1WLP B;  1G83 A;  3BE3 A;  2KDS A;  3EFO B;  5DLQ E;  1VQK T;  1DJ7 B;  4OVA A;  3S3N A;  4BAC A;  5GJV B;  3TQ7 P;  1GBQ A;  4M78 B;  5KYN A;  4KUD K;  5FTN A;  2QA4 T;  1Q7Y C;  1NPR A;  2Q19 X;  1ARK A;  2K5I A;  3JCM Q;  3I55 Q;  2JVV A;  3QDR B;  2MF2 A;  4LDV A;  4PKC C;  1G2B A;  2ESW A;  4C92 C;  5HK0 A;  4E7J A;  2L8D A;  1H8K A;  3E9G A;  4JJD A;  1OYX A;  5CKH A;  1VQM A;  1PSE A;  2F5T X;  2X35 A;  5GAO p;  3UAT A;  2JMA A;  5KYY B;  4J9E A;  5DLO A;  2K79 A;  1H92 A;  3LGF A;  4FT4 A;  3UA6 A;  4YTL A;  4HVV A;  3QJ6 A;  2AIR B;  1HJD A;  2CDT A;  4GLK A;  4RTW A;  2VB6 A;  3CPW P;  4F7U B;  3M0P A;  4LXC A;  4CC3 A;  1ABO A;  2JV2 A;  1WJQ A;  1XJW B;  1Q95 G;  5C18 A;  2E41 A;  5HKC A;  1UDL A;  2F5K A;  2LQK A;  4CC2 A;  3KUF A;  4R55 A;  5GAM j;  2A7Y A;  4QVZ A;  1GBR A;  4M77 F;  2LCL A;  3P8B B;  1K8A U;  2ED0 A;  5LJ5 f;  1W6X A;  4M7D F;  2NUT A;  2LRQ A;  2VWF A;  2CH4 A;  1NEB A;  1FXX A;  2Q18 X;  4RTX A;  2QEX A;  2EIF A;  2BIV A;  5FRN A;  1OOT A;  5LJ5 e;  1BIA A;  3CCM Q;  3RDV A;  2MWP A;  4F7U F;  3CCL T;  3CMA A;  3TCJ A;  1FYN A;  2YDL A;  1HYO A;  3G71 A;  4A4H A;  5FU6 B;  1VQ7 A;  2JS0 A;  2CZ0 B;  1WXB A;  5C6S A;  5GAN j;  2BZY A;  2DE0 X;  2DYB A;  3LGA A;  2DKG A;  3A8O B;  4DQ2 A;  4NL2 A;  1YJN A;  1S72 A;  2GNC A;  1BBZ A;  3M9Q A;  4JPB W;  1PWT A;  2M1H A;  1PG5 B;  5IXB A;  1VQ4 A;  1YJ9 A;  4C92 A;  1ZSZ B;  1WXU A;  2IG0 A;  4ZGE B;  4J9F A;  4IUP A;  4E6R A;  1M2V B;  1VQM Q;  1N8R C;  2M0O A;  1NPP A;  4BY6 B;  1KQS S;  3VRZ A;  3PVL A;  3PFS A;  3G6E T;  3QYG B;  4JZ3 A;  1G3T A;  1YJW T;  1ZA1 B;  2Q1C X;  3JCM e;  1T3L A;  5J39 A;  4RV0 A;  1K9A A;  3TRE A;  3CXC S;  1VQ6 A;  3HU2 A;  4OF1 A;  4KH1 B;  3M4G A;  2ROL A;  4CI0 C;  5C1B A;  3FJ5 A;  1GFC A;  2DTI A;  1T3S A;  3QG1 A;  2DEQ A;  5KYU B;  3L2W A;  1QDN A;  2PNI A;  2XK0 A;  2M51 A;  2DFU A;  3JCM h;  4QVD A;  1VQO A;  3SB2 A;  2CUB A;  2QQS A;  3QWY A;  3OBW A;  3CPW A;  4Z88 A;  5HK3 A;  2HKQ B;  4LNP A;  2ED1 A;  3OYN A;  3N5B B;  4KGX B;  1GRI A;  1RAA B;  2QEX Q;  2Q1A X;  1AWX A;  1WXT A;  4OMP A;  3CC2 A;  4JRI A;  1Y7X A;  3CCV Q;  5ECA A;  4KDI A;  1JJ2 S;  1ZSG A;  2G6F X;  4RKU E;  3A5Z B;  3X26 B;  3EG0 A;  3CC4 Q;  2DM1 A;  2HMA A;  2H3E B;  1T0J