2XDPA

Crystal structure of the tudor domain of human jmjd2c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
EKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4C
publication title Crystal Structure of the Tudor Domain of Human Jmjd2C
rcsb
source organism Homo sapiens
total genus 18
structure length 119
sequence length 119
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xdpA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2xdpA02
3LGFA 3OYEA 3MO8A 3CEYA 3ME9A 1OI1A 2DAQA 3DLMA 2E6NA 2BKDN 3OYGA 2HQEA 3MP8A 2RHUA 2X4WA 3OQ5A 2BIVA 1OYXA 5KE2A 1WGSA 2K3XA 2R5AA 3SD4A 3BDLA 4C5HA 2LRQA 3OYJA 2WACA 4BACA 3OYFA 4UC4A 4IUTA 3L2QA 4QQGA 4E7JA 3LX7A 4ZTFA 1XNIA 2D9TA 4BDYA 2LTOA 4OVAA 4Q5WA 4IUVA 3OYCA 5C0MA 4A4FA 2M16A 4FU6A 2GFAA 5FRMA 4X34A 3O8VA 3OYNA 1OZ3A 3OYAA 2M0OA 2LVMA 3E9GA 2P0KA 3F70A 1WJRA 3S6WA 2RHZA 4E7LA 1MHNA 4BE2A 2RJFA 2QQSA 3LGLA 3ASKA 2L3RA 5KCHA 3PNWC 5D6YA 1SSFA 2RI5A 3DB3A 5IN1A 3OY9A 3L2VA 3OS1A 2L89A 2R5MA 3UWNA 2RHIA 3OYDA 2M1HA 2X35A 4HCZA 2B8AA 1H3ZA 3LH0A 2FHDA 2EQMA 3OMGA 3OMCA 2EQJA 2RJCA 2CKKA 5M9OA 3LLRA 3MEWA 5J26A 4B9XA 2JZ2A 5KCOA 4IKFA 4A4EA 2RJDA 2QQRA 4GY5A 1KHCA 3FEOA 3KUFA 2F5KA 3QKJA 2VYTA 3E9FA 3UT1A 3QBYA 4LD6A 5IAYA 5J39A 2R58A 2RI3A 2RJEA 2XK0A 3MP6A 3P8HA 3Q1JA 4II1A 4BD3A 2RHYA 4PLLA 3OYLA 3OYBA 2RHXA 3DB4A 1RI0A 2EQKA 5D6WA 3H6ZA 2HQXA 4IUPA 4A4GA 4EDUA 3L2UA 3P8DA 4E7IA 4CRIA 4BE1A 3PMIA 4C5IA 2L8DA 2EFIA 3L2RA 2EQUA 2O4XB 3MP1A 4Z02A 3C4SA 4IURA 3S3NA 2G3RA 2DIQA 2LDMA 4QVZA 4QQ6A 2YRVA 4ZTJA 5FRNA 1G5VA 4N4IA 2PQWA 4BDZA 2DIGA 2JTFA 3EAEA 5D6XA 2IG0A 4B9WA 4C5EA 4QQDA 3OYIA 4N4GA 4BE0A 2EKOA 3OYKA 5FROA 4C5GA 3S3OA 4L59A 2RI2A 3OS0A 1WJQA 4A4HA 2NLUA 4PLIA 3LYIA 4RG2A 2X4YA 3M9QA 4IUQA 1N27A 3QIIA 4E7KA 3GOXA 2R57A 