2XDPA

Crystal structure of the tudor domain of human jmjd2c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
EKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4C
publication title Crystal Structure of the Tudor Domain of Human Jmjd2C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 18
structure length 119
sequence length 119
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xdpA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2xdpA02
3PNWC 1XNIA 4A4GA 3OS0A 2O4XA 4OVAA 4C5GA 3OYBA 2PQWA 1WJRA 3ASKA 1OZ3A 3MEAA 2R57A 2JTFA 5D6XA 1WJQA 3OYCA 2RJEA 4FL6A 3FC3A 3OYHA 2GFUA 5KE2A 3OS1A 3OYNA 2XK0A 3LYIA 3OY9A 4ZTJA 4Q5WA 3DB3A 3OB9A 2M16A 2CKKA 2MWOA 4BE2A 3LH0A 3OYJA 3OQ5A 2L3RA 1MHNA 4N4GA 5KCHA 2RJFA 4II1A 2XDPA 5J39A 4IUQA 1H3ZA 2RI5A 4B9WA 2RJCA 5KE3A 4E7KA 3E9GA 2HQEA 2BKDN 4Z02A 2MWPA 4IKFA 5FRNA 3L2WA 4QQDA 3CEYA 2QQSA 3QBYA 2LRQA 2P0KA 1OI1A 3DLMA 2FHDA 2GF7A 1WJSA 2K3YA 3MP6A 4QW2A 5KH6A 3GOXA 3S3MA 2RI3A 2RHYA 3LX7A 3OS2A 2EQUA 2DIGA 2IG0A 2LVMA 3MP1A 3EAEA 2L89A 3NTIA 4N4IA 5J26A 3OYMA 4BDYA 3PMTA 3OYKA 3PFSA 5M9OA 4ZTFA 4IUTA 2VYTA 3MEWA 3DB4A 4UC4A 4L59A 2G3RA 5C6SA 3OYDA 2E6NA 3L2QA 3S3OA 3OYGA 4GY5A 3F70A 2E5QA 4IUPA 4C5IA 4BDZA 3KUFA 3QJ6A 4IUVA 5FRMA 4N4HA 1WGSA 2RHXA 2NLUA 3E9FA 5D6WA 2DIQA 3S3NA 3QIIA 5IAYA 3UWNA 3MP8A 3OMCA 3LLRA 2RI2A 4CRIA 3MO8A 2GFAA 3OYEA 2R5MA 2RJDA 3ME9A 4X34A 3OA6A 4NS5A 2LTOA 2EQKA 2EFIA 3FLGA 3H6ZA 3S6WA 2X4YA 4E7JA 3L2RA 4LD6A 4PL6A 3MEVA 2B8AA 4A4HA 2HQXA 2R58A 4PLLA 3L2VA 1OYXA 4IUUA 3QKJA 3O8VA 3P8DA 4BE0A 4A4EA 2D9TA 2X4WA 4QVZA 2RHZA 4FU6A 4RG2A 2O4XB 2X4XA 1KHCA 3P8HA 4C5HA 4BE1A 4E7HA 5IN1A 4A4FA 3C4SA 3OYLA 2DAQA 3SD4A 4IURA 1N27A 2RO0A 2LCCA 4E7IA 2QQRA 3LGFA 2YRVA 2M1HA 2LDMA 3M9QA 2EQJA 3NTKA 3Q1JA 3UT1A 2EKOA 5D6YA 3PMIA 4EDUA 5KCOA 1G5VA 5FROA 3OMGA 2F5KA 3OYFA 3LGLA 3H8ZA 2WACA 3MEUA 2BUDA 3FEOA 3BDLA 4E7LA 1RI0A 2RHUA 5CIUA 2R5AA 3L42A 2EQMA 1OZ2A 3ZEHA 3NTHA 5C0MA 3OYIA 4HCZA 4BD3A 1SSFA 4C5EA 2K3XA 2BIVA 2L8DA 4PLIA 3META 4QQGA 2M0OA 2X35A 4BACA 4QQ6A 4B9XA 3L2UA 3OYAA 2RHIA 2JZ2A 3FDRA
chains in the Genus database with same CATH superfamily
3PNWC 4BB7A 4M78C 2QI2A 4OVAA 1QCFA 2AIRB 4N0AC 1OZ3A 2J6OA 2R57A 3MEAA 3OYCA 3SWNA 2DILA 1K76A 3H9NA 2CT3A 4PJLA 4ZTJA 1Y57A 3KXTA 1IRXA 3HL8A 4KH1B 4HA8A 2LJ0A 2K4YA 4JLIA 1MHNA 5KCHA 1VQMT 3VS1A 4E7KA 1WFWA 3RKWA 4HVVA 5CD1A 1Q82U 3FPUA 1VQ7T 2KMTA 2QQSA 2O9VA 1E7OA 5LJ3j 1KK7A 4K11A 1VQ9T 3OS2A 2EQUA 1QMCA 4R55A 3ZGZA 2WSCE 1TUGB 1QW1A 4IUTA 1KG1A 2RK1A 3BY7A 4PJOC 2OAUA 2OTJA 5A0GA 5FRMA 2RB6A 3U23A 2E3HA 1W4SA 1UE9A 3OYEA 1VQLA 3CF2A 3REBB 1U8RA 4JRIA 3ME9A 4X34A 3LH5A 3RDVA 3EG1A 3EFOB 4M7AB 2HAXA 1VQPQ 2B25A 1K9MR 3A8GB 4KUDK 4PKCC 3MEVA 2XICA 2LCSA 4CC2A 1YITA 4PFPA 3OYYA 2D8JA 2RNAA 1E6HA 4QVZA 2JN0A 5GLFA 2DO3A 1X43A 1TTHB 2YWWA 4IIOA 2VKNA 1YHQQ 1IO6A 3LGFA 2LW6A 4KLNA 5CCXA 2K3BA 1G8XA 2EPDA 3E19A 3MPUB 3JAME 1UTIA 4CC7A 4DQ2A 5LJ5h 1GFCA 2JMCA 2K3XA 2VWFA 3EGDA 2A7YA 1XNIA 4X9CA 4A4GA 1ZSZB 1M3CA 4RKUE 4ZNXA 1G3SA 5I21A 1QVGP 3CC2Q 1P92A 3ZJUA 2ZPGB 1IZ6A 1JXOA 2C0IA 1M5Q1 3GNFB 2RI5A 4KBMB 3I56A 1FXXA 1PNJA 2HQHA 4JZ3A 2YT6A 1U1SA 3EGUA 1K8AC 3CBPA 3HU2A 1M2OA 3BFMA 2E5KA 2LRQA 1Q82R 3VS0A 2NWMA 1K0XA 2OTLA 2LMJA 5GAOq 2QA4T 1C6VX 2MIOA 2LVMA 3MP1A 2FRWA 2KAFA 5DY9A 3VS5A 4J6YA 1GCQA 3M56A 2CZ0B 2KR3A 2DMOA 3JCMh 5KYXB 1S72Q 1H8KA 4GLKA 1VYUA 2JVVA 2DZCA 3KBGA 3S3NA 3INZA 3A8LB 4M77C 3I35A 4CRIA 3MO8A 1YBYA 3CPFA 3QWXX 3RR6A 4J9IA 2AZVA 1U06A 3FLGA 3RIRA 4MDXA 4E7JA 3N5BB 3H41A 1B34B 1VUBA 2KE9A 2XG8D 4PJOD 3O8VA 2XDBA 1QDNA 5ECAA 2D8HA 4E7HA 1OULA 1KHCA 1VYTA 3GLXA 3ZFJA 1QCOA 2HEQA 3MCAB 2NYSA 1AD5A 3PMIA 1YI2Q 1BIAA 1G5VA 2COZA 1Y7XA 1VQNA 5GMKe 4LUEA 2KNBB 3CCMA 4E7ZA 1PCXA 1GBQA 1RABB 2EKHA 4RTUA 1JB0E 2X35A 1GXIE 4MZPA 1M30A 3OS0A 2EYWA 2YHTA 4KGVB 1JO8A 3G6EA 3SEMA 2AKKA 3JB9I 4FYWB 3PTAA 4XQ3A 2Y4YA 4AT1B 3ZJVA 3TCJA 1VQ4Q 3HRSA 3G4SQ 1D1CA 2YUJA 4AFQC 2JS2A 4ELYC 1VQOQ 3OBWA 1SKUB 3LH0A 2L3RA 2RJFA 2EJFA 2COYA 2JJ9A 2HQEA 4M78E 1AZEA 3EG3A 1OQKA 3CC4Q 5FRNA 1QP3A 3CD6A 2MM0A 3FB9A 2CYZB 2GNCA 1ZBXA 1ZSZA 1WHKA 3TSWA 5I2SA 2C06A 1UHCA 1QQJA 4C0DB 1X75C 3DB4A 3BW1A 2A3LA 2QXFA 1AWOA 2FPFA 2DIQA 5CAIA 5IAYA 1M2VA 2ROLA 3OMCA 3LLRA 1WXUA 2MK5A 1TOVA 2BZXA 3OA6A 2GTOA 4PJOE 1TSFA 3HSBA 5FW9A 1IXDA 2X4YA 1MMDA 2AT1B 4O6JA 1Q86U 2M0YA 1MUZA 2E65A 2JT4A 1VQ5A 2BZYA 1WLPB 4FU6A 5CKEA 5KYXA 2QQBA 3P8HA 3OSSC 4M7DC 3OYLA 2EIFA 2PZ1A 3CMAA 4OGEA 1VQ6A 1VIFA 3FJPA 5KCOA 1KC8U 3OMGA 4AQ7A 3OYFA 2BUDA 2EW3A 5LJ3e 4E7LA 1RI0A 4HXJA 5IHKA 1NEGA 1B34A 4C5EA 1YHQT 1OU8A 2OJ2A 3EHRA 2I2LA 4NL2A 2PUOB 3RNJA 3OYBA 1U1TA 4JDSA 3R6NA 3EG0A 1IB8A 1VQKA 2PWYA 3OB9A 3VV0A 2QEXT 4X1VA 2EGAA 5IXBA 2MWPA 4CI0C 4DBFA 1GCPA 3M0TA 5GANh 1TU0B 1HSQA 1AHJB 2E4HA 1WLFA 4FT2A 1KSWA 2L89A 1VQ7Q 4LDWA 3CC7T 3E2UA 5C6SA 2E6ZA 2ED1A 1VQ9Q 1OX9A 3FPRA 3O5ZA 3G71Q 1C0MA 1N8RU 3GPLA 2WSEE 4C92F 3RKXA 1M1GA 2JW4A 2X3WD 2DVJA 4ORZA 2CZ7B 5GJVB 1TUDA 4OMQA 4FW1A 3CCRA 2EQKA 4ESRA 1LPLA 5LJ3f 2P4RA 3FPTA 1M4ZA 1AOJA 1Q86R 3MJXA 5L8RE 3V7CA 5A0DA 5HK3A 4XU0A 4M77E 1SEMA 2K5LA 1I81A 4A53A 3RMSA 4C8QB 4E7IA 2OTJT 2HSPA 2LQKA 3QO3A 5GMKm 4Y28E 4PJOA 2YLCA 1KC8R 1VQLT 2DD4A 4JRPA 3HU3A 4HCZA 7AT1B 2J6KA 1K73U 5D7UA 2BIVA 5GAN4 4J5YA 5IHNA 2V8KA 1YITT 2FVUA 4M7DD 2Z0WA 3ASKA 1WJRA 2DEUA 2DTOA 3JSCA 1OPKA 4LDYA 2YVLA 2AHJB 3CCSA 1WA7A 3PVQA 3JCMQ 3J80E 1MMGA 1ZLMA 3DKMA 1V76A 2LX7A 3FRNA 2KXCA 1NJIC 3VRZA 1VQOT 1CZ5A 1SHFA 3H0HA 3I5RA 1UB4A 1XTDA 3VUBA 4JRKA 2IIMA 1T0HA 5FWBA 3C0CA 1RAFB 2C0OA 4MMKA 2QA4Q 1PRLC 3VS2A 1LJOA 4F17A 2H3JA 1N8RR 3QIIA 4GLMA 3RERA 3A8MB 3UWNA 3TVTA 3I56T 5GAN6 5DLQE 2HKNA 2CP2A 1OU9A 4MZTA 3EH1A 2OTLT 1Q95G 1ZA1B 4J9CA 3CCQA 2FZCB 4C5HA 2KQWA 2BZ8A 2DAQA 3V7SA 1HJDA 4CQNA 4KGZB 4RV0A 3QHSA 2DERA 5LJ5e 3R6OA 2LDMA 1PSFA 1CR5A 2H8HA 1I0CA 2EKOA 1B07A 1ABOA 5CKDA 1M1FA 3QC8A 1VQPA 1WHLA 2XD0A 1BK2A 3EGDB 2CS7A 4M7DE 3NGPA 1K73R 2KSSA 4RTYA 5DLOA 2CKKA 1OEBA 1FMKA 2DL3A 5D6XA 1S3SA 3WVDB 3OYNA 2DLPA 1QCNA 1LNXA 2KK4A 3A1PA 4XK8E 2LT1A 2DX1A 3CBMA 2M51A 2HNIA 1VQNT 3M53A 3P8BB 3HPWA 4LUDA 3HKSA 1K8AU 2DM1A 4QQDA 2Q1DX 3JCMe 3CCMT 2P0KA 2EGCA 1WX6A 3MP6A 2K9GA 4AS1A 2KROA 2P0QA 4BDYA 3PMTA 2DE0X 4XTYA 3G6ET 5FU7C 3L2QA 1SSHA 1BBZA 2EGEA 2JTEA 4NOYA 3TQ7P 2DA9A 4J9EA 3BDUA 5D6WA 4FW2A 8AT1B 4FSXA 4F7UF 1K0SA 4HCBA 3EG9A 3OW2S 3PE0A 4FT4A 4D8DA 3CCUA 3CD6T 3M0SA 3G71T 4XU2A 1AWJA 2RH2A 5DM7R 1M8MA 2CT4A 3G7ZA 4IUUA 3QKJA 4DOVA 4E7SA 3P8DA 5AYFA 1FX7A 1NLPC 1TG0A 2W0ZA 3C4SA 5CKHA 1T3SA 2QQRA 4O5VA 5CCAA 2YRVA 3CXCS 1WQWA 4XU1A 1W70A 1UGPB 2EQJA 1PD1A 2DXUA 3NFCA 1M90C 5ERGB 2JUFA 1TWBA 1RAEB 2I0NA 2HZYA 2XHCA 4PFZA 2EWNA 2V1QA 5HKCA 4RTZA 1UJ0A 3JB9F 4PLIA 4OGCA 2P84A 2E70A 3WXMB 2K6DA 3CBOA 3L2ZA 4FYYB 2EYQA 5I2MA 1D1BA 4PJNA 1QP2A 1F1BB 2JTFA 1VQ5T 4ZN1A 1FMWA 3OS1A 1W2BS 4DBRA 5CVIA 3CMAT 2E12A 2X3XD 1VQ6T 2MWOA 4N4GA 4M7DA 4M78G 2Y4XA 4C92C 