A;  2VC8 A;  4FSX A;  3ZJV A;  3NTI A;  2C06 A;  3G71 Q;  1VQ7 Q;  2DXU A;  1VQ9 T;  2HKN A;  4E7I A;  2E1H A;  3EGU A;  2A3L A;  4E7L A;  1G5V A;  2H3J A;  2FYK A;  1Y71 A;  1GFD A;  4OMN A;  1M8M A;  1UGQ B;  3I55 T;  2RNA A;  4R56 A;  5GMK j;  1YJN Q;  1S72 Q;  2VXF A;  1VYU A;  2EKO A;  2EW3 A;  2AK5 A;  2B25 A;  1QVG P;  1Q86 C;  1YI2 A;  4AS1 A;  3M54 A;  5CVI A;  3P8H A;  3RNJ A;  4C5G A;  2M02 A;  4II1 A;  1YHQ T;  1QCS A;  1CKB A;  1XQH A;  2F2X A;  3HU3 A;  4M75 F;  1C1A A;  1QMC A;  3INZ A;  3CCS T;  2E6N A;  2PU9 B;  3V7S A;  4OMF B;  3FDR A;  3C95 A;  4M78 C;  3JB9 H;  2I0N A;  2JXB A;  5FRM A;  3RES A;  4ARC A;  2I2L A;  4HVW A;  1VQ6 Q;  3U23 A;  2KRO A;  4HKE A;  2L3S A;  2PQW A;  5GAN 6;  1UGR B;  4PJM A;  2ZGW A;  1PHT A;  5D6Y A;  3VS5 A;  3PE0 A;  3OS1 A;  2O2O A;  2OTJ T;  4BB7 A;  2KGT A;  3JCM g;  1RAB B;  3ZFJ A;  4M77 C;  1R8O B;  5D7U A;  2DF6 A;  3M0U A;  3OS0 A;  2JUF A;  5I2S A;  3REB B;  2RD1 A;  3EG9 A;  2KRN A;  3OYE A;  3CC2 Q;  2ENM A;  2DMO A;  1SPK A;  3CCJ A;  5LJ3 f;  1AVZ C;  2RH2 A;  2K3X A;  3SHW A;  1RAG B;  2KT1 A;  2QGF B;  2CZ7 B;  1OI1 A;  5FWB A;  2PJH B;  1M27 C;  1AHJ B;  2RI5 A;  1K0X A;  4ATO A;  5LJ3 e;  2RPN A;  4FYV B;  3ZJU A;  4N0A C;  4A4K A;  1I0C A;  1RAH B;  3M59 A;  3DLL A;  3RIR A;  2R5A A;  3VYH B;  3VS7 A;  3HP9 A;  1VQK Q;  1K73 R;  1VQM T;  3SDZ A;  3JB9 D;  3OW2 S;  3MEU A;  3QYH B;  2RJC A;  3LHD A;  2GTO A;  2QA4 Q;  2DD5 A;  2EYY A;  3H0I A;  4GLM A;  2J6F A;  2E10 A;  3JCM W;  1OV3 A;  2FVU A;  3OYK A;  2DJZ A;  2XHC A;  4PJO D;  1X69 A;  4AFQ C;  1NJI R;  3A1P A;  1SSH A;  1MMN A;  1QVG A;  2PVG B;  4HCK A;  5FU6 C;  4M78 A;  2CT3 A;  3PVQ A;  1XOV A;  4PFZ A;  3OMG A;  2ZPG B;  1X2K A;  4EIK A;  1OZ3 A;  3L2U A;  1KC8 U;  4E47 A;  3AT1 B;  3H8Z A;  3ASK A;  2DAQ A;  4FYY B;  2PTK A;  5IHK A;  4ZTF A;  3SEM A;  4LN2 A;  5GAN 5;  3MHX A;  4M77 A;  2XI9 A;  3QHS A;  1GCQ C;  4BY6 C;  3X20 B;  1WHG A;  4FL6 A;  1KQS P;  2P84 A;  3JCM d;  2QQ9 A;  3CCJ Q;  1D0X A;  1I4K 1;  2EGC A;  1M1K C;  2KQW A;  4CQN A;  3WVE B;  4M77 E;  3MB5 A;  3CMA T;  2LX7 A;  3EFR A;  4Y91 A;  3HRT A;  4F17 A;  5CAI A;  4JUV A;  1QCN A;  2O01 E;  1X2Q A;  2P0K A;  1D3B B;  2QDY B;  4F7U A;  4M7D E;  4B9X A;  2DIL A;  2C0O