2BUDA 3L42A 4QW2A 3OYHA 3OYMA 3NTKA 4IUUA 3NTHA 3MEUA 4N4HA 4PL6A 3MEVA 4E7HA 3FLGA 3META 2XDPA 3FDRA 3OB9A 3PFSA 3S3MA 3QJ6A 2MWOA 4NS5A 5KH6A 1WJSA 3ZEHA 3OA6A 3NTIA 2GF7A 2GFUA 3FC3A 4FL6A 3MEAA 3H8ZA 5CIUA 2MWPA 2O4XA 3PMTA 5KE3A 3OS2A 2RO0A 2LCCA 2X4XA 1OZ2A 5C6SA 2E5QA 2K3YA 3L2WA
chains in the Genus database with same CATH superfamily
1Q82C 1YHQT 4X9CA 4ZGJB 1UDLA 4BACA 1M2VB 2QEXA 4ANJA 2V1QA 1MUZA 1VQ5A 5KYWB 1W2BA 1X27A 2K5LA 4OVAA 3JCMP 4Q5WA 2FVUA 4IUVA 4OMOA 1VQ6Q 5CKDA 2MM0A 1K4US 1I5OB 3OYNA 4C0ZA 4BE2A 2YRDA 2RJFA 4ME7A 3HL8A 1FWZA 1Q81R 4C92D 5B6CA 3L2VA 2HEQA 2MOXA 2X35A 2M02A 5GAMg 2EQJA 2Y90A 5GAOq 3CD6Q 2JOYA 1NJIR 3LLRA 2C0OA 1N8RR 3TU4K 5CCXA 5GAOr 4FIBA 5J39A 1M90C 4JJDA 4PLLA 2KT8A 2AHJB 1JJ2P 2PNIA 1X69A 1UB4A 4HCKA 3L2UA 4XU1A 4KLNA 3PMIA 4RTVA 5GAOl 4DBFA 4M4ZA 5GAMj 1VQMQ 2YUPA 4QQ6A 1A0NB 5GAOn 4DEXA 3QQ8A 4KULA 4PJOG 3CD6A 5KYNA 2RH2A 1OOTA 1YI2Q 1VA7A 2H3EB 2E41A 4BB7A 1WHMA 1BI3A 2ED1A 2PU9B 3HFNA 1QVPA 2OTLQ 4IUQA 3E1SA 2VC8A 1ABQA 3MEVA 3L1AA 1UJ0A 2MWOA 3DKMA 4NS5A 2JMCA 4FSXA 3FC3A 3H8ZA 4AG1C 3M0UA 4M77E 1PC0A 2OX7A 2DA9A 1TUGB 3TSWA 2EJGA 3MO8A 2FB7A 1ACMB 2PVGB 1P92A 5GAOm 2DJQA 3PVQA 1WGSA 2EPDA 1OPKA 3CCMT 3CC7T 2C0TA 1CKAA 1FXXA 4ZN3A 1SPKA 3G71Q 1XNIA 2V8KA 3M0PA 2JNGA 2O01E 3VRYA 3C12A 1OU9A 1WPYA 4GLMA 3QYHB 4E6RA 3BFMA 1YHQQ 1Y07A 2K2VA 2E65A 5KYXA 4E7LA 5GANe 2RMOA 2LT1A 1RADB 1VQ8T 3DB3A 4M7DA 2DFUA 1Q86C 4JZ4A 3CPWP 4M78G 1UG1A 5FU7C 2VXEA 4J7FA 1UGSB 2DL8A 2DVEA 1T3SA 1GL5A 2F1LA 3RMSA 1Q82U 1KHCA 1VQPT 3QWZA 3KUFA 3C95A 3JCMd 3REAB 5HK0A 2DZ9A 2ZPBB 2LJ3A 1BU1A 3J81E 5D6WA 2C0IA 2CS7A 4P5NA 3NHNA 4RV0A 2KT1A 1QVFP 4WF2A 4IURA 3M0QA 4M77C 5A0LA 2F69A 2DEUA 3RKWA 2GNCA 5DYGA 2KXCA 1G2BA 2LNVA 2DKGA 3OSVA 2BE7D 3V8JA 2K4YA 