5KE3A 2JS0A 3QWZA 2QDLA 2HD0A 3CEYA 2QEXQ 1K8AR 4HCCA 2CH4A 2GF7A 4EIKA 3OW2A 3HTRA 2QTXA 2MM2A 5J3BA 2RA2A 3I9QA 1SF9A 2MF2A 1R77A 2RD1A 4M7AF 4DBHA 3G4SA 4PJJA 4JRQA 5HY6A 2CUDA 3M5AA 2QQ9A 1VQKT 4J6XA 2LQNA 2CGHA 4LDXA 3CC7Q 3CCLA 1M2VB 3GF5A 2HBWA 1RAHB 1NLOC 1XJWB 1YIJA 3TU4K 4PJOG 2RQRA 4M78D 3LWHA 1W6XA 4ANJA 1X6GA 2JOYA 1JU5C 1I1JA 3SFMA 2K2MA 3E1SA 4XTWA 2B8AA 3M4YA 3CPWS 4PLLA 2Y90A 5GMKl 1CZ4A 5FU6B 4A4EA 3A5ZB 2CSIA 2F69A 4QKUA 1KD1C 1PD0A 3M59A 1BI1A 4A63B 4JPBW 2C0TA 1W1FA 1W2BA 1G3WA 1NEBA 2YRDA 1KQ1A 2ZAEA 4EDUA 1KJWA 1QWEA 2OTJQ 1RLPC 1Q7YC 3BQBA 5CIUA 1KHIA 2R5AA 4OMFB 3CCRT 2RK2A 2DF6A 1HYOA 1KIKA 4KDIA 2DRMA 4ZGDB 1VQLQ 2K5FA 1NPRA 4R0KA 1C1AA 2DL4A 3FIFA 2VUBA 3A8HB 2H3EB 5DYIA 5HCKA 3VUZA 2LJ1A 4BI3A 5LJ5g 3VRYA 2DJZA 1YITQ 1RACB 2YRCA 4OMLA 4C92G 1N6AA 1X2KA 1D09B 2DTIA 5LJ5d 2E3IA 5KYUA 1X6OA 1GFDA 2FPEA 2WSFE 4WTOB 3AHUA 2RJCA 3OBYA 2FZGB 3L2WA 1AWXA 5KH6A 2O2OA 2ENMA 3SHWA 2ESWA 2CUBA 3LX7A 2J06A 1LVKA 1MV0B 5IH2A 4XTVA 3CPWA 4ZTFA 2COWA 4EMHA 2YUPA 2EJGA 1G3TA 4JS4A 3M0PA 1NBEB 4M78B 2E5QA 4IUPA 4BDZA 1QVPA 2XI9A 4OMPA 4CC3A 2CH4W 2A36A 4C92D 3CCST 3M55A 5LJ5j 2K2VA 3JCMg 1VIEA 1YWOA 2R5MA 2QGFB 1YFNA 2LTOA 2FG0A 3T9NA 2EFIA 4JLGA 1VQMA 3ZBDA 2HL3A 2JNGA 3JCMd 3I56Q 2XDDA 3QG1A 4M77G 1EZZB 1YJ9A 2HKQB 3CMEA 1JJ2S 1BKBA 3QPHA 1IREB 4A4FA 3UA6A 2OTLQ 4IIMA 4KUIA 4ZN3A 1N27A 2LCCA 1OOTA 5GAN2 4Y91A 2DXTA 3EGXA 4PJOB 5B6CA 3L1AA 3M9QA 1IHWA 2DYIA 2QDYB 3HFNA 2DVEA 4FCYA 1EFNA 3H0FA 1ZHIA 3H0IA 3META 2ZPHB 2M0OA 4EMKC 4KRTA 3HHTB 4AFUC 4JJCA 3CCQT 1ZX6A 4RMOA 4M77D 2JTMA 2CZ6B 2KI7A 4JJDA 2KT8A 1LCKA 5CO7A 2PNIA 2DETA 2A37A 3QDFA 3SDZA 1RUWA 4WF2A 2DFUA 1RAAB 3CCEA 4E2FB 4KGXB 3VS4A 2O31A 3VYGA 1NJIU 2QASA 3DLMA 2QGGA 1U3OA 5CCBA 1YJNT 1OV3A 3S3MA 1VQNQ 1NG2A 1NE8A 3NTIA 3OYMA 3CCMQ 3OYKA 1BB9A 5LL6S 2RPNA 2V8JA 4C92E 4GY5A 2BE7D 3QUIA 2AKLA 4BY6C 5L23A 3OW2P 3G6EQ 1G3YA 2LT4A 2O88A 1E6GA 2NUPB 2NUTA 4AFZC 1BCOA 1SG5A 4Z89A 2ZPEB 2QTVA 2LX9A 3G1JA 3S6WA 2PUKB 4AG2C 4OMMA 3L2RA 5EG2A 1UJYA 2K5IA 1R0CB 4HKEA 1GCQC 1YN8A 4OB3B 2X4WA 3CD6Q 2DEQA 3CXCP 2RHZA 4M78A 4XAXB 3I55A 2O4XB 2RQTA 2GQVA 5FWCA 4N0AA 4OB0B 1Y0MA 5GMKi 2F5TX 5GMKh 2XIDA 5EQJB 4RCBA 2O01E 4M75E 4OF1A 1Y71A 2KYBA 2A28A 2F5KA 4HVUA 1MV3A 1RLQC 2MCNA 3UF4A 1WNLA 4XTXA 4M7DG 4M77B 2KVQG 3CCUT 4OB1B 2D1XA 1M3BA 1D1AA 5GAMh 1W2BP 2JZ2A 5KYYA 1VQ8A 3RBBB 1WI7A 3X26B 2MMPA 3KFVA 3HU1A 1JBMA 5DYGA 2DXCA 2RN8A 3DB3A 2DBKA 1VQ5Q 4M75F 4PJMA 4M7AC 2KXDA 2M02A 2VXEA 4F7UG 2LCLA 2CP7A 1H3ZA 4ZGJB 5IT9E 3OSVA 2F1LA 4NL3A 3E9GA 3CMAQ 5I11A 1VQ6Q 4AG1C 4XU3A 1CKAA 4IKFA 3UATA 1YJWA 1OI1A 1NJIR 4DEXA 1PM3A 1ZA2B 4ATOA 2OX7A 2L3PA 3CCJA 3CCVA 1Y96B 5GANg 2DRKA 2FEIA 1BIBA 4YTLA 5CKBA 1XOVA 3M57A 2Q1CX 2IPOB 5GANd 3NPFA 2DZ9A 4J6WA 4J83A 4DBQA 3EG9B 4M4ZA 1VQKQ 2EAYA 3CPWP 1FMVA 1O54A 2YUOA 4BUGA 4J9HA 2LNHB 3MHXA 1ZSZC 1Z9QA 3IQLA 4PL6A 4C8QF 4C92A 1R7RA 4F14A 1RI9A 2PTKA 2KRNA 3C94A 2X4XA 3M0RA 4D6WA 5LJ3h 4ARIA 1LOJA 2CP0A 1V1CA 3D7SB 3JCMV 2NUPA 1O75A 3VS6A 4EPCA 4J7IA 3CCLT 5GANj 5GAN7 5KYWA 1Q81U 1H3HA 1M90U 3H8ZA 1VYVA 4B6MA 1YIJT 4EMGA 3FEOA 3JCMX 2PVDB 4LDUA 1M3AA 5GAMd 1NZ9A 4QQGA 3JB9D 3QZ9B 1MMAA 3PGGA 1K9AA 2RM4A 2VVKA 4TVRA 3CCRQ 1D3BB 2O4XA 2K79A 1NYFA 3VYHB 4ME7A 1RL2A 2PQWA 1QKWA 4D8KA 1ZUYA 1WQ7A 1ZUKA 4L6V5 4PK4A 3OYHA 4M7AG 1UGSB 1BI3A 2A0FB 1CKBA 2MAMA 3LHDA 5I22A 1IGQA 1ZSGA 2M16A 5FTLA 1T3LA 4M7DB 3OYJA 2EYZA 5J39A 2MI6A 3VJPA 4M77A 1MNDA 1JEGA 5GAMj 3JB9J 1QVFS 4QW2A 4V2SA 1J3TA 3QZ5B 2DIGA 1YHQA 1X27A 3PFSA 1MMNA 1WIEA 2KYMA 3JCMc 2E6NA 3THKA 2QQAA 4M7AD 3QJ6A 4IUVA 2RHXA 3JV3A 4AFSC 4F7UE 4Z8AA 1YNZA 5C18A 2LJ3A 2J6FA 4NS5A 3CCSQ 4C0ZA 1R8OB 2F2XA 3CQTA 4GBQA 1S1NA 2BTTA 1JJ2P 4DA4A 2F2VA 1X01A 3CC2A 1YCYA 1JRIA 1I5OB 5GAOp 1Y96A 1UGVA 2HMAA 5FTKA 1I9GA 1ZBJA 4FYXB 3A8OB 1KD1U 3EFSA 1JQQA 1H641 2OAWA 1VOMA 5LJ5f 3TREA 3CC7A 1PKTA 3ULRB 4XTZA 3NTKA 5EC7A 3J7AF 1M1KC 1AZGB 1Q81R 1M90R 3BDLA 1Q7YU 2EQMA 2DTHA 3QSUA 2JXBA 4C0DC 2L8DA 1IHVA 4RUGA 4BACA 4Z88A 3FDRA 3HRUA 1S72A 1QVFA 4KODA 1YJ9T 2X4JA 2ZCFB 4C5GA 1G2BA 1WJQA 3CMET 2X51A 4JUVA 2XK0A 2KDSA 3M0QA 3JCMb 4R56A 1PKSA 1Q81C 4A54A 3CCQQ 3J81E 5KYUB 4F16A 2XDPA 1NPPA 4KDLA 1BYMA 3JCMf 2Q19X 1RAGB 3V7RA 2YUNA 2YXYA 2K3YA 2LQWA 1D3BA 1QLYA 5GAOm 5CQYA 1DJ7B 4M7AE 2YDLA 3MEWA 1X69A 4CC4B 1YJNQ 3OYDA 2LNVA 1YI2A 3QQ7A 4EMKA 3QJYA 4OMNA 3KUFA 4KULA 1WGSA 2ECZA 3MKDA 2LZ6B 1NM7A 6AT1B 1GBRA 2RI2A 1TUCA 2RJDA 3FJ5A 3OS5A 1K9MC 2DKGA 1WHGA 3CCET 1I07A 4HCKA 2ABLA 4LD6A 1NYGA 2R58A 1T0JA 5GAN8 1VQ4A 4LE9A 2JM9A 4F7UA 1VQOA 4KO8A 1QWFA 3I5SA 4OMOA 4HVWA 1KD1R 4IURA 3EGXB 1GRIA 2XMFA 3CXCA 2W10A 1O9SA 4A4KA 2MPXC 3CC4A 4QT7A 2DD5A 2P4TA 2DNUA 4M75C 4RG8A 3JCMJ 1Q7YR 1WHMA 4BD3A 2FB7A 5CR2A 4QQ6A 4B9XA 2L2PA 5M9OA 1VA7A 1TS9A 3X20B 3CCUQ 2EYXA 4BI8B 1HD3A 2RJEA 3A98A 3I55T 4JS5A 1AWWA 1PG5B 4X9DA 2AK5A 4Q5WA 4E6RA 5GAN3 2ROTA 1ZQ1A 3C95A 1H92A 3PIPA 3EHQA 2PVGB 2CSQA 4AMCA 1Q82C 5KYNA 2V8IA 3X24B 4L5GA 3GOXA 1M27C 3ZJTA 2YSQA 1PWTA 2RHYA 2QAZA 1KQSS 1V29B 3EAEA 2D0QB 3V8LA 2KBTA 2JV2A 4C8QC 1VQ8T 2VYTA 1PRMC 5GANe 2KRMA 1YWPA 4JJBA 4FIBA 2ZPBB 3ER0A 2DPPB 2YLBA 2NLUA 1HXDA 2L5QA 2RQUA 3LWIA 2VGNA 2NUTB 5GAOn 5CK9A 2DYBA 1UEBA 1GL5A 4LDVA 1OX8A 2XU8A 5CKFA 5A2QE 2KRSA 3EFOA 3URGA 4M7AA 8ATCB 3SWNC 1YJWT 1TXQA 3LW5E 3WVEB 1Y07A 3QWYA 4BE0A 3RUXA 4PNOA 3CCJT 3PIOA 3GIBA 3CCVT 2MOXA 4BE1A 1X2QA 5IN1A 2YUQA 2CZ1B 4J8OA 2RO0A 2E1HA 2QK0A 4JZ4A 2RQWA 1PHTA 4M75G 5FU7B 2E10A 1EX4A 4RTTA 1AEYA 2P0PA 5GAMe 2HDAA 2JM8A 1OZ2A 5GAOr 3CCLQ 1VQ7A 1X6BA 1ZUUA 2CDTA 2ED0A 4OP0A 1YIJQ 1VQ9A 3LGAA 5KYYB 3G71A 3HRTA 1BI2A 4WCIA 3UPUA 4HT8A 1KQSA 1D0ZA 2EVRA 3LYIA 2HL5C 2L0AA 5GANf 1SPKA 1M8VA 1U5SA 2X9HA 2L3QA 2DK3A 3QYGB 2FYKA 2QG9B 4M75D 1RADB 4MMLA 4II1A 2RMOA 4IUQA 1QVFP 2KGTA 4B9WA 1UFFA 4Z02A 5FTJA 2F2WA 3GNGA 3RKYA 4M78F 4LXCA 4MDWA 3QBYA 4C8QG 2FHDA 1WJSA 1R0BG 2VB6A 4J7FA 2D0NA 2CP3A 1B7TA 3UDCA 2DJQA 2IG0A 1TH7A 2G6FX 4ZGEB 3VS3A 1MNEA 5IXFA 4RTWA 1ABQA 1ZC1A 2ZPFB 3E9FA 1VQPT 1WXBA 2GGRA 2GFAA 2VGMA 5HK0A 3GBQA 5GAMf 3M0UA 2EQIA 3H6ZA 2O9SA 4C92B 1KQ2A 2ATCB 4PJOF 4J9GA 4C8QD 3AT1B 2KY9A 3EH2A 3M4GA 2K57A 2D9TA 1N5ZA 4J9DA 3RESA 1N9SA 1JJ2A 4KH0B 4RG2A 2V1RA 4C0FA 3HP9A 1QCSA 1WHHA 1Z9ZA 3HFOA 4MZMA 1M9SA 1A0NB 4PFOA 2B86A 5KYWB 1BCMA 3JB9H 3C12A 2E64A 2WACA 3MEUA 3VS7A 4HT9A 4ELZC 2GQIA 3ZEHA 1PC0A 3OYIA 1WZOA 2Q18X 2LC4A 3VU3C 3BE3A 4DEYA 1D0XA 2QA4A 3CC2T 3X25B 2VV5A 3PVLA 2ZZDA 2VXFA 2FZKB 1VQMQ 5EPPA 1SRLA 4M75B 4J9FA 4FL6A 3FC3A 2PJHB 3RMQA 1MGQA 3OY9A 2K7AA 1SRMA 1WPYA 1ACMB 4F04B 1YJ9Q 2DL8A 2XKOC 2DBMA 1QVGS 3CMEQ 2PVOB 2CP5A 3OQ5A 4RCCA 1D0YA 5GAOl 2VC8A 1QKXA 1OPLA 2L3SA 3X28B 3REAB 3M58A 2EBPA 1I5LA 4N4IA 1AT1B 1S72T 2RF0A 1UG1A 1FYNA 1UGRB 4FSSA 1I8FA 4UC4A 4L59A 3UA7A 3OYGA 1WHJA 1N9RA 2M9UA 1RAIB 5A0LA 3SB2A 2EYYA 3MP8A 4QVDA 1IGUA 2SEMA 3M54A 2E41A 4FM4B 1WDXA 4C8QE 1UUEA 4J9BA 4C0GA 4ARCA 1AVZC 2GCXA 4FYVB 