A;  2DET A;  2L3Q A;  2V8K A;  4IUU A;  3E1S A;  4C8Q G;  4M7D G;  3LLR A;  1M3A A;  1UJY A;  4N0A A;  5J26 A;  3RBB B;  1YJN T;  2KYB A;  5LL6 S;  3CCE T;  2GQV A;  3JCM c;  1VQ4 T;  2HAX A;  2EQK A;  4C92 D;  1YJ9 T;  4B9W A;  5CKB A;  4F7U E;  2DNU A;  4WCI A;  1MUZ A;  4E7H A;  1BIB A;  3IQL A;  4MMK A;  2Y4Y A;  3CCL Q;  5EQJ B;  4QQD A;  1M30 A;  3CCU A;  1KFZ A;  1LPL A;  1M4Z A;  5DM7 R;  1K73 U;  3MET A;  5AT1 B;  1VQ9 A;  4RTT A;  2OTL A;  2MAM A;  3E19 A;  2RHX A;  1W4S A;  1WHJ A;  3M55 A;  1JBM A;  5IAY A;  3ZGZ A;  2EJF A;  1VQ6 T;  4RMO A;  2FG0 A;  3RMS A;  1NJI U;  2BZ8 A;  3HFN A;  1S3S A;  4QQG A;  1H64 1;  2RQR A;  3EG9 B;  1U1T A;  3I9Q A;  1ZUY A;  3T9N A;  1VQO T;  3EGX B;  4DEY A;  3GF5 A;  2A0F B;  1WI7 A;  1M1F A;  2LJ3 A;  2JTM A;  3PT9 A;  1CR5 A;  3CCS A;  4NOY A;  2V1R A;  2OX7 A;  8AT1 B;  3A8M B;  1YJW Q;  1GCQ A;  3EGD A;  4E7Z A;  3CC2 T;  2OAU A;  3X24 B;  4J9I A;  2DLP A;  1MMD A;  3GNF B;  3UDC A;  5KYX A;  3CBM A;  1NM7 A;  3UT1 A;  3F70 A;  2K9G A;  1VQ8 A;  1B34 B;  1VQ5 T;  2ZAE A;  4XTU A;  1QCO A;  1WJS A;  1WX6 A;  3MP6 A;  3LH5 A;  1KQS A;  3M5A A;  1TH7 A;  3JCM X;  3OYL A;  2PUO B;  1QVF S;  1G3W A;  1UUE A;  2LT4 A;  4BI3 A;  2DX1 A;  1AZE A;  2C0T A;  1Y57 A;  2L2P A;  1YI2 T;  5I11 A;  4OB3 B;  5GMK l;  4XTZ A;  2X4W A;  1F1B B;  3FEO A;  2EAY A;  2FL7 A;  4WF2 A;  3MP1 A;  3OS2 A;  3KBG A;  4NS5 A;  2E4H A;  1Y07 A;  2KR3 A;  2EQM A;  3VUZ A;  5A0G A;  1Q81 R;  1VQ9 Q;  4KOD A;  1OEB A;  2CP3 A;  2JM9 A;  5IHN A;  2COY A;  2AKK A;  4KGV B;  1PC0 A;  2W0Z A;  1ZLM A;  3RKY A;  4QVC A;  1CZ5 A;  1O75 A;  3KFV A;  1RAC B;  2AZS A;  1K8A C;  3LH0 A;  1X6B A;  2DK3 A;  2A28 A;  1TUD A;  4M77 B;  5FU7 B;  3BDL A;  3FB9 A;  2RHI A;  3M53 A;  1IRX A;  4A53 A;  1BB9 A;  3E9F A;  5GAO l;  4M75 E;  2XU8 A;  1WFW A;  4M7D B;  1VYT A;  1YHQ Q;  5CO7 A;  9ATC B;  2XKO C;  2BTT A;  2QG9 B;  4M75 G;  1IRE B;  3QUI A;  3CCS Q;  3VKI A;  3LWI A;  1PNJ A;  1NBE B;  1UHC A;  2IVW A;  3V8K A;  4CC7 A;  4OB1 B;  4KLN A;  1I5O B;  2JOY A;  1EX4 A;  3QWX X;  3M0S A;  3CCJ T;  2EQJ A;  2YWW A;  2O88 A;  2EYW A;  3CC7 A;  1M1G A;  1Q81 C;  1AT1 B;  4E7S A;  1XTD A;  3URG A;  1WJR A;  3O8V A;  1S1N A;  5FLX E;  1RL2 A;  2EQI A;  3OYB A;  2JNG A;  1PD0 A;  3TU4 K;  2JJ9 A;  1W2B S;  1M2O A;  2OTJ Q;  1M9S A;  2YUQ A;  1WLF A;  2C0I A;  5J3B A;  2O4X B;  3H9N A;  4J6X A;  3V8L A;  4C8Q F;  1QP3 A;  2KRM A;  2EJ9 A;  5I21 A;  2DER A;  4DBQ A;  5C0M A;  2D6F A;  2RO0 A;  3JCM V;  1U3O A;  3SFM A;  2EFI A;  2K57 A;  1JB0 E;  4HT8 A;  1RAE B;  3QZ9 B;  1K76 A;  3MO8 A;  1ZX6 A;  5EC7 A;  1PM3 A;  1U06 A;  3OYG A;  2O9V A;  3OYH A;  1VQL A; 
#chains in the Genus database with same CATH homology
 3CCQ A;  4M7A G;  3JSC A;  2CGH A;  3QZ5 B;  4C5G A;  1GXI E;  3V8J A;  4II1 A;  5CIU A;  1YHQ T;  1QCS A;  2QQR A;  1XQH A;  3HU3 A;  4OGE A;  3MEV A;  2E12 A;  3NTH A;  3QBY A;  4KDL A;  4DOV A;  3L2Z A;  4M75 F;  3ZBD A;  2PWY A;  3JRZ A;  3QPH A;  3G7Z A;  3VYG A;  4FU6 A;  3INZ A;  5LJ5 h;  3CCS T;  2E6N A;  1Q81 U;  2LX9 A;  2PU9 B;  4C0F A;  3V7S A;  4M78 D;  4C0G A;  4M78 E;  4OMF B;  5A0L A;  4HCB A;  2KVQ G;  3QC8 A;  3FDR A;  5LJ5 j;  3C95 A;  3CCE A;  2VUB A;  4MML A;  2B8A A;  2WSF E;  4M78 C;  3JB9 H;  3G6E A;  3CXC A;  4L5G A;  5FRM A;  5CK9 A;  2XDB A;  2ZCF B;  3P8D A;  3RES A;  4M78 G;  1LJO A;  5KH6 A;  2X4Y A;  3OSV A;  1YJW A;  3J7A F;  4ARC A;  3FLG A;  2I2L A;  1QVG S;  2GFU A;  3L1A A;  4IUR A;  2QEX T;  4HKE A;  4J6W A;  3RKW A;  2PQW A;  5GAN 6;  3FPR A;  3CBP A;  2DD4 A;  3CCV T;  1UGR B;  2PVD B;  2LQ8 A;  3BW1 A;  2ZGW A;  3BFM A;  3OS5 A;  3OMC A;  5D6Y A;  5LJ3 d;  2CS7 A;  3M4Y A;  3QJY A;  3OS1 A;  4M75 A;  3CC4 T;  3MEA A;  2DTO A;  3UPU A;  2RJE A;  3PIP A;  3OYF A;  2OTJ T;  2DXC A;  4BB7 A;  3JCM g;  2QQA A;  3ZFJ A;  1M90 U;  4M77 C;  4XTY A;  5FRO A;  3CCM A;  3SD4 A;  4XU3 A;  4D6W A;  5M9O A;  4A4F A;  3PIO A;  3VV0 A;  3G71 T;  1Y96 B;  4M77 G;  1VQ7 T;  3BQB A;  3OBY A;  2LTO A;  1R8O B;  2CKK A;  5D6W A;  3SWN A;  5A2Q E;  2F69 A;  4PLI A;  3OS0 A;  2JUF A;  5I2S A;  4MDW A;  2RD1 A;  3L2Q A;  3OYE A;  1KD1 C;  2GF7 A;  3OQ5 A;  3MCA B;  1JJ2 A;  5CKD A;  2HNI A;  1S72 T;  4RG8 A;  5D6X A;  2RI2 A;  2E5Q A;  4C8Q B;  5FTK A;  4PLL A;  5LJ3 f;  3CCJ A;  4BE2 A;  2JTF A;  3S3M A;  1W2B A;  2BUD A;  4LD6 A;  1VQN T;  2RHZ A;  2RH2 A;  2K3X A;  4Q5W A;  4ZTJ A;  2LDM A;  2RA2 A;  1X6O A;  4FM4 B;  2CZ7 B;  4BDY A;  5GAM f;  1OI1 A;  3S3O A;  2FHD A;  1ZQ1 A;  2CZ6 B;  3DB4 A;  2PJH B;  