1Q86C 4A4HA 1BI0A 1OYXA 2ZGWA 1HK9A 2FPDA 3CCEQ 2LP5A 4XTUA 2RQVA 1YI2T 3SD4A 1EIFA 4M77F 3SWNB 2DXBA 4LD9K 3TEEA 3Q1JA 1E32A 2JMAA 5D6YA 1KC8C 2LQ8A 5FROA 3JB9G 2FL7A 1QVGA 3TIWA 1M1KU 1SHGA 2RHUA 1YP5A 4DOWA 3L42A 2DL7A 1K1ZA 3NTHA 3JCMW 3PT9A 3L2UA 2V26A 2AZSA 3S3OA 1PSEA 2RHIA 4RTXA 1VQ4T 3G4ST 2CREA 3QXEB 1FWZA 1XQHA 2GFUA 3V8KA 5KE2A 1B3QA 4E47A 2NUZA 5GAMg 3VKIA 5C1BA 2MYSA 4BE2A 3I55Q 3CC4T 5GAN5 4P5NA 2GBQA 2QYZA 3GP8A 2BKDN 1KQSP 3DLLA 1CSKA 5FU6C 5FTNA 2HBPA 2DL5A 2RI3A 4M75A 5GMKj 4KT0E 5J26A 1WYXA 2HSEB 9ATCB 2BE9B 2KEAA 3QQ8A 1UGQB 2G3RA 4OB2B 4EMKB 2Q1AX 2A08A 3F70A 4C5IA 1N8RC 4N4HA 1VQ8Q 1JXMA 2GTJA 5FTMA 2FRYA 2VASA 5AT1B 1K4US 1KFZA 1K9MU 2KT1A 2J05A 1UECA 2EJ9A 3ZL7C 2SRCA 2HQXA 3NMZC 3V8JA 2HCKA 3L2VA 3EFRA 4F7UB 1BU1A 1YJNA 1YCSB 2ZPIB 4Y92A 1YJWQ 3QYHB 1ARKA 2IVWA 3JRZA 4VUBA 4JJNK 4BI4A 1G83A 4QVCA 3CCJQ 1WXTA 4C8QA 3CCVQ 2D6FA 2M1HA 2PU9B 1UHFA 2FO0A 4RTVA 4LN2A 3UT1A 2QEXA 3QDRB 2CP6A 3LGLA 3EG2A 1I4K1 4BY6B 2OI3A 5LJ3g 1M1KR 5FLXE 5CQXA 4LNPA 5IHIA 3TSZA 2J7IA 5C0MA 3JCMP 1K73C 1SSFA 3MB5A 3NHNA 5LJ3d 5GJWB 3OYAA 4M7DF 1UDLA
chains in the Genus database with same CATH topology
3PNWC 4BB7A 4M78C 2QI2A 2FVUA 3HHTB 4OVAA 3X20B 4M7DD 4N0AC 3ASKA 1WJRA 3CCQT 1OZ3A 3MEAA 2R57A 4BI8B 4RMOA 3SWNA 3OYCA 2RJEA 4M77D 2DTOA 3I55T 4JS5A 2JTMA 3JSCA 2CZ6B 4LDYA 4X9DA 4ZTJA 4Q5WA 3KXTA 2YVLA 2AHJB 3HL8A 3BQBA 5GAN3 3CCSA 4HA8A 2K4YA 4JLIA 1MHNA 5CO7A 5KCHA 3JCMQ 1ZQ1A 3C95A 3J80E 1VQMT 3SDZA 4E7KA 3PIPA 3DKMA 2PVGB 4WF2A 3CCEA 3RKWA 1Q82C 5CD1A 1Q82U 3FRNA 1VQ7T 3FPUA 2V8IA 2KMTA 2QQSA 3VYGA 4L5GA 3X24B 3DLMA 3GOXA 1NJIU 1NJIC 5CCBA 3ZJTA 1YJNT 3S3MA 1VQOT 5LJ3j 1CZ5A 2RHYA 1VQ9T 3OS2A 1KQSS 2EQUA 1UB4A 1XTDA 1V29B 3VUBA 3EAEA 1NE8A 3NTIA 4JRKA 2D0QB 4R55A 2WSCE 3V8LA 3OYMA 3OYKA 2JV2A 3ZGZA 4C8QC 1QW1A 4IUTA 5LL6S 1VQ8T 2RK1A 2VYTA 3BY7A 4PJOC 1KG1A 5GANe 2OAUA 2V8JA 4MMKA 4C92E 4GY5A 3QUIA 4FIBA 2OTJA 5A0GA 1LJOA 5FRMA 2ZPBB 3ER0A 2DPPB 4BY6C 2H3JA 2YLBA 2NLUA 2RB6A 1HXDA 1G3YA 2LT4A 2L5QA 3QIIA 3LWIA 2VGNA 3A8MB 3UWNA 1W4SA 3RERA 5GAOn 5CK9A 1UEBA 3OYEA 1VQLA 3CF2A 4LDVA 1U8RA 4JRIA 3ME9A 5GAN6 4X34A 3I56T 4M7AB 2HAXA 5DLQE 2XU8A 5CKFA 2B25A 5A2QE 4M7AA 3URGA 2ZPEB 3S6WA 2LX9A 3A8GB 2PUKB 4MZTA 3SWNC 1YJWT 3L2RA 4KUDK 4PKCC 5EG2A 3MEVA 2XICA 3LW5E 3WVEB 2K5IA 1Y07A 2OTLT 1YITA 3OYYA 4HKEA 4BE0A 4OB3B 2X4WA 3RUXA 4PNOA 3CCQA 2DEQA 3CCJT 4QVZA 2RHZA 4M78A 4XAXB 3PIOA 3CCVT 4C5HA 2O4XB 2JN0A 3I55A 2GQVA 2KQWA 4BE1A 4N0AA 5IN1A 2DO3A 5GLFA 4OB0B 2DAQA 3V7SA 2CZ1B 4J8OA 5GMKi 2F5TX 5GMKh 4CQNA 2RO0A 2E1HA 2XIDA 4RV0A 5EQJB 3QHSA 4M75G 3LGFA 5LJ5e 4RCBA 5FU7B 2O01E 3R6OA 2E10A 1PSFA 2LDMA 1CR5A 4M75E 2LW6A 2EKOA 4OF1A 4KLNA 1Y71A 2P0PA 5GAMe 5CCXA 2F5KA 5CKDA 1M1FA 3QC8A 1VQPA 3E19A 3JAME 1WNLA 4XTXA 2XD0A 1OZ2A 5GAOr 4M7DG 4M77B 1VQ7A 2KVQG 4DQ2A 5LJ5h 2CS7A 3CCUT 2K3XA 4M7DE 4OB1B 4OP0A 2A7YA 2KSSA 5GAMh 1VQ9A 3LGAA 5DLOA 2JZ2A 2CKKA 1XNIA 4X9CA 4A4GA 3HRTA 3G71A 2D6FA 1BI2A 1VQ8A 5D6XA 3UPUA 4RKUE 3X26B 1G3SA 5I21A 4HT8A 1KQSA 2MMPA 1S3SA 3WVDB 3OYNA 3LYIA 1P92A 3ZJUA 1LNXA 5GANf 3HU1A 2KK4A 1JBMA 2ZPGB 1M8VA 1IZ6A 2DXCA 5DYGA 3DB3A 4M75F 2DK3A 4M7AC 3QYGB 4XK8E 2FYKA 1M5Q1 4M75D 3GNFB 4MMLA 2VXEA 4II1A 2LCLA 4F7UG 4IUQA 4ZGJB 2RI5A 5IT9E 3OSVA 4KBMB 4B9WA 4NL3A 2LT1A 3I56A 3CBMA 3E9GA 1FXXA 2HNIA 3M53A 3P8BB 4Z02A 1U1SA 3HPWA 1VQNT 3HKSA 5FTJA 1K8AC 3GNGA 4XU3A 1K8AU 4IKFA 3RKYA 3CBPA 3HU2A 4QQDA 2Q1DX 3JCMe 3BFMA 3CCMT 4M78F 1YJWA 4MDWA 3QBYA 2LRQA 2P0KA 1OI1A 4C8QG 2FHDA 1WJSA 3MP6A 4J7FA 2OTLA 5GAOq 2QA4T 4AS1A 3UDCA 2LVMA 2IG0A 2P0QA 3MP1A 4BDYA 4ATOA 2KAFA 5DY9A 3PMTA 3CCJA 4J6YA 1TH7A 3M56A 3CCVA 2CZ0B 4XTYA 1Y96B 5GANg 3G6ET 5FU7C 3JCMh 3L2QA 4ZGEB 1BIBA 4YTLA 5CKBA 4GLKA 1ZC1A 4NOYA 2JVVA 1XOVA 3M57A 2DZCA 2ZPFB 3BDUA 3E9FA 3KBGA 1VQPT 5D6WA 5GANd 2Q1CX 3S3NA 2DZ9A 3INZA 3A8LB 4M77C 4FSXA 3MO8A 2GFAA 4J6WA 4J83A 4CRIA 4F7UF 2VGMA 1YBYA 5HK0A 2EAYA 4HCBA 5GAMf 3CPFA 1O54A 3OW2S 4FT4A 3FLGA 4MDXA 3RIRA 4BUGA 3H6ZA 3CCUA 3CD6T 3MHXA 4C92B 3G71T 4XU2A 4E7JA 1KQ2A 4PL6A 3N5BB 4C8QF 2RH2A 4C92A 5DM7R 4PJOF 1R7RA 1B34B 1VUBA 3G7ZA 4C8QD 2XG8D 2KY9A 3M4GA 3QKJA 3O8VA 4IUUA 2K57A 3P8DA 4DOVA 2XDBA 4PJOD 1QDNA 2D9TA 3C94A 1N9SA 3RESA 1JJ2A 5AYFA 1FX7A 4E7HA 4RG2A 2X4XA 1KHCA 4C0FA 3HP9A 1QCSA 3C4SA 3GLXA 4D6WA 5LJ3h 4ARIA 3HFOA 4MZMA 1LOJA 5CKHA 1M9SA 3ZFJA 2QQRA 4O5VA 5CCAA 2YRVA 3CXCS 1WQWA 3MCAB 4XU1A 1O75A 1UGPB 2EQJA 4J7IA 3JCMV 4EPCA 3CCLT 5GANj 3PMIA 2DXUA 5GAN7 3NFCA 1BIAA 1G5VA 3JB9H 1M90C 1Q81U 3C12A 1M90U 5ERGB 1Y7XA 2E64A 2JUFA 2WACA 3H8ZA 3MEUA 1YIJT 4EMGA 3FEOA 1VQNA 2XHCA 4HT9A 3JCMX 2PVDB 4ELZC 5GMKe 2EWNA 4LDUA 5HKCA 3ZEHA 3OYIA 3CCMA 2Q18X 2LC4A 3VU3C 5GAMd 3JB9F 4PLIA 1NZ9A 4QQGA 1JB0E 3JB9D 3QZ9B 2X35A 4OGCA 2QA4A 4MZPA 3CC2T 1GXIE 2E70A 3WXMB 3PGGA 4TVRA 3CBOA 2RM4A 3L2ZA 5I2MA 2EYQA 3X25B 3OS0A 2VV5A 1D3BB 2O4XA 2VXFA 2ZZDA 2YHTA 1QP2A 4ME7A 3VYHB 4M75B 1RL2A 2PQWA 5EPPA 3G6EA 1WQ7A 2JTFA 1VQ5T 4ZN1A 4FL6A 4L6V5 3FC3A 3RMQA 3JB9I 3OS1A 1MGQA 3OYHA 1UGSB 3PTAA 1W2BS 1BI3A 4XQ3A 4M7AG 3OY9A 2Y4YA 1WPYA 3ZJVA 2MAMA 3TCJA 3HRSA 3LHDA 2YUJA 5CVIA 4ELYC 2E12A 3CMAT 2XKOC 2M16A 1QVGS 3OBWA 1VQ6T 5FTLA 2MWOA 2PVOB 4M7DB 3LH0A 3OYJA 3OQ5A 2L3RA 4RCCA 5GAOl 4N4GA 4M7DA 2RJFA 5J39A 2MI6A 3VJPA 4M78G 2EJFA 2Y4XA 4C92C 4M77A 5KE3A 2VC8A 2HQEA 4M78E 3X28B 5FRNA 2MM0A 1QP3A 3CD6A 3QWZA 2HD0A 3CEYA 3M58A 5GAMj 3JB9J 1QVFS 4HCCA 2GF7A 3FB9A 4QW2A 2CYZB 3OW2A 4V2SA 3QZ5B 1ZBXA 2QTXA 1I5LA 2MM2A 5J3BA 5I2SA 2RA2A 2DIGA 4N4IA 1YHQA 2C06A 1S72T 4C0DB 3PFSA 1X75C 1UGRB 3DB4A 1I8FA 2MF2A 4L59A 4UC4A 3JCMc 2E6NA 2RD1A 3OYGA 4M7AF 3BW1A 3G4SA 4JRQA 5HY6A 3M5AA 2QQAA 4M7AD 2A3LA 2QQ9A 1N9RA 1VQKT 3QJ6A 4IUVA 4J6XA 2M9UA 2CGHA 2QXFA 2RHXA 4LDXA 4F7UE 5A0LA 3CCLA 2DIQA 3SB2A 3GF5A 5CAIA 5IAYA 3MP8A 3OMCA 3LLRA 5C18A 4QVDA 1YIJA 3TU4K 3M54A 3OA6A 2E41A 4FM4B 4NS5A 4M78D 4PJOG 3LWHA 4C8QE 4C0ZA 1R8OB 4C0GA 4PJOE 3HSBA 4ARCA 2GCXA 2JOYA 2X4YA 3SFMA 4O6JA 4DA4A 1Q86C 4XTWA 3E1SA 1Q86U 1X01A 2B8AA 4A4HA 3CC2A 3M4YA 3CPWS 1YCYA 1JRIA 4PLLA 1BI0A 1OYXA 2E65A 2Y90A 1HK9A 2ZGWA 1Y96A 5GMKl 5GAOp 1CZ4A 5FU6B 5FTKA 4A4EA 1I9GA 1VQ5A 2PJHB 3A5ZB 4FU6A 5CKEA 4XTUA 2F69A 2QQBA 3OSSC 3P8HA 3A8OB 1KD1C 4M7DC 3OYLA 1KD1U 3EFSA 5B6CA 2EIFA 1YI2T 3SD4A 3M59A 1EIFA 1H641 4M77F 3SWNB 5LJ5f 2DXBA 1BI1A 3TREA 3CC7A 3CMAA 4OGEA 4LD9K 1W2BA 1VQ6A 1G3WA 4XTZA 3NTKA 3TEEA 1KQ1A 1VIFA 3Q1JA 1E32A 5D6YA 4EDUA 3FJPA 2LQ8A 5KCOA 1KC8C 1KC8U 5FROA 3OMGA 3JB9G 4AQ7A 3OYFA 3J7AF 2FL7A 1QVGA 1M1KC 3TIWA 1M1KU 2BUDA 5LJ3e 3BDLA 4E7LA 1Q7YC 1RI0A 1KHIA 2RHUA 5CIUA 4DOWA 2R5AA 3L42A 4OMFB 1Q7YU 2EQMA 3CCRT 3NTHA 3JCMW 2RK2A 2DTHA 1B34A 3PT9A 4C5EA 3QSUA 4KDIA 4C0DC 2L8DA 1YHQT 4ZGDB 2K5FA 1NPRA 4BACA 3L2UA 2I2LA 3S3OA 1PSEA 3FIFA 2VUBA 2RHIA 3A8HB 3FDRA 3HRUA 4NL2A 1S72A 1QVFA 4KODA 1VQ4T 2PUOB 3G4ST 5DYIA 1YJ9T 3VUZA 2X4JA 2ZCFB 4C5GA 3OYBA 1U1TA 3QXEB 4BI3A 1FWZA 1WJQA 4JDSA 3CMET 