3DLM A;  4ZGJ B;  1AHJ B;  2RI5 A;  4F7U G;  3FC3 A;  4ATO A;  3QQ7 A;  4BE1 A;  4IUT A;  1P92 A;  4PL6 A;  4JJN K;  5LJ3 e;  3ZJT A;  1I5L A;  4ARI A;  2L89 A;  1NE8 A;  3C94 A;  3ZJU A;  2DPP B;  4N0A C;  1BYM A;  1UGP B;  2LVM A;  4A4K A;  4BI4 A;  3LWH A;  3HSB A;  2RHU A;  3RMQ A;  1ZHI A;  5CQX A;  1RI0 A;  3CBO A;  5GAM e;  2ZPF B;  1LNX A;  3I55 A;  1M1K U;  5CD1 A;  3OYY A;  4BUG A;  2EQU A;  2ZPB B;  3M59 A;  4M75 B;  2R5M A;  3DLL A;  3RIR A;  5KCO A;  2DIG A;  2R5A A;  4PJO A;  4M78 F;  3VYH B;  3DB3 A;  1VQP A;  3HP9 A;  1WNL A;  3EFS A;  2VXE A;  3LGL A;  3CCU T;  1KQ2 A;  5CR2 A;  2HBP A;  4LDY A;  4MZT A;  4XTV A;  5GAN 2;  1VQM T;  5A0D A;  2HQX A;  3SWN B;  5DYI A;  3TEE A;  2HD0 A;  3SDZ A;  3JB9 D;  3OW2 S;  4M7A D;  2X4X A;  3MEU A;  2XDP A;  4EMK B;  1VQ5 A;  2RM4 A;  2V8J A;  2OTL T;  3QYH B;  2RJC A;  3LHD A;  3PGG A;  1WPY A;  3JCM J;  3MEW A;  1Q7Y U;  4M7A C;  2DD5 A;  1UEB A;  2E70 A;  5LJ5 g;  2KSS A;  3JB9 G;  4RCC A;  2E10 A;  3NTK A;  3JCM W;  1BKB A;  3OYC A;  2FVU A;  4ME7 A;  5GAN f;  3OYK A;  1YHQ A;  3OYD A;  2DJZ A;  2XHC A;  4E7K A;  1M90 C;  4PJO D;  1XNI A;  4PJO E;  1X75 C;  1M8V A;  1UGS B;  2K2V A;  4A4G A;  3JAM E;  1D3B A;  3I56 T;  3ME9 A;  4PJO C;  2QI2 A;  1QVG A;  1JRI A;  2QXF A;  2PVG B;  4BD3 A;  2XID A;  4PJO G;  2L5Q A;  5FU6 C;  4C0D C;  4M78 A;  2PVO B;  4IKF A;  1HK9 A;  2LT1 A;  2QTX A;  2RK2 A;  4HT9 A;  1XOV A;  1QVP A;  3OMG A;  2LCC A;  1I9G A;  2ZPG B;  2DZ9 A;  4UC4 A;  1VQL T;  4EPC A;  5GAN e;  5KE2 A;  1OZ3 A;  3L2U A;  5DYG A;  1KC8 U;  2KY9 A;  4E47 A;  3C12 A;  3R6O A;  1I8F A;  3X25 B;  3CCV A;  3H8Z A;  3ASK A;  2DAQ A;  3V7R A;  5KCH A;  4ZTF A;  5CKF A;  2K5F A;  1ZBX A;  2VGN A;  5GAN 5;  1ZC1 A;  4Y28 E;  3CC4 A;  2R57 A;  3MHX A;  1YIT T;  4M77 A;  3OYH A;  2XI9 A;  3HFO A;  2OTJ A;  3QHS A;  5GAO n;  3HU1 A;  5FTJ A;  2XD0 A;  3CD6 T;  2ZPE B;  1YJ9 T;  4BY6 C;  3OA6 A;  2MM2 A;  5ERG B;  3X20 B;  4FL6 A;  2LNV A;  2XIC A;  3OYA A;  3JCM d;  2QQ9 A;  3L2R A;  2RJD A;  1YBY A;  3HRU A;  1X01 A;  3RUX A;  5B6C A;  4N4G A;  1H3Z A;  2DIQ A;  1I4K 1;  1VUB A;  4OB0 B;  1M1K C;  1O9S A;  4VUB A;  1VQ8 T;  1EIF A;  4J7F A;  3UWN A;  5HY6 A;  2KQW A;  4HCZ A;  4JLI A;  4M77 D;  3WVE B;  4M77 E;  3MB5 