5LJ5g 1XQHA 2GFUA 4JUVA 3V8KA 5KE2A 2XK0A 2KDSA 4E47A 2DJZA 3JCMb 5GAMg 4R56A 1VQKA 4C92G 1Q81C 3VKIA 2PWYA 5C1BA 4A54A 3OB9A 1N6AA 3J81E 3VV0A 4BE2A 2DTIA 5LJ5d 3CC4T 1X6OA 5GAN5 2QEXT 2WSFE 2XDPA 4P5NA 1H3ZA 3AHUA 1NPPA 2RJCA 3OBYA 4KDLA 3GP8A 2BKDN 1BYMA 3JCMf 2Q19X 2MWPA 4CI0C 3V7RA 3DLLA 3L2WA 5GANh 5FTNA 5FU6C 2HBPA 5KH6A 2K3YA 1D3BA 1AHJB 5GAOm 1WLFA 2RI3A 3LX7A 4M75A 4FT2A 5GMKj 4KT0E 2L89A 5CQYA 5J26A 4XTVA 1DJ7B 4LDWA 4M7AE 3CPWA 4ZTFA 4EMHA 3MEWA 3QQ8A 1UGQB 3CC7T 2G3RA 4OB2B 2E6ZA 2LNVA 4EMKB 5C6SA 3OYDA 2Q1AX 1YI2A 3QQ7A 2EJGA 1G3TA 4JS4A 4EMKA 4M78B 3F70A 3FPRA 3QJYA 2E5QA 4IUPA 4C5IA 4BDZA 1N8RC 3KUFA 1N8RU 1QVPA 2XI9A 3GPLA 2WSEE 4N4HA 4KULA 1WGSA 4C92F 3GIBA 3RKXA 1M1GA 4C92D 3CCST 3M55A 5LJ5j 5FTMA 2RI2A 2K2VA 3JCMg 2CZ7B 1VIEA 2R5MA 2RJDA 2LTOA 3OS5A 1K9MC 3CCRA 2DKGA 3T9NA 2EQKA 1K9MU 2EFIA 4JLGA 5LJ3f 1VQMA 3CCET 3ZBDA 3FPTA 1YITT 2EJ9A 4LD6A 2JNGA 3JCMd 1M4ZA 2HQXA 2R58A 3V8JA 2XDDA 3L2VA 3QG1A 5GAN8 3EFRA 1VQ4A 5L8RE 4M77G 3V7CA 4F7UB 5A0DA 5HK3A 1YJ9A 1YJNA 2ZPIB 4F7UA 4XU0A 1VQOA 3QYHB 4M77E 3CMEA 1BKBA 1JJ2S 4KO8A 3QPHA 1IREB 2K5LA 4A4FA 4KUIA 2IVWA 1I81A 3JRZA 4IURA 4VUBA 1N27A 3RMSA 2LCCA 4A53A 4ZN3A 4JJNK 4C8QB 5GAN2 4Y91A 2DXTA 4BI4A 4QVCA 3CXCA 4E7IA 4PJOB 2OTJT 2LQKA 1O9SA 3L1AA 3QO3A 4A4KA 4C8QA 5GMKm 4Y28E 2M1HA 3CC4A 3M9QA 2PU9B 3UT1A 4PJOA 2QEXA 2YLCA 3QDRB 2DD5A 2P4TA 3LGLA 2QDYB 1VQLT 1I4K1 2DD4A 4BY6B 5LJ3g 3HFNA 4M75C 4JRPA 2DVEA 4RG8A 5FLXE 5CQXA 3JCMJ 5C0MA 3JCMP 3HU3A 4HCZA 1K73C 4BD3A 1SSFA 1ZHIA 1K73U 3MB5A 2BIVA 5GAN4 2FB7A 4J5YA 3META 2ZPHB 2M0OA 2V8KA 5CR2A 5LJ3d 4QQ6A 4B9XA 4EMKC 3OYAA 4M7DF 5M9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNW C;  1XNI A;  4A4G A;  3OS0 A;  2O4X A;  4OVA A;  4C5G A;  3OYB A;  2PQW A;  1WJR A;  3ASK A;  1OZ3 A;  3MEA A;  2R57 A;  2JTF A;  5D6X A;  1WJQ A;  3OYC A;  2RJE A;  4FL6 A;  3FC3 A;  3OYH A;  2GFU A;  5KE2 A;  3OS1 A;  3OYN A;  2XK0 A;  3LYI A;  3OY9 A;  4ZTJ A;  4Q5W A;  3DB3 A;  3OB9 A;  2M16 A;  2CKK A;  2MWO A;  4BE2 A;  3LH0 A;  3OYJ A;  3OQ5 A;  2L3R A;  1MHN A;  4N4G A;  5KCH A;  2RJF A;  4II1 A;  2XDP A;  5J39 A;  4IUQ A;  1H3Z A;  2RI5 A;  4B9W A;  2RJC A;  5KE3 A;  4E7K A;  3E9G A;  2HQE A;  2BKD N;  4Z02 A;  2MWP A;  4IKF A;  5FRN A;  3L2W A;  4QQD A;  3CEY A;  2QQS A;  3QBY A;  2LRQ A;  2P0K A;  1OI1 A;  3DLM A;  2FHD A;  2GF7 A;  1WJS A;  2K3Y A;  3MP6 A;  4QW2 A;  5KH6 A;  3GOX A;  3S3M A;  2RI3 A;  2RHY A;  3LX7 A;  3OS2 A;  2EQU A;  2DIG A;  2IG0 A;  2LVM A;  3MP1 A;  3EAE A;  2L89 A;  3NTI A;  4N4I A;  5J26 A;  3OYM A;  4BDY A;  3PMT A;  3OYK A;  3PFS A;  5M9O A;  4ZTF A;  4IUT A;  2VYT A;  3MEW A;  3DB4 A;  4UC4 A;  4L59 A;  2G3R A;  5C6S A;  3OYD A;  2E6N A;  3L2Q A;  3S3O A;  3OYG A;  4GY5 A;  3F70 A;  2E5Q A;  4IUP A;  4C5I A;  4BDZ A;  3KUF A;  3QJ6 A;  4IUV A;  5FRM A;  4N4H A;  1WGS A;  2RHX A;  2NLU A;  3E9F A;  5D6W A;  2DIQ A;  3S3N A;  3QII A;  5IAY A;  3UWN A;  3MP8 A;  3OMC A;  3LLR A;  2RI2 A;  4CRI A;  3MO8 A;  2GFA A;  3OYE A;  2R5M A;  2RJD A;  3ME9 A;  4X34 A;  3OA6 A;  4NS5 A;  2LTO A;  2EQK A;  2EFI A;  3FLG A;  3H6Z A;  3S6W A;  2X4Y A;  4E7J A;  3L2R A;  4LD6 A;  4PL6 A;  3MEV A;  2B8A A;  4A4H A;  2HQX A;  2R58 A;  4PLL A;  3L2V A;  1OYX A;  4IUU A;  3QKJ A;  3O8V A;  3P8D A;  4BE0 A;  4A4E A;  2D9T A;  2X4W A;  4QVZ A;  2RHZ A;  4FU6 A;  4RG2 A;  2O4X B;  2X4X A;  1KHC A;  3P8H A;  4C5H A;  4BE1 A;  4E7H A;  5IN1 A;  4A4F A;  3C4S A;  3OYL A;  2DAQ A;  3SD4 A;  4IUR A;  1N27 A;  2RO0 A;  2LCC A;  4E7I A;  2QQR A;  3LGF A;  2YRV A;  2M1H A;  2LDM A;  3M9Q A;  2EQJ A;  3NTK A;  3Q1J A;  3UT1 A;  2EKO A;  5D6Y A;  3PMI A;  4EDU A;  5KCO A;  1G5V A;  5FRO A;  3OMG A;  2F5K A;  3OYF A;  3LGL A;  3H8Z A;  2WAC A;  3MEU A;  2BUD A;  3FEO A;  3BDL A;  4E7L A;  1RI0 A;  2RHU A;  5CIU A;  2R5A A;  3L42 A;  2EQM A;  1OZ2 A;  3ZEH A;  3NTH A;  5C0M A;  3OYI A;  4HCZ A;  4BD3 A;  1SSF A;  4C5E A;  2K3X A;  2BIV A;  2L8D A;  4PLI A;  3MET A;  4QQG A;  2M0O A;  2X35 A;  4BAC A;  4QQ6 A;  4B9X A;  3L2U A;  3OYA A;  2RHI A;  2JZ2 A;  3FDR A; 
#chains in the Genus database with same CATH topology
 3PNW C;  4BB7 A;  4M78 C;  2QI2 A;  4OVA A;  1QCF A;  2AIR B;  4N0A C;  1OZ3 A;  2J6O A;  2R57 A;  3MEA A;  3OYC A;  3SWN A;  2DIL A;  1K76 A;  3H9N A;  2CT3 A;  4PJL A;  4ZTJ A;  1Y57 A;  3KXT A;  1IRX A;  3HL8 A;  4KH1 B;  4HA8 A;  2LJ0 A;  2K4Y A;  4JLI A;  1MHN A;  5KCH A;  1VQM T;  3VS1 A;  4E7K A;  1WFW A;  3RKW A;  4HVV A;  5CD1 A;  1Q82 U;  3FPU A;  1VQ7 T;  2KMT A;  2QQS A;  2O9V A;  1E7O A;  5LJ3 j;  1KK7 A;  4K11 A;  1VQ9 T;  3OS2 A;  2EQU A;  1QMC A;  4R55 A;  3ZGZ A;  2WSC E;  1TUG B;  1QW1 A;  4IUT A;  1KG1 A;  2RK1 A;  3BY7 A;  4PJO C;  2OAU A;  2OTJ A;  5A0G A;  5FRM A;  2RB6 A;  3U23 A;  2E3H A;  1W4S A;  1UE9 A;  3OYE A;  1VQL A;  3CF2 A;  3REB B;  1U8R A;  4JRI A;  3ME9 A;  4X34 A;  3LH5 A;  3RDV A;  3EG1 A;  3EFO B;  4M7A B;  2HAX A;  1VQP Q;  2B25 A;  1K9M R;  3A8G B;  4KUD K;  4PKC C;  3MEV A;  2XIC A;  2LCS A;  4CC2 A;  1YIT A;  4PFP A;  3OYY A;  2D8J A;  2RNA A;  1E6H A;  4QVZ A;  2JN0 A;  5GLF A;  2DO3 A;  1X43 A;  1TTH B;  2YWW A;  4IIO A;  2VKN A;  1YHQ Q;  1IO6 A;  3LGF A;  2LW6 A;  4KLN A;  5CCX A;  2K3B A;  1G8X A;  2EPD A;  3E19 A;  3MPU B;  3JAM E;  1UTI A;  4CC7 A;  4DQ2 A;  5LJ5 h;  1GFC A;  2JMC A;  2K3X A;  2VWF A;  3EGD A;  2A7Y A;  1XNI A;  4X9C A;  4A4G A;  1ZSZ B;  1M3C A;  4RKU E;  4ZNX A;  1G3S A;  5I21 A;  1QVG P;  3CC2 Q;  1P92 A;  3ZJU A;  2ZPG B;  1IZ6 A;  1JXO A;  2C0I A;  1M5Q 1;  3GNF B;  2RI5 A;  4KBM B;  3I56 A;  1FXX A;  1PNJ A;  2HQH A;  4JZ3 A;  2YT6 A;  1U1S A;  3EGU A;  1K8A C;  3CBP A;  3HU2 A;  1M2O A;  3BFM A;  2E5K A;  2LRQ A;  1Q82 R;  3VS0 A;  2NWM A;  1K0X A;  2OTL A;  2LMJ A;  5GAO q;  2QA4 T;  1C6V X;  2MIO A;  2LVM A;  3MP1 A;  2FRW A;  2KAF A;  5DY9 A;  3VS5 A;  4J6Y A;  1GCQ A;  3M56 A;  2CZ0 B;  2KR3 A;  2DMO A;  3JCM h;  5KYX B;  1S72 Q;  1H8K A;  4GLK A;  1VYU A;  2JVV A;  2DZC A;  3KBG A;  3S3N A;  3INZ A;  3A8L B;  4M77 C;  3I35 A;  4CRI A;  3MO8 A;  1YBY A;  3CPF A;  3QWX X;  3RR6 A;  4J9I A;  2AZV A;  1U06 A;  3FLG A;  3RIR A;  4MDX A;  4E7J A;  3N5B B;  3H41 A;  1B34 B;  1VUB A;  2KE9 A;  2XG8 D;  4PJO D;  3O8V A;  2XDB A;  1QDN A;  5ECA A;  2D8H A;  4E7H A;  1OUL A;  1KHC A;  1VYT A;  3GLX A;  3ZFJ A;  1QCO A;  2HEQ A;  3MCA B;  2NYS A;  1AD5 A;  3PMI A;  1YI2 Q;  1BIA A;  1G5V A;  2COZ A;  1Y7X A;  1VQN A;  5GMK e;  4LUE A;  2KNB B;  3CCM A;  4E7Z A;  1PCX A;  1GBQ A;  1RAB B;  2EKH A;  4RTU A;  1JB0 E;  2X35 A;  1GXI E;  4MZP A;  1M30 A;  3OS0 A;  2EYW A;  2YHT A;  4KGV B;  1JO8 A;  3G6E A;  3SEM A;  2AKK A;  3JB9 I;  4FYW B;  3PTA A;  4XQ3 A;  2Y4Y A;  4AT1 B;  3ZJV A;  3TCJ A;  1VQ4 Q;  3HRS A;  3G4S Q;  1D1C A;  2YUJ A;  4AFQ C;  2JS2 A;  4ELY C;  1VQO Q;  3OBW A;  1SKU B;  3LH0 A;  2L3R A;  2RJF A;  2EJF A;  2COY A;  2JJ9 A;  2HQE A;  4M78 E;  1AZE A;  3EG3 A;  1OQK A;  3CC4 Q;  5FRN A;  1QP3 A;  3CD6 A;  2MM0 A;  3FB9 A;  2CYZ B;  2GNC A;  1ZBX A;  1ZSZ A;  1WHK A;  3TSW A;  5I2S A;  2C06 A;  1UHC A;  1QQJ A;  4C0D B;  1X75 C;  3DB4 A;  3BW1 A;  2A3L A;  2QXF A;  1AWO A;  2FPF A;  2DIQ A;  5CAI A;  5IAY A;  1M2V A;  2ROL A;  3OMC A;  3LLR A;  1WXU A;  2MK5 A;  1TOV A;  2BZX A;  3OA6 A;  2GTO A;  4PJO E;  1TSF A;  3HSB A;  5FW9 A;  1IXD A;  2X4Y A;  1MMD A;  2AT1 B;  4O6J A;  1Q86 U;  2M0Y A;  1MUZ A;  2E65 A;  2JT4 A;  1VQ5 A;  2BZY A;  1WLP B;  4FU6 A;  5CKE A;  5KYX A;  2QQB A;  3P8H A;  3OSS C;  4M7D C;  3OYL A;  2EIF A;  2PZ1 A;  3CMA A;  4OGE A;  1VQ6 A;  1VIF A;  3FJP A;  5KCO A;  1KC8 U;  3OMG A;  4AQ7 A;  3OYF A;  2BUD A;  2EW3 A;  5LJ3 e;  4E7L A;  1RI0 A;  4HXJ A;  5IHK A;  1NEG A;  1B34 A;  4C5E A;  1YHQ T;  1OU8 A;  2OJ2 A;  3EHR A;  2I2L A;  4NL2 A;  2PUO B;  3RNJ A;  3OYB A;  1U1T A;  4JDS A;  3R6N A;  3EG0 A;  1IB8 A;  1VQK A;  2PWY A;  3OB9 A;  3VV0 A;  2QEX T;  4X1V A;  2EGA A;  5IXB A;  2MWP A;  4CI0 C;  4DBF A;  1GCP A;  3M0T A;  5GAN h;  1TU0 B;  1HSQ A;  1AHJ B;  2E4H A;  1WLF A;  4FT2 A;  1KSW A;  2L89 A;  1VQ7 Q;  4LDW A;  3CC7 T;  3E2U A;  5C6S A;  2E6Z A;  2ED1 A;  1VQ9 Q;  1OX9 A;  3FPR A;  3O5Z A;  3G71 Q;  1C0M A;  1N8R U;  3GPL A;  2WSE E;  4C92 F;  3RKX A;  1M1G A;  2JW4 A;  2X3W D;  2DVJ A;  4ORZ A;  2CZ7 B;  5GJV B;  1TUD A;  4OMQ A;  4FW1 A;  3CCR A;  2EQK A;  4ESR A;  1LPL A;  5LJ3 f;  2P4R A;  3FPT A;  1M4Z A;  1AOJ A;  1Q86 R;  3MJX A;  5L8R E;  3V7C A;  5A0D A;  5HK3 A;  4XU0 A;  4M77 E;  1SEM A;  2K5L A;  1I81 A;  4A53 A;  3RMS A;  4C8Q B;  4E7I A;  2OTJ T;  2HSP A;  2LQK A;  3QO3 A;  5GMK m;  4Y28 E;  4PJO A;  2YLC A;  1KC8 R;  1VQL T;  2DD4 A;  4JRP A;  3HU3 A;  4HCZ A;  7AT1 B;  2J6K A;  1K73 U;  5D7U A;  2BIV A;  5GAN 4;  4J5Y A;  5IHN A;  2V8K A;  1YIT T;  2FVU A;  4M7D D;  2Z0W A;  3ASK A;  1WJR A;  2DEU A;  2DTO A;  3JSC A;  1OPK A;  4LDY A;  2YVL A;  2AHJ B;  3CCS A;  1WA7 A;  3PVQ A;  3JCM Q;  3J80 E;  1MMG A;  1ZLM A;  3DKM A;  1V76 A;  2LX7 A;  3FRN A;  2KXC A;  1NJI C;  3VRZ A;  1VQO T;  1CZ5 A;  1SHF A;  3H0H A;  3I5R A;  1UB4 A;  1XTD A;  3VUB A;  4JRK A;  2IIM A;  1T0H A;  5FWB A;  3C0C A;  1RAF B;  2C0O A;  4MMK A;  2QA4 Q;  1PRL C;  3VS2 A;  1LJO A;  4F17 A;  2H3J A;  1N8R R;  3QII A;  4GLM A;  3RER A;  3A8M B;  3UWN A;  3TVT A;  3I56 T;  5GAN 6;  5DLQ E;  2HKN A;  2CP2 A;  1OU9 A;  4MZT A;  3EH1 A;  2OTL T;  1Q95 G;  1ZA1 B;  4J9C A;  3CCQ A;  2FZC B;  4C5H A;  2KQW A;  2BZ8 A;  2DAQ A;  3V7S A;  1HJD A;  4CQN A;  4KGZ B;  4RV0 A;  3QHS A;  2DER A;  5LJ5 e;  3R6O A;  2LDM A;  1PSF A;  1CR5 A;  2H8H A;  1I0C A;  2EKO A;  1B07 A;  1ABO A;  5CKD A;  1M1F A;  3QC8 A;  1VQP A;  1WHL A;  2XD0 A;  1BK2 A;  3EGD B;  2CS7 A;  4M7D E;  3NGP A;  1K73 R;  2KSS A;  4RTY A;  5DLO A;  2CKK A;  1OEB A;  1FMK A;  2DL3 A;  5D6X A;  1S3S A;  3WVD B;  3OYN A;  2DLP A;  1QCN A;  1LNX A;  2KK4 A;  3A1P A;  4XK8 E;  2LT1 A;  2DX1 A;  3CBM A;  2M51 A;  2HNI A;  1VQN T;  3M53 A;  3P8B B;  3HPW A;  4LUD A;  3HKS A;  1K8A U;  2DM1 A;  4QQD A;  2Q1D X;  3JCM e;  3CCM T;  2P0K A;  2EGC A;  1WX6 A;  3MP6 A;  2K9G A;  4AS1 A;  2KRO A;  2P0Q A;  4BDY A;  3PMT A;  2DE0 X;  4XTY A;  3G6E T;  5FU7 C;  3L2Q A;  1SSH A;  1BBZ A;  2EGE A;  2JTE A;  4NOY A;  3TQ7 P;  2DA9 A;  4J9E A;  3BDU A;  5D6W A;  4FW2 A;  8AT1 B;  4FSX A;  4F7U F;  1K0S A;  4HCB A;  3EG9 A;  3OW2 S;  3PE0 A;  4FT4 A;  4D8D A;  3CCU A;  3CD6 T;  3M0S A;  3G71 T;  4XU2 A;  1AWJ A;  2RH2 A;  5DM7 R;  1M8M A;  2CT4 A;  3G7Z A;  4IUU A;  3QKJ A;  4DOV A;  4E7S A;  3P8D A;  5AYF A;  1FX7 A;  1NLP C;  1TG0 A;  2W0Z A;  3C4S A;  5CKH A;  1T3S A;  2QQR A;  4O5V A;  5CCA A;  2YRV A;  3CXC S;  1WQW A;  4XU1 A;  1W70 A;  1UGP B;  2EQJ A;  1PD1 A;  2DXU A;  3NFC A;  1M90 C;  5ERG B;  2JUF A;  1TWB A;  1RAE B;  2I0N A;  2HZY A;  2XHC A;  4PFZ A;  2EWN A;  2V1Q A;  5HKC A;  4RTZ A;  1UJ0 A;  3JB9 F;  4PLI A;  4OGC A;  2P84 A;  2E70 A;  3WXM B;  2K6D A;  3CBO A;  3L2Z A;  4FYY B;  2EYQ A;  5I2M A;  1D1B A;  4PJN A;  1QP2 A;  1F1B B;  2JTF A;  1VQ5 T;  4ZN1 A;  1FMW A;  3OS1 A;  1W2B S;  4DBR A;  5CVI A;  3CMA T;  2E12 A;  2X3X D;  1VQ6 T;  2MWO A;  4N4G A;  4M7D A;  4M78 G;  2Y4X A;  4C92 C;  5KE3 A;  2JS0 A;  3QWZ A;  2QDL A;  2HD0 A;  3CEY A;  2QEX Q;  1K8A R;  4HCC A;  2CH4 A;  2GF7 A;  4EIK A;  3OW2 A;  3HTR A;  2QTX A;  2MM2 A;  5J3B A;  2RA2 A;  3I9Q A;  1SF9 A;  2MF2 A;  1R77 A;  2RD1 A;  4M7A F;  4DBH A;  3G4S A;  4PJJ A;  4JRQ A;  5HY6 A;  2CUD A;  3M5A A;  2QQ9 A;  1VQK T;  4J6X A;  2LQN A;  2CGH A;  4LDX A;  3CC7 Q;  3CCL A;  1M2V B;  3GF5 A;  2HBW A;  1RAH B;  1NLO C;  1XJW B;  1YIJ A;  3TU4 K;  4PJO G;  2RQR A;  4M78 D;  3LWH A;  1W6X A;  4ANJ A;  1X6G A;  2JOY A;  1JU5 C;  1I1J A;  3SFM A;  2K2M A;  3E1S A;  4XTW A;  2B8A A;  3M4Y A;  3CPW S;  4PLL A;  2Y90 A;  5GMK l;  1CZ4 A;  5FU6 B;  4A4E A;  3A5Z B;  2CSI A;  2F69 A;  4QKU A;  1KD1 C;  1PD0 A;  3M59 A;  1BI1 A;  4A63 B;  4JPB W;  2C0T A;  1W1F A;  1W2B A;  1G3W A;  1NEB A;  2YRD A;  1KQ1 A;  2ZAE A;  4EDU A;  1KJW A;  1QWE A;  2OTJ Q;  1RLP C;  1Q7Y C;  3BQB A;  5CIU A;  1KHI A;  2R5A A;  4OMF B;  3CCR T;  2RK2 A;  2DF6 A;  1HYO A;  1KIK A;  4KDI A;  2DRM A;  4ZGD B;  1VQL Q;  2K5F A;  1NPR A;  4R0K A;  1C1A A;  2DL4 A;  3FIF A;  2VUB A;  3A8H B;  2H3E B;  5DYI A;  5HCK A;  3VUZ A;  2LJ1 A;  4BI3 A;  5LJ5 g;  3VRY A;  2DJZ A;  1YIT Q;  1RAC B;  2YRC A;  4OML A;  4C92 G;  1N6A A;  1X2K A;  1D09 B;  2DTI A;  5LJ5 d;  2E3I A;  5KYU A;  1X6O A;  1GFD A;  2FPE A;  2WSF E;  4WTO B;  3AHU A;  2RJC A;  3OBY A;  2FZG B;  3L2W A;  1AWX A;  5KH6 A;  2O2O A;  2ENM A;  3SHW A;  2ESW A;  2CUB A;  3LX7 A;  2J06 A;  1LVK A;  1MV0 B;  5IH2 A;  4XTV A;  3CPW A;  4ZTF A;  2COW A;  4EMH A;  2YUP A;  2EJG A;  1G3T A;  4JS4 A;  3M0P A;  1NBE B;  4M78 B;  2E5Q A;  4IUP A;  4BDZ A;  1QVP A;  2XI9 A;  4OMP A;  4CC3 A;  2CH4 W;  2A36 A;  4C92 D;  3CCS T;  3M55 A;  5LJ5 j;  2K2V A;  3JCM g;  1VIE A;  1YWO A;  2R5M A;  2QGF B;  1YFN A;  2LTO A;  2FG0 A;  3T9N A;  2EFI A;  4JLG A;  1VQM A;  3ZBD A;  2HL3 A;  2JNG A;  3JCM d;  3I56 Q;  2XDD A;  3QG1 A;  4M77 G;  1EZZ B;  1YJ9 A;  2HKQ B;  3CME A;  1JJ2 S;  1BKB A;  3QPH A;  1IRE B;  4A4F A;  3UA6 A;  2OTL Q;  4IIM A;  4KUI A;  4ZN3 A;  1N27 A;  2LCC A;  1OOT A;  5GAN 2;  4Y91 A;  2DXT A;  3EGX A;  4PJO B;  5B6C A;  3L1A A;  3M9Q A;  1IHW A;  2DYI A;  2QDY B;  3HFN A;  2DVE A;  4FCY A;  1EFN A;  3H0F A;  1ZHI A;  3H0I A;  3MET A;  2ZPH B;  2M0O A;  4EMK C;  4KRT A;  3HHT B;  4AFU C;  4JJC A;  3CCQ T;  1ZX6 A;  4RMO A;  4M77 D;  2JTM A;  2CZ6 B;  2KI7 A;  4JJD A;  2KT8 A;  1LCK A;  5CO7 A;  2PNI A;  2DET A;  2A37 A;  3QDF A;  3SDZ A;  1RUW