A;  4CQN A;  1YIJ A;  3CMA T;  2M16 A;  4Z02 A;  2MWO A;  3EFR A;  4Y91 A;  1VQN A;  3HRT A;  5FTL A;  2KDS A;  2JN0 A;  5DLQ E;  5FU7 C;  1VQK T;  3FPU A;  5CAI A;  4JUV A;  1DJ7 B;  4LDW A;  2O01 E;  4C8Q D;  5CCA A;  2P0K A;  1D3B B;  2QDY B;  3L42 A;  4OVA A;  4F7U A;  5GAO q;  4B9X A;  4BAC A;  3S3N A;  2JZ2 A;  4M7D D;  4M7D E;  3X28 B;  2V8K A;  3GLX A;  4C8Q C;  4M78 B;  4IUU A;  3E1S A;  4KUD K;  4M7D C;  2P0P A;  4FT2 A;  3VJP A;  1PSF A;  4C8Q G;  2QA4 T;  3JCM f;  1NPR A;  1Q7Y C;  1K9M U;  4M7D G;  3JB9 F;  3LLR A;  3GP8 A;  4AQ7 A;  3C4S A;  2QQB A;  2YVL A;  4N0A A;  5J26 A;  1YJN T;  4MZM A;  2Q19 X;  4ZN3 A;  2D0Q B;  2K5I A;  3JCM Q;  5LL6 S;  3CCE T;  2P4T A;  3OB9 A;  2JVV A;  2GQV A;  4BDZ A;  4XAX B;  3QDR B;  2MF2 A;  4LDV A;  4PKC C;  4X9D A;  3JCM c;  1VQ4 T;  1Q82 U;  4C5H A;  1OZ2 A;  2HAX A;  1KQ1 A;  2EQK A;  3PMI A;  4PJO F;  4C92 D;  1V29 B;  4B9W A;  4C92 E;  5IT9 E;  5CKB A;  4JS4 A;  3TIW A;  4F7U E;  3CCR T;  4KO8 A;  3OW2 A;  4C92 C;  5HK0 A;  1VQO A;  4E7J A;  2EJG A;  5L8R E;  2L8D A;  3Q1J A;  3FIF A;  4C92 G;  3G4S T;  1BIB A;  4E7H A;  2K3Y A;  4MMK A;  2Y4Y A;  3E9G A;  4QQ6 A;  2YLC A;  3CME T;  5GAN 4;  4QQD A;  5EQJ B;  3CCU A;  4J83 A;  3QO3 A;  1OYX A;  2G3R A;  4O6J A;  2L3R A;  3PTA A;  1KC8 C;  2DXB A;  1M4Z A;  3HPW A;  5CKH A;  3QII A;  1PSE A;  4XK8 E;  5GAM g;  1VQM A;  5DM7 R;  1BI3 A;  3M56 A;  3MET A;  2F5T X;  2X35 A;  3QXE B;  4J7I A;  1K73 U;  1VQ9 A;  4M7A A;  1MGQ A;  5GAO p;  3DKM A;  2WSC E;  2OTL A;  5AYF A;  2MAM A;  1NZ9 A;  3OSS C;  5DLO A;  2Y4X A;  4KT0 E;  3E19 A;  4XTW A;  1B34 A;  2RHX A;  1W4S A;  3LGF A;  4N4I A;  4FT4 A;  4YTL A;  1G3Y A;  3M58 A;  2RHY A;  3M55 A;  5GMK m;  1JBM A;  5IAY A;  3QJ6 A;  4HA8 A;  4EMK C;  3ZGZ A;  5LJ3 h;  2EJF A;  5LJ5 d;  1VQ6 T;  4GLK A;  4RMO A;  3RMS A;  1NJI U;  4F7U B;  3JB9 J;  3HFN A;  4IUQ A;  3LW5 E;  1MHN A;  5CVI A;  5LJ3 j;  4M7A E;  1S3S A;  4CRI A;  4MZP A;  4KBM B;  4QQG A;  1H64 1;  4JRK A;  3V7C A;  2XDD A;  5GAM h;  5GMK e;  1N8R U;  1U1T A;  4JLG A;  2JV2 A;  1WJQ A;  3T9N A;  2HQE A;  1O54 A;  5C18 A;  1VQO T;  2E41 A;  5HKC A;  2LQK A;  2F5K A;  3GF5 A;  3KUF A;  4R55 A;  1M1F A;  5GAM j;  1G3S A;  1M5Q 1;  2A7Y A;  4QVZ A;  2JTM A;  4M77 F;  