A;  4WF2 A;  2DFU A;  1RAA B;  3CCE A;  4E2F B;  4KGX B;  3VS4 A;  2O31 A;  3VYG A;  1NJI U;  2QAS A;  3DLM A;  2QGG A;  1U3O A;  5CCB A;  1YJN T;  1OV3 A;  3S3M A;  1VQN Q;  1NG2 A;  1NE8 A;  3NTI A;  3OYM A;  3CCM Q;  3OYK A;  1BB9 A;  5LL6 S;  2RPN A;  2V8J A;  4C92 E;  4GY5 A;  2BE7 D;  3QUI A;  2AKL A;  4BY6 C;  5L23 A;  3OW2 P;  3G6E Q;  1G3Y A;  2LT4 A;  2O88 A;  1E6G A;  2NUP B;  2NUT A;  4AFZ C;  1BCO A;  1SG5 A;  4Z89 A;  2ZPE B;  2QTV A;  2LX9 A;  3G1J A;  3S6W A;  2PUK B;  4AG2 C;  4OMM A;  3L2R A;  5EG2 A;  1UJY A;  2K5I A;  1R0C B;  4HKE A;  1GCQ C;  1YN8 A;  4OB3 B;  2X4W A;  3CD6 Q;  2DEQ A;  3CXC P;  2RHZ A;  4M78 A;  4XAX B;  3I55 A;  2O4X B;  2RQT A;  2GQV A;  5FWC A;  4N0A A;  4OB0 B;  1Y0M A;  5GMK i;  2F5T X;  5GMK h;  2XID A;  5EQJ B;  4RCB A;  2O01 E;  4M75 E;  4OF1 A;  1Y71 A;  2KYB A;  2A28 A;  2F5K A;  4HVU A;  1MV3 A;  1RLQ C;  2MCN A;  3UF4 A;  1WNL A;  4XTX A;  4M7D G;  4M77 B;  2KVQ G;  3CCU T;  4OB1 B;  2D1X A;  1M3B A;  1D1A A;  5GAM h;  1W2B P;  2JZ2 A;  5KYY A;  1VQ8 A;  3RBB B;  1WI7 A;  3X26 B;  2MMP A;  3KFV A;  3HU1 A;  1JBM A;  5DYG A;  2DXC A;  2RN8 A;  3DB3 A;  2DBK A;  1VQ5 Q;  4M75 F;  4PJM A;  4M7A C;  2KXD A;  2M02 A;  2VXE A;  4F7U G;  2LCL A;  2CP7 A;  1H3Z A;  4ZGJ B;  5IT9 E;  3OSV A;  2F1L A;  4NL3 A;  3E9G A;  3CMA Q;  5I11 A;  1VQ6 Q;  4AG1 C;  4XU3 A;  1CKA A;  4IKF A;  3UAT A;  1YJW A;  1OI1 A;  1NJI R;  4DEX A;  1PM3 A;  1ZA2 B;  4ATO A;  2OX7 A;  2L3P A;  3CCJ A;  3CCV A;  1Y96 B;  5GAN g;  2DRK A;  2FEI A;  1BIB A;  4YTL A;  5CKB A;  1XOV A;  3M57 A;  2Q1C X;  2IPO B;  5GAN d;  3NPF A;  2DZ9 A;  4J6W A;  4J83 A;  4DBQ A;  3EG9 B;  4M4Z A;  1VQK Q;  2EAY A;  3CPW P;  1FMV A;  1O54 A;  2YUO A;  4BUG A;  4J9H A;  2LNH B;  3MHX A;  1ZSZ C;  1Z9Q A;  3IQL A;  4PL6 A;  4C8Q F;  4C92 A;  1R7R A;  4F14 A;  1RI9 A;  2PTK A;  2KRN A;  3C94 A;  2X4X A;  3M0R A;  4D6W A;  5LJ3 h;  4ARI A;  1LOJ A;  2CP0 A;  1V1C A;  3D7S B;  3JCM V;  2NUP A;  1O75 A;  3VS6 A;  4EPC A;  4J7I A;  3CCL T;  5GAN j;  5GAN 7;  5KYW A;  1Q81 U;  1H3H A;  1M90 U;  3H8Z A;  1VYV A;  4B6M A;  1YIJ T;  4EMG A;  3FEO A;  3JCM X;  2PVD B;  4LDU A;  1M3A A;  5GAM d;  1NZ9 A;  4QQG A;  3JB9 D;  3QZ9 B;  1MMA A;  3PGG A;  1K9A A;  2RM4 A;  2VVK A;  4TVR A;  3CCR Q;  1D3B B;  2O4X A;  2K79 A;  1NYF A;  3VYH B;  4ME7 A;  1RL2 A;  2PQW A;  1QKW A;  4D8K A;  1ZUY A;  1WQ7 A;  1ZUK A;  4L6V 5;  4PK4 A;  3OYH A;  4M7A G;  1UGS B;  1BI3 A;  2A0F B;  1CKB A;  2MAM A;  3LHD A;  5I22 A;  1IGQ A;  1ZSG A;  2M16 A;  5FTL A;  1T3L A;  4M7D B;  3OYJ A;  2EYZ A;  5J39 A;  2MI6 A;  3VJP A;  4M77 A;  1MND A;  1JEG A;  5GAM j;  3JB9 J;  1QVF S;  4QW2 A;  4V2S A;  1J3T A;  3QZ5 B;  2DIG A;  1YHQ A;  1X27 A;  3PFS A;  1MMN A;  1WIE A;  2KYM A;  3JCM c;  2E6N A;  3THK A;  2QQA A;  4M7A D;  3QJ6 A;  4IUV A;  2RHX A;  3JV3 A;  4AFS C;  4F7U E;  4Z8A A;  1YNZ A;  5C18 A;  2LJ3 A;  2J6F A;  4NS5 A;  3CCS Q;  4C0Z A;  1R8O B;  2F2X A;  3CQT A;  4GBQ A;  1S1N A;  2BTT A;  1JJ2 P;  4DA4 A;  2F2V A;  1X01 A;  3CC2 A;  1YCY A;  1JRI A;  1I5O B;  5GAO p;  1Y96 A;  1UGV A;  2HMA A;  5FTK A;  1I9G A;  1ZBJ A;  4FYX B;  3A8O B;  1KD1 U;  3EFS A;  1JQQ A;  1H64 1;  2OAW A;  1VOM A;  5LJ5 f;  3TRE A;  3CC7 A;  1PKT A;  3ULR B;  4XTZ A;  3NTK A;  5EC7 A;  3J7A F;  1M1K C;  1AZG B;  1Q81 R;  1M90 R;  3BDL A;  1Q7Y U;  2EQM A;  2DTH A;  3QSU A;  2JXB A;  4C0D C;  2L8D A;  1IHV A;  4RUG A;  4BAC A;  4Z88 A;  3FDR A;  3HRU A;  1S72 A;  1QVF A;  4KOD A;  1YJ9 T;  2X4J A;  2ZCF B;  4C5G A;  1G2B A;  1WJQ A;  3CME T;  2X51 A;  4JUV A;  2XK0 A;  2KDS A;  3M0Q A;  3JCM b;  4R56 A;  1PKS A;  1Q81 C;  4A54 A;  3CCQ Q;  3J81 E;  5KYU B;  4F16 A;  2XDP A;  1NPP A;  4KDL A;  1BYM A;  3JCM f;  2Q19 X;  1RAG B;  3V7R A;  2YUN A;  2YXY A;  2K3Y A;  2LQW A;  1D3B A;  1QLY A;  5GAO m;  5CQY A;  1DJ7 B;  4M7A E;  2YDL A;  3MEW A;  1X69 A;  4CC4 B;  1YJN Q;  3OYD A;  2LNV A;  1YI2 A;  3QQ7 A;  4EMK A;  3QJY A;  4OMN A;  3KUF A;  4KUL A;  1WGS A;  2ECZ A;  3MKD A;  2LZ6 B;  1NM7 A;  6AT1 B;  1GBR A;  2RI2 A;  1TUC A;  2RJD A;  3FJ5 A;  3OS5 A;  1K9M C;  2DKG A;  1WHG A;  3CCE T;  1I07 A;  4HCK A;  2ABL A;  4LD6 A;  1NYG A;  2R58 A;  1T0J A;  5GAN 8;  1VQ4 A;  4LE9 A;  2JM9 A;  4F7U A;  1VQO A;  4KO8 A;  1QWF A;  3I5S A;  4OMO A;  4HVW A;  1KD1 R;  4IUR A;  3EGX B;  1GRI A;  2XMF A;  3CXC A;  2W10 A;  1O9S A;  4A4K A;  2MPX C;  3CC4 A;  4QT7 A;  2DD5 A;  2P4T A;  2DNU A;  4M75 C;  4RG8 A;  3JCM J;  1Q7Y R;  1WHM A;  4BD3 A;  2FB7 A;  5CR2 A;  4QQ6 A;  4B9X A;  2L2P A;  5M9O A;  1VA7 A;  1TS9 A;  3X20 B;  3CCU Q;  2EYX A;  4BI8 B;  1HD3 A;  2RJE A;  3A98 A;  3I55 T;  4JS5 A;  1AWW A;  1PG5 B;  4X9D A;  2AK5 A;  4Q5W A;  4E6R A;  5GAN 3;  2ROT A;  1ZQ1 A;  3C95 A;  1H92 A;  3PIP A;  3EHQ A;  2PVG B;  2CSQ A;  4AMC A;  1Q82 C;  5KYN A;  2V8I A;  3X24 B;  4L5G A;  3GOX A;  1M27 C;  3ZJT A;  2YSQ A;  1PWT A;  2RHY A;  2QAZ A;  1KQS S;  1V29 B;  3EAE A;  2D0Q B;  3V8L A;  2KBT A;  2JV2 A;  4C8Q C;  1VQ8 T;  2VYT A;  1PRM C;  5GAN e;  2KRM A;  1YWP A;  4JJB A;  4FIB A;  2ZPB B;  3ER0 A;  2DPP B;  2YLB A;  2NLU A;  1HXD A;  2L5Q A;  2RQU A;  3LWI A;  2VGN A;  2NUT B;  5GAO n;  5CK9 A;  2DYB A;  1UEB A;  1GL5 A;  4LDV A;  1OX8 A;  2XU8 A;  5CKF A;  5A2Q E;  2KRS A;  3EFO A;  3URG A;  4M7A A;  8ATC B;  3SWN C;  1YJW T;  1TXQ A;  3LW5 E;  3WVE B;  1Y07 A;  3QWY A;  4BE0 A;  3RUX A;  4PNO A;  3CCJ T;  3PIO A;  3GIB A;  3CCV T;  2MOX A;  4BE1 A;  1X2Q A;  5IN1 A;  2YUQ A;  2CZ1 B;  4J8O A;  2RO0 A;  2E1H A;  2QK0 A;  4JZ4 A;  2RQW A;  1PHT A;  4M75 G;  5FU7 B;  2E10 A;  1EX4 A;  4RTT A;  1AEY A;  2P0P A;  5GAM e;  2HDA A;  2JM8 A;  1OZ2 A;  5GAO r;  3CCL Q;  1VQ7 A;  1X6B A;  1ZUU A;  2CDT A;  2ED0 A;  4OP0 A;  1YIJ Q;  1VQ9 A;  3LGA A;  5KYY B;  3G71 A;  3HRT A;  1BI2 A;  4WCI A;  3UPU A;  4HT8 A;  1KQS A;  1D0Z A;  2EVR A;  3LYI A;  2HL5 C;  2L0A A;  5GAN f;  1SPK A;  1M8V A;  1U5S A;  2X9H A;  2L3Q A;  2DK3 A;  3QYG B;  2FYK A;  2QG9 B;  4M75 D;  1RAD B;  4MML A;  4II1 A;  2RMO A;  4IUQ A;  1QVF P;  2KGT A;  4B9W A;  1UFF A;  4Z02 A;  5FTJ A;  2F2W A;  3GNG A;  3RKY A;  4M78 F;  4LXC A;  4MDW A;  3QBY A;  4C8Q G;  2FHD A;  1WJS A;  1R0B G;  2VB6 A;  4J7F A;  2D0N A;  2CP3 A;  1B7T A;  3UDC A;  2DJQ A;  2IG0 A;  1TH7 A;  2G6F X;  4ZGE B;  3VS3 A;  1MNE A;  5IXF A;  4RTW A;  1ABQ A;  1ZC1 A;  2ZPF B;  3E9F A;  1VQP T;  1WXB A;  2GGR A;  2GFA A;  2VGM A;  5HK0 A;  3GBQ A;  5GAM f;  3M0U A;  2EQI A;  3H6Z A;  2O9S A;  4C92 B;  1KQ2 A;  2ATC B;  4PJO F;  4J9G A;  4C8Q D;  3AT1 B;  2KY9 A;  3EH2 A;  3M4G A;  2K57 A;  2D9T A;  1N5Z A;  4J9D A;  3RES A;  1N9S A;  1JJ2 A;  4KH0 B;  4RG2 A;  2V1R A;  4C0F A;  3HP9 A;  1QCS A;  1WHH A;  1Z9Z A;  3HFO A;  4MZM A;  1M9S A;  1A0N B;  4PFO A;  2B86 A;  5KYW B;  1BCM A;  3JB9 H;  3C12 A;  2E64 A;  2WAC A;  3MEU A;  3VS7 A;  4HT9 A;  4ELZ C;  2GQI A;  3ZEH A;  1PC0 A;  3OYI A;  1WZO A;  2Q18 X;  2LC4 A;  3VU3 C;  3BE3 A;  4DEY A;  1D0X A;  2QA4 A;  3CC2 T;  3X25 B;  2VV5 A;  3PVL A;  2ZZD A;  2VXF A;  2FZK B;  1VQM Q;  5EPP A;  1SRL A;  4M75 B;  4J9F A;  4FL6 A;  3FC3 A;  2PJH B;  3RMQ A;  1MGQ A;  3OY9 A;  2K7A A;  1SRM A;  1WPY A;  1ACM B;  4F04 B;  1YJ9 Q;  2DL8 A;  2XKO C;  2DBM A;  1QVG S;  3CME Q;  2PVO B;  2CP5 A;  3OQ5 A;  4RCC A;  1D0Y A;  5GAO l;  2VC8 A;  1QKX A;  1OPL A;  2L3S A;  3X28 B;  3REA B;  3M58 A;  2EBP A;  1I5L A;  4N4I A;  1AT1 B;  1S72 T;  2RF0 A;  1UG1 A;  1FYN A;  1UGR B;  4FSS A;  1I8F A;  4UC4 A;  4L59 A;  3UA7 A;  3OYG A;  1WHJ A;  1N9R A;  2M9U A;  1RAI B;  5A0L A;  3SB2 A;  2EYY A;  3MP8 A;  4QVD A;  1IGU A;  2SEM A;  3M54 A;  2E41 A;  4FM4 B;  1WDX A;  4C8Q E;  1UUE A;  4J9B A;  4C0G A;  4ARC A;  1AVZ C;  2GCX A;  4FYV B;  1Q86 C;  4A4H A;  1BI0 A;  1OYX A;  2ZGW A;  1HK9 A;  2FPD A;  3CCE Q;  2LP5 A;  4XTU A;  2RQV A;  1YI2 T;  3SD4 A;  1EIF A;  4M77 F;  3SWN B;  2DXB A;  4LD9 K;  3TEE A;  3Q1J A;  1E32 A;  2JMA A;  5D6Y A;  1KC8 C;  2LQ8 A;  5FRO A;  3JB9 G;  2FL7 A;  1QVG A;  3TIW A;  1M1K U;  1SHG A;  2RHU A;  1YP5 A;  4DOW A;  3L42 A;  2DL7 A;  1K1Z A;  3NTH A;  3JCM W;  3PT9 A;  3L2U A;  2V26 A;  2AZS A;  3S3O A;  1PSE A;  2RHI A;  4RTX A;  1VQ4 T;  3G4S T;  2CRE A;  3QXE B;  1FWZ A;  1XQH A;  2GFU A;  3V8K A;  5KE2 A;  1B3Q A;  4E47 A;  2NUZ A;  5GAM g;  3VKI A;  5C1B A;  2MYS A;  4BE2 A;  3I55 Q;  3CC4 T;  5GAN 5;  4P5N A;  2GBQ A;  2QYZ A;  3GP8 A;  2BKD N;  1KQS P;  3DLL A;  1CSK A;  5FU6 C;  5FTN A;  2HBP A;  2DL5 A;  2RI3 A;  4M75 A;  5GMK j;  4KT0 E;  5J26 A;  1WYX A;  2HSE B;  9ATC B;  2BE9 B;  2KEA A;  3QQ8 A;  1UGQ B;  2G3R A;  4OB2 B;  4EMK B;  2Q1A X;  2A08 A;  3F70 A;  4C5I A;  1N8R C;  4N4H A;  1VQ8 Q;  1JXM A;  2GTJ A;  5FTM A;  2FRY A;  2VAS A;  5AT1 B;  1K4U S;  1KFZ A;  1K9M U;  2KT1 A;  2J05 A;  1UEC A;  2EJ9 A;  3ZL7 C;  2SRC A;  2HQX A;  3NMZ C;  3V8J A;  2HCK A;  3L2V A;  3EFR A;  4F7U B;  1BU1 A;  1YJN A;  1YCS B;  2ZPI B;  4Y92 A;  1YJW Q;  3QYH B;  1ARK A;  2IVW A;  3JRZ A;  4VUB A;  4JJN K;  4BI4 A;  1G83 A;  4QVC A;  3CCJ Q;  1WXT A;  4C8Q A;  3CCV Q;  2D6F A;  2M1H A;  2PU9 B;  1UHF A;  2FO0 A;  4RTV A;  4LN2 A;  3UT1 A;  2QEX A;  3QDR B;  2CP6 A;  3LGL A;  3EG2 A;  1I4K 1;  4BY6 B;  2OI3 A;  5LJ3 g;  1M1K R;  5FLX E;  5CQX A;  4LNP A;  5IHI A;  3TSZ A;  2J7I A;  5C0M A;  3JCM P;  1K73 C;  1SSF A;  3MB5 A;  3NHN A;  5LJ3 d;  5GJW B;  3OYA A;  4M7D F;  1UDL A; 
#chains in the Genus database with same CATH homology
 3PNW C;  4BB7 A;  4M78 C;  2QI2 A;  2FVU A;  3HHT B;  4OVA A;  3X20 B;  4M7D D;  4N0A C;  3ASK A;  1WJR A;  3CCQ T;  1OZ3 A;  3MEA A;  2R57 A;  4BI8 B;  4RMO A;  3SWN A;  3OYC A;  2RJE A;  4M77 D;  2DTO A;  3I55 T;  4JS5 A;  2JTM A;  3JSC A;  2CZ6 B;  4LDY A;  4X9D A;  4ZTJ A;  4Q5W A;  3KXT A;  2YVL A;  2AHJ B;  3HL8 A;  3BQB A;  5GAN 3;  3CCS A;  4HA8 A;  2K4Y A;  4JLI A;  1MHN A;  5CO7 A;  5KCH A;  3JCM Q;  1ZQ1 A;  3C95 A;  3J80 E;  1VQM T;  3SDZ A;  4E7K A;  3PIP A;  3DKM A;  2PVG B;  4WF2 A;  3CCE A;  3RKW A;  1Q82 C;  5CD1 A;  1Q82 U;  3FRN A;  1VQ7 T;  3FPU A;  2V8I A;  2KMT A;  2QQS A;  3VYG A;  4L5G A;  3X24 B;  3DLM A;  3GOX A;  1NJI U;  1NJI C;  5CCB A;  3ZJT A;  1YJN T;  3S3M A;  1VQO T;  5LJ3 j;  1CZ5 A;  2RHY A;  1VQ9 T;  3OS2 A;  1KQS S;  2EQU A;  1UB4 A;  1XTD A;  1V29 B;  3VUB A;  3EAE A;  1NE8 A;  3NTI A;  4JRK A;  2D0Q B;  4R55 A;  2WSC E;  3V8L A;  3OYM A;  3OYK A;  2JV2 A;  3ZGZ A;  4C8Q C;  1QW1 A;  4IUT A;  5LL6 S;  1VQ8 T;  2RK1 A;  2VYT A;  3BY7 A;  4PJO C;  1KG1 A;  5GAN e;  2OAU A;  2V8J A;  4MMK A;  4C92 E;  4GY5 A;  3QUI A;  4FIB A;  2OTJ A;  5A0G A;  1LJO A;  5FRM A;  2ZPB B;  3ER0 A;  2DPP B;  4BY6 C;  2H3J A;  2YLB A;  2NLU A;  2RB6 A;  1HXD A;  1G3Y A;  2LT4 A;  2L5Q A;  3QII A;  3LWI A;  2VGN A;  3A8M B;  3UWN A;  1W4S A;  3RER A;  5GAO n;  5CK9 A;  1UEB A;  3OYE A;  1VQL A;  3CF2 A;  4LDV A;  1U8R A;  4JRI A;  3ME9 A;  5GAN 6;  4X34 A;  3I56 T;  4M7A B;  2HAX A;  5DLQ E;  2XU8 A;  5CKF A;  2B25 A;  5A2Q E;  4M7A A;  3URG A;  2ZPE B;  3S6W A;  2LX9 A;  3A8G B;  2PUK B;  4MZT A;  3SWN C;  1YJW T;  3L2R A;  4KUD K;  4PKC C;  5EG2 A;  3MEV A;  2XIC A;  3LW5 E;  3WVE B;  2K5I A;  1Y07 A;  2OTL T;  1YIT A;  3OYY A;  4HKE A;  4BE0 A;  4OB3 B;  2X4W A;  3RUX A;  4PNO A;  3CCQ A;  2DEQ A;  3CCJ T;  4QVZ A;  2RHZ A;  4M78 A;  4XAX B;  3PIO A;  3CCV T;  4C5H A;  2O4X B;  2JN0 A;  3I55 A;  2GQV A;  2KQW A;  4BE1 A;  4N0A A;  5IN1 A;  2DO3 A;  5GLF A;  4OB0 B;  2DAQ A;  3V7S A;  2CZ1 B;  4J8O A;  5GMK i;  2F5T X;  5GMK h;  4CQN A;  2RO0 A;  2E1H A;  2XID A;  4RV0 A;  5EQJ B;  3QHS A;  4M75 G;  3LGF A;  5LJ5 e;  4RCB A;  5FU7 B;  2O01 E;  3R6O A;  2E10 A;  1PSF A;  2LDM A;  1CR5 A;  4M75 E;  2LW6 A;  2EKO A;  4OF1 A;  4KLN A;  1Y71 A;  2P0P A;  5GAM e;  5CCX A;  2F5K A;  5CKD A;  1M1F A;  3QC8 A;  1VQP A;  3E19 A;  3JAM E;  1WNL A;  4XTX A;  2XD0 A;  1OZ2 A;  5GAO r;  4M7D G;  4M77 B;  1VQ7 A;  2KVQ G;  4DQ2 A;  5LJ5 h;  2CS7 A;  3CCU T;  2K3X A;  4M7D E;  4OB1 B;  4OP0 A;  2A7Y A;  2KSS A;  5GAM h;  1VQ9 A;  3LGA A;  5DLO A;  2JZ2 A;  2CKK A;  1XNI A;  4X9C A;  4A4G A;  3HRT A;  3G71 A;  2D6F A;  1BI2 A;  1VQ8 A;  5D6X A;  3UPU A;  4RKU E;  3X26 B;  1G3S A;  5I21 A;  4HT8 A;  1KQS A;  2MMP A;  1S3S A;  3WVD B;  3OYN A;  3LYI A;  1P92 A;  3ZJU A;  1LNX A;  5GAN f;  3HU1 A;  2KK4 A;  1JBM A;  2ZPG B;  1M8V A;  1IZ6 A;  2DXC A;  5DYG A;  3DB3 A;  4M75 F;  2DK3 A;  4M7A C;  3QYG B;  4XK8 E;  2FYK A;  1M5Q 1;  4M75 D;  3GNF B;  4MML A;  2VXE A;  4II1 A;  2LCL A;  4F7U G;  4IUQ A;  4ZGJ B;  2RI5 A;  5IT9 E;  3OSV A;  4KBM B;  4B9W A;  4NL3 A;  2LT1 A;  3I56 A;  3CBM A;  3E9G A;  1FXX A;  2HNI A;  3M53 A;  3P8B B;  4Z02 A;  1U1S A;  3HPW A;  1VQN T;  3HKS A;  5FTJ A;  1K8A C;  3GNG A;  4XU3 A;  1K8A U;  4IKF A;  3RKY A;  3CBP A;  3HU2 A;  4QQD A;  2Q1D X;  3JCM e;  3BFM A;  3CCM T;  4M78 F;  1YJW A;  4MDW A;  3QBY A;  2LRQ A;  2P0K A;  1OI1 A;  4C8Q G;  2FHD A;  1WJS A;  3MP6 A;  4J7F A;  2OTL A;  5GAO q;  2QA4 T;  4AS1 A;  3UDC A;  2LVM A;  2IG0 A;  2P0Q A;  3MP1 A;  4BDY A;  4ATO A;  2KAF A;  5DY9 A;  3PMT A;  3CCJ A;  4J6Y A;  1TH7 A;  3M56 A;  3CCV A;  2CZ0 B;  4XTY A;  1Y96 B;  5GAN g;  3G6E T;  5FU7 C;  3JCM h;  3L2Q A;  4ZGE B;  1BIB A;  4YTL A;  5CKB A;  4GLK A;  1ZC1 A;  4NOY A;  2JVV A;  1XOV A;  3M57 A;  2DZC A;  2ZPF B;  3BDU A;  3E9F A;  3KBG A;  1VQP T;  5D6W A;  5GAN d;  2Q1C X;  3S3N A;  2DZ9 A;  3INZ A;  3A8L B;  4M77 C;  4FSX A;  3MO8 A;  2GFA A;  4J6W A;  4J83 A;  4CRI A;  4F7U F;  2VGM A;  1YBY A;  5HK0 A;  2EAY A;  4HCB A;  5GAM f;  3CPF A;  1O54 A;  3OW2 S;  4FT4 A;  3FLG A;  4MDX A;  3RIR A;  4BUG A;  