2LCL A;  3PT9 A;  1WQ7 A;  1QP2 A;  4N4H A;  3WXM B;  3CCS A;  4DA4 A;  4ZGD B;  3RER A;  1CR5 A;  1KHI A;  3P8B B;  4NOY A;  3S6W A;  1K8A U;  3A8M B;  5LJ5 f;  3HHT B;  5GAN g;  2Q1D X;  2BKD N;  3JB9 I;  1K9M C;  1YIT A;  4M7D F;  3CC7 T;  2LRQ A;  5CCB A;  3A8H B;  4X9C A;  3CC2 T;  4J5Y A;  2OAU A;  3CD6 A;  3X24 B;  3CPW S;  3BY7 A;  2GCX A;  1KG1 A;  3FJP A;  5GAO m;  1FXX A;  2PUK B;  3QKJ A;  4XU0 A;  3OYI A;  2Q18 X;  4J8O A;  2E6Z A;  4RG2 A;  1UB4 A;  2EIF A;  3GNF B;  2BIV A;  2QEX A;  1Q82 C;  5FRN A;  3UDC A;  4P5N A;  4JRP A;  3CBM A;  3UT1 A;  2E64 A;  5LJ5 e;  1BI2 A;  1BIA A;  3HKS A;  1R7R A;  3F70 A;  3FPT A;  1WQW A;  1N9R A;  1YCY A;  1VQ8 A;  4L6V 5;  4C92 F;  5FTN A;  1B34 B;  2MWP A;  4EDU A;  4F7U F;  1VQ5 T;  3CCL T;  3CMA A;  4DOW A;  3TCJ A;  4HCC A;  3GPL A;  4XTU A;  4BI8 B;  1WJS A;  4PJO B;  5GAN h;  1VQK A;  5GAN 3;  2DZC A;  3MP6 A;  4A4H A;  4C0D B;  1KHC A;  1TH7 A;  3M5A A;  4OB2 B;  5FU6 B;  4C8Q A;  3G71 A;  2CZ1 B;  1K73 C;  1KQS A;  1VQ7 A;  4M7D A;  2CZ0 B;  4EMH A;  4C0Z A;  1HXD A;  3JCM X;  5C6S A;  3OYL A;  5GAN j;  2PUO B;  1QVF S;  1G3W A;  4MDX A;  2CYZ B;  2LT4 A;  4BI3 A;  2QA4 A;  3LGA A;  2DKG A;  3GOX A;  3EAE A;  2LW6 A;  3A8O B;  4DQ2 A;  1BI1 A;  4NL2 A;  5FTM A;  3CF2 A;  1YJN A;  4V2S A;  1WGS A;  4PNO A;  1S72 A;  1YI2 T;  3M9Q A;  2DVE A;  3M57 A;  2XG8 D;  4L59 A;  1VIE A;  4OB3 B;  2M1H A;  3A8L B;  5GMK l;  2M9U A;  2EYQ A;  2X4W A;  4XTZ A;  3FEO A;  3ER0 A;  1BI0 A;  5KE3 A;  3CCQ T;  3LX7 A;  4JS5 A;  1VQ4 A;  2EAY A;  1NJI C;  1E32 A;  2X4J A;  3CPF A;  2FL7 A;  4WF2 A;  4OP0 A;  4C8Q E;  2R58 A;  4C92 A;  3OYJ A;  4O5V A;  1YJ9 A;  3MP1 A;  3OS2 A;  2IG0 A;  3KBG A;  3RKX A;  4ZGE B;  4NS5 A;  3CCR A;  2NLU A;  4IUP A;  1Y07 A;  4OGC A;  2MM0 A;  2EQM A;  3VUZ A;  4XQ3 A;  5A0G A;  1N8R C;  2M0O A;  4X34 A;  3G4S A;  4KOD A;  1NPP A;  4BY6 B;  4M7A F;  4C5E A;  5GAN 8;  3CME A;  3MP8 A;  1KQS S;  2DO3 A;  3AHU A;  3PFS A;  3J81 E;  3RKY A;  3G6E T;  4J6Y A;  3ZEH A;  3QYG B;  4QVC A;  1CZ5 A;  1O75 A;  4XU2 A;  1G3T A;  2O4X A;  4KUL A;  3NFC A;  5GAM d;  4JRQ A;  1YJW T;  5GAN 7;  1K8A C;  3LH0 A;  4ELZ C;  5LJ3 g;  2D9T A;  2Q1C X;  2DK3 A;  2MI6 A;  2MMP A;  3KXT A;  4EMK A;  3JCM e;  5IN1 A;  5J39 A;  3L2V A;  1Q86 U;  4M77 B;  5FU7 B;  4RV0 A;  3BDL A;  5GLF A;  3FB9 A;  2RHI A;  2YRV A;  3TRE A;  3CXC S;  3M53 A;  4A53 A;  1VQ6 A;  3HU2 A;  2Y90 A;  3E9F A;  4M75 D;  1N27 A;  1VIF A;  2RI3 A;  2XU8 A;  3M4G A;  3PMT A;  2WAC A;  4M75 E;  4OF1 A;  4JDS A;  4QW2 A;  4CI0 C;  1YIJ T;  4M7D B;  5C1B A;  2V8I A;  5CO7 A;  2DTI A;  5EG2 A;  2YLB A;  4M75 C;  3JCM b;  2WSE E;  3QG1 A;  2XKO C;  3CEY A;  5CQY A;  3WVD B;  3CCM T;  4M75 G;  2DEQ A;  3LYI A;  1IRE B;  3A8G B;  3QUI A;  1U8R A;  3L2W A;  4GY5 A;  3J80 E;  1QDN A;  2XK0 A;  3VU3 C;  3GNG A;  1U1S A;  3JCM h;  1I81 A;  2E65 A;  3FRN A;  2KMT A;  3VKI A;  3SB2 A;  3VUB A;  4QVD A;  3LWI A;  3SWN C;  3V8K A;  2IVW A;  2QQS A;  3GIB A;  4OB1 B;  4KLN A;  3H6Z A;  3OBW A;  4XU1 A;  3CPW A;  4XTX A;  5HK3 A;  3I56 A;  4A54 A;  2P0Q A;  5GAO l;  2VYT A;  2JOY A;  2ZPH B;  4C92 B;  3OYN A;  3OYM A;  3CCJ T;  2EQJ A;  4EMG A;  3N5B B;  4A4E A;  2K4Y A;  1N9S A;  1SSF A;  4TVR A;  2ZZD A;  2VGM A;  5CKE A;  3CC7 A;  2Q1A X;  1M1G A;  1Q81 C;  3QSU A;  3CC2 A;  4JRI A;  1XTD A;  2FB7 A;  5DY9 A;  1Y7X A;  3URG A;  1WJR A;  4LDU A;  4FIB A;  5GAN d;  2YUJ A;  4KDI A;  3O8V A;  3HL8 A;  3QQ8 A;  5FLX E;  1RL2 A;  3OYB A;  2GFA A;  2EWN A;  3OY9 A;  1JJ2 S;  4RCB A;  3JCM P;  2JNG A;  4RKU E;  3A5Z B;  5I2M A;  3X26 B;  4C5I A;  2RK1 A;  2VV5 A;  3TU4 K;  1W2B S;  4ELY C;  2DTH A;  4LDX A;  1M9S A;  2VC8 A;  4FSX A;  1WLF A;  5J3B A;  3PNW C;  3ZJV A;  2YHT A;  2O4X B;  3BDU A;  3NTI A;  2AHJ B;  2DXT A;  2C06 A;  1IZ6 A;  4J6X A;  3V8L A;  2RB6 A;  4C8Q F;  2DXU A;  1QP3 A;  1VQ9 T;  1QVF A;  2EJ9 A;  2KK4 A;  4ZN1 A;  4E7I A;  2E1H A;  2RJF A;  1LOJ A;  2A3L A;  4E7L A;  5GMK h;  2H3J A;  5I21 A;  2LC4 A;  3CCL A;  1G5V A;  1CZ4 A;  2FYK A;  1Y71 A;  1N6A A;  5C0M A;  5GMK i;  2KAF A;  2D6F A;  2RO0 A;  3QWZ A;  1UGQ B;  3I55 T;  1KD1 U;  3JCM V;  3SFM A;  4BE0 A;  4R56 A;  2EFI A;  5GMK j;  5EPP A;  2K57 A;  1JB0 E;  4HT8 A;  2K5L A;  3QZ9 B;  2VXF A;  4NL3 A;  4M7A B;  3MO8 A;  1VQP T;  1Y96 A;  2EKO A;  2B25 A;  2ZPI B;  4LD9 K;  1QW1 A;  5GAO r;  3OYG A;  1Q86 C;  3HRS A;  1YI2 A;  4AS1 A;  4IUV A;  5CCX A;  3M54 A;  3P8H A;  1FX7 A;  1FWZ A;  1VQL A;  4KUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...