3H6Z A;  3CCU A;  3CD6 T;  3MHX A;  4C92 B;  3G71 T;  4XU2 A;  4E7J A;  1KQ2 A;  4PL6 A;  3N5B B;  4C8Q F;  2RH2 A;  4C92 A;  5DM7 R;  4PJO F;  1R7R A;  1B34 B;  1VUB A;  3G7Z A;  4C8Q D;  2XG8 D;  2KY9 A;  3M4G A;  3QKJ A;  3O8V A;  4IUU A;  2K57 A;  3P8D A;  4DOV A;  2XDB A;  4PJO D;  1QDN A;  2D9T A;  3C94 A;  1N9S A;  3RES A;  1JJ2 A;  5AYF A;  1FX7 A;  4E7H A;  4RG2 A;  2X4X A;  1KHC A;  4C0F A;  3HP9 A;  1QCS A;  3C4S A;  3GLX A;  4D6W A;  5LJ3 h;  4ARI A;  3HFO A;  4MZM A;  1LOJ A;  5CKH A;  1M9S A;  3ZFJ A;  2QQR A;  4O5V A;  5CCA A;  2YRV A;  3CXC S;  1WQW A;  3MCA B;  4XU1 A;  1O75 A;  1UGP B;  2EQJ A;  4J7I A;  3JCM V;  4EPC A;  3CCL T;  5GAN j;  3PMI A;  2DXU A;  5GAN 7;  3NFC A;  1BIA A;  1G5V A;  3JB9 H;  1M90 C;  1Q81 U;  3C12 A;  1M90 U;  5ERG B;  1Y7X A;  2E64 A;  2JUF A;  2WAC A;  3H8Z A;  3MEU A;  1YIJ T;  4EMG A;  3FEO A;  1VQN A;  2XHC A;  4HT9 A;  3JCM X;  2PVD B;  4ELZ C;  5GMK e;  2EWN A;  4LDU A;  5HKC A;  3ZEH A;  3OYI A;  3CCM A;  2Q18 X;  2LC4 A;  3VU3 C;  5GAM d;  3JB9 F;  4PLI A;  1NZ9 A;  4QQG A;  1JB0 E;  3JB9 D;  3QZ9 B;  2X35 A;  4OGC A;  2QA4 A;  4MZP A;  3CC2 T;  1GXI E;  2E70 A;  3WXM B;  3PGG A;  4TVR A;  3CBO A;  2RM4 A;  3L2Z A;  5I2M A;  2EYQ A;  3X25 B;  3OS0 A;  2VV5 A;  1D3B B;  2O4X A;  2VXF A;  2ZZD A;  2YHT A;  1QP2 A;  4ME7 A;  3VYH B;  4M75 B;  1RL2 A;  2PQW A;  5EPP A;  3G6E A;  1WQ7 A;  2JTF A;  1VQ5 T;  4ZN1 A;  4FL6 A;  4L6V 5;  3FC3 A;  3RMQ A;  3JB9 I;  3OS1 A;  1MGQ A;  3OYH A;  1UGS B;  3PTA A;  1W2B S;  1BI3 A;  4XQ3 A;  4M7A G;  3OY9 A;  2Y4Y A;  1WPY A;  3ZJV A;  2MAM A;  3TCJ A;  3HRS A;  3LHD A;  2YUJ A;  5CVI A;  4ELY C;  2E12 A;  3CMA T;  2XKO C;  2M16 A;  1QVG S;  3OBW A;  1VQ6 T;  5FTL A;  2MWO A;  2PVO B;  4M7D B;  3LH0 A;  3OYJ A;  3OQ5 A;  2L3R A;  4RCC A;  5GAO l;  4N4G A;  4M7D A;  2RJF A;  5J39 A;  2MI6 A;  3VJP A;  4M78 G;  2EJF A;  2Y4X A;  4C92 C;  4M77 A;  5KE3 A;  2VC8 A;  2HQE A;  4M78 E;  3X28 B;  5FRN A;  2MM0 A;  1QP3 A;  3CD6 A;  3QWZ A;  2HD0 A;  3CEY A;  3M58 A;  5GAM j;  3JB9 J;  1QVF S;  4HCC A;  2GF7 A;  3FB9 A;  4QW2 A;  2CYZ B;  3OW2 A;  4V2S A;  3QZ5 B;  1ZBX A;  2QTX A;  1I5L A;  2MM2 A;  5J3B A;  5I2S A;  2RA2 A;  2DIG A;  4N4I A;  1YHQ A;  2C06 A;  1S72 T;  4C0D B;  3PFS A;  1X75 C;  1UGR B;  3DB4 A;  1I8F A;  2MF2 A;  4L59 A;  4UC4 A;  3JCM c;  2E6N A;  2RD1 A;  3OYG A;  4M7A F;  3BW1 A;  3G4S A;  4JRQ A;  5HY6 A;  3M5A A;  2QQA A;  4M7A D;  2A3L A;  2QQ9 A;  1N9R A;  1VQK T;  3QJ6 A;  4IUV A;  4J6X A;  2M9U A;  2CGH A;  2QXF A;  2RHX A;  4LDX A;  4F7U E;  5A0L A;  3CCL A;  2DIQ A;  3SB2 A;  3GF5 A;  5CAI A;  5IAY A;  3MP8 A;  3OMC A;  3LLR A;  5C18 A;  4QVD A;  1YIJ A;  3TU4 K;  3M54 A;  3OA6 A;  2E41 A;  4FM4 B;  4NS5 A;  4M78 D;  4PJO G;  3LWH A;  4C8Q E;  4C0Z A;  1R8O B;  4C0G A;  4PJO E;  3HSB A;  4ARC A;  2GCX A;  2JOY A;  2X4Y A;  3SFM A;  4O6J A;  4DA4 A;  1Q86 C;  4XTW A;  3E1S A;  1Q86 U;  1X01 A;  2B8A A;  4A4H A;  3CC2 A;  3M4Y A;  3CPW S;  1YCY A;  1JRI A;  4PLL A;  1BI0 A;  1OYX A;  2E65 A;  2Y90 A;  1HK9 A;  2ZGW A;  1Y96 A;  5GMK l;  5GAO p;  1CZ4 A;  5FU6 B;  5FTK A;  4A4E A;  1I9G A;  1VQ5 A;  2PJH B;  3A5Z B;  4FU6 A;  5CKE A;  4XTU A;  2F69 A;  2QQB A;  3OSS C;  3P8H A;  3A8O B;  1KD1 C;  4M7D C;  3OYL A;  1KD1 U;  3EFS A;  5B6C A;  2EIF A;  1YI2 T;  3SD4 A;  3M59 A;  1EIF A;  1H64 1;  4M77 F;  3SWN B;  5LJ5 f;  2DXB A;  1BI1 A;  3TRE A;  3CC7 A;  3CMA A;  4OGE A;  4LD9 K;  1W2B A;  1VQ6 A;  1G3W A;  4XTZ A;  3NTK A;  3TEE A;  1KQ1 A;  1VIF A;  3Q1J A;  1E32 A;  5D6Y A;  4EDU A;  3FJP A;  2LQ8 A;  5KCO A;  1KC8 C;  1KC8 U;  5FRO A;  3OMG A;  3JB9 G;  4AQ7 A;  3OYF A;  3J7A F;  2FL7 A;  1QVG A;  1M1K C;  3TIW A;  1M1K U;  2BUD A;  5LJ3 e;  3BDL A;  4E7L A;  1Q7Y C;  1RI0 A;  1KHI A;  2RHU A;  5CIU A;  4DOW A;  2R5A A;  3L42 A;  4OMF B;  1Q7Y U;  2EQM A;  3CCR T;  3NTH A;  3JCM W;  2RK2 A;  2DTH A;  1B34 A;  3PT9 A;  4C5E A;  3QSU A;  4KDI A;  4C0D C;  2L8D A;  1YHQ T;  4ZGD B;  2K5F A;  1NPR A;  4BAC A;  3L2U A;  2I2L A;  3S3O A;  1PSE A;  3FIF A;  2VUB A;  2RHI A;  3A8H B;  3FDR A;  3HRU A;  4NL2 A;  1S72 A;  1QVF A;  4KOD A;  1VQ4 T;  2PUO B;  3G4S T;  5DYI A;  1YJ9 T;  3VUZ A;  2X4J A;  2ZCF B;  4C5G A;  3OYB A;  1U1T A;  3QXE B;  4BI3 A;  1FWZ A;  1WJQ A;  4JDS A;  3CME T;  5LJ5 g;  1XQH A;  2GFU A;  4JUV A;  3V8K A;  5KE2 A;  2XK0 A;  2KDS A;  4E47 A;  2DJZ A;  3JCM b;  5GAM g;  4R56 A;  1VQK A;  4C92 G;  1Q81 C;  3VKI A;  2PWY A;  5C1B A;  4A54 A;  3OB9 A;  1N6A A;  3J81 E;  3VV0 A;  4BE2 A;  2DTI A;  5LJ5 d;  3CC4 T;  1X6O A;  5GAN 5;  2QEX T;  2WSF E;  2XDP A;  4P5N A;  1H3Z A;  3AHU A;  1NPP A;  2RJC A;  3OBY A;  4KDL A;  3GP8 A;  2BKD N;  1BYM A;  3JCM f;  2Q19 X;  2MWP A;  4CI0 C;  3V7R A;  3DLL A;  3L2W A;  5GAN h;  5FTN A;  5FU6 C;  2HBP A;  5KH6 A;  2K3Y A;  1D3B A;  1AHJ B;  5GAO m;  1WLF A;  2RI3 A;  3LX7 A;  4M75 A;  4FT2 A;  5GMK j;  4KT0 E;  2L89 A;  5CQY A;  5J26 A;  4XTV A;  1DJ7 B;  4LDW A;  4M7A E;  3CPW A;  4ZTF A;  4EMH A;  3MEW A;  3QQ8 A;  1UGQ B;  3CC7 T;  2G3R A;  4OB2 B;  2E6Z A;  2LNV A;  4EMK B;  5C6S A;  3OYD A;  2Q1A X;  1YI2 A;  3QQ7 A;  2EJG A;  1G3T A;  4JS4 A;  4EMK A;  4M78 B;  3F70 A;  3FPR A;  3QJY A;  2E5Q A;  4IUP A;  4C5I A;  4BDZ A;  1N8R C;  3KUF A;  1N8R U;  1QVP A;  2XI9 A;  3GPL A;  2WSE E;  4N4H A;  4KUL A;  1WGS A;  4C92 F;  3GIB A;  3RKX A;  1M1G A;  4C92 D;  3CCS T;  3M55 A;  5LJ5 j;  5FTM A;  2RI2 A;  2K2V A;  3JCM g;  2CZ7 B;  1VIE A;  2R5M A;  2RJD A;  2LTO A;  3OS5 A;  1K9M C;  3CCR A;  2DKG A;  3T9N A;  2EQK A;  1K9M U;  2EFI A;  4JLG A;  5LJ3 f;  1VQM A;  3CCE T;  3ZBD A;  3FPT A;  1YIT T;  2EJ9 A;  4LD6 A;  2JNG A;  3JCM d;  1M4Z A;  2HQX A;  2R58 A;  3V8J A;  2XDD A;  3L2V A;  3QG1 A;  5GAN 8;  3EFR A;  1VQ4 A;  5L8R E;  4M77 G;  3V7C A;  4F7U B;  5A0D A;  5HK3 A;  1YJ9 A;  1YJN A;  2ZPI B;  4F7U A;  4XU0 A;  1VQO A;  3QYH B;  4M77 E;  3CME A;  1BKB A;  1JJ2 S;  4KO8 A;  3QPH A;  1IRE B;  2K5L A;  4A4F A;  4KUI A;  2IVW A;  1I81 A;  3JRZ A;  4IUR A;  4VUB A;  1N27 A;  3RMS A;  2LCC A;  4A53 A;  4ZN3 A;  4JJN K;  4C8Q B;  5GAN 2;  4Y91 A;  2DXT A;  4BI4 A;  4QVC A;  3CXC A;  4E7I A;  4PJO B;  2OTJ T;  2LQK A;  1O9S A;  3L1A A;  3QO3 A;  4A4K A;  4C8Q A;  5GMK m;  4Y28 E;  2M1H A;  3CC4 A;  3M9Q A;  2PU9 B;  3UT1 A;  4PJO A;  2QEX A;  2YLC A;  3QDR B;  2DD5 A;  2P4T A;  3LGL A;  2QDY B;  1VQL T;  1I4K 1;  2DD4 A;  4BY6 B;  5LJ3 g;  3HFN A;  4M75 C;  4JRP A;  2DVE A;  4RG8 A;  5FLX E;  5CQX A;  3JCM J;  5C0M A;  3JCM P;  3HU3 A;  4HCZ A;  1K73 C;  4BD3 A;  1SSF A;  1ZHI A;  1K73 U;  3MB5 A;  2BIV A;  5GAN 4;  2FB7 A;  4J5Y A;  3MET A;  2ZPH B;  2M0O A;  2V8K A;  5CR2 A;  5LJ3 d;  4QQ6 A;  4B9X A;  4EMK C;  3OYA A;  4M7D F;  5M9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...