4DBRA 2LQWA 5CKFA 5EPPA 1JXMA 3ULRB 2MIOA 4JRPA 3QQ7A 2JV2A 3I55T 3META 1M90U 4FSSA 3JSCA 1VQ9Q 3HKSA 2E10A 2ABLA 2LP5A 5AT1B 2BE9B 4M75G 3RESA 2YDLA 2JM8A 1YJ9T 1RAFB 2HKQB 2O31A 1OYXA 5CKHA 2K3XA 3QZ9B 4OB3B 1IREB 3R6NA 2CZ0B 3HP9A 2CP2A 2QK0A 5J3BA 2B86A 2PVOB 5IHNA 2EYYA 4A4FA 1QDNA 2CZ7B 1OZ3A 4RTWA 3JCMf 2VB6A 2QAZA 2DL7A 3OS5A 3CCMQ 3CC7Q 4KGZB 5KCHA 3DLLA 1GCQC 3E2UA 1HXDA 2VVKA 1H3ZA 1Y57A 4M7DE 2D8JA 5ERGB 3JB9F 2L3QA 1M3BA 2KEAA 1QCSA 1NZ9A 4PJOB 1YNZA 2F5KA 3E9FA 4ZGDB 1NEBA 5CD1A 2EQKA 2FRWA 3TQ7P 5IT9E 3EGXA 4E7IA 3L2RA 2O4XB 3X26B 4R0KA 2NUPA 3CC7A 2YWWA 1UGVA 4D8KA 3JCMh 2ECZA 4QVZA 2K3BA 1VQPQ 3A8HB 3CCST 5GAN6 1RAHB 2KYMA 1X2KA 1XQHA 5D6XA 1YJWT 4M7AF 2PUOB 1LJOA 2AZVA 2VWFA 3OYIA 1Q86U 1QVGP 3JCMc 4OP0A 2ZCFB 3EGUA 5LJ3d 2K9GA 4N0AC 2D1XA 1VQ8A 3OYHA 2YUJA 3CCVQ 1CZ5A 4N4HA 1BYMA 5FWBA 3SB2A 3FDRA 3VV0A 4A54A 2E1HA 1K8AC 2VKNA 1KD1C 3I5SA 2GF7A 3NMZC 2LJ0A 2PVDB 1TUCA 3RDVA 3LGAA 1NYFA 2RF0A 4OGCA 1YP5A 3CQTA 2DAQA 2HQHA 2CT4A 3I55Q 4C5HA 1SRLA 1B07A 3BDLA 1JJ2S 2GBQA 4LUEA 4PFPA 4EMGA 1X01A 4FT4A 5FTMA 2CZ1B 4JZ3A 1OU8A 3V8LA 2MI6A 1WXTA 1W6XA 4C8QA 4BY6B 4TVRA 1NBEB 1JEGA 2KY9A 1I5LA 2AZSA 2EKHA 1VQLT 5GMKl 5FU6C 1ZSZA 4X9DA 3OMGA 1WYXA 3RIRA 3CC2A 1GBRA 3I55A 4XTYA 4Z8AA 4NL3A 2COZA 2QQRA 1UHFA 4C92E 4O5VA 3PE0A 2OI3A 5IXBA 5FWCA 4EMKA 1G8XA 3HRTA 3TCJA 1FX7A 1YJ9A 4J9IA 3AHUA 2EFIA 1WQWA 1WQ7A 3CPFA 2G3RA 2AIRB 1VOMA 3RERA 1SKUB 2DE0X 1AWWA 1YCSB 4FW1A 3QWXX 4OMPA 2DYBA 2CP5A 3VS5A 4M75B 2HBPA 3OYKA 4XU2A 3WVEB 4LDWA 4AG2C 4CC2A 1Q7YR 3A98A 1V76A 1QKXA 5GMKm 3QUIA 4RG2A 3RKXA 1M2OA 1KC8C 4M77G 1VQOT 4L6V5 5KYYA 3CCSQ 5I2MA 3X20B 2FL7A 1IZ6A 1C6VX 4ELZC 4OB1B 3TIWA 2CP3A 2KVQG 1YJWQ 1V29B 1VQ4Q 4J5YA 3CCQQ 1IHWA 5DLOA 3INZA 4PKCC 1YIJT 2LMJA 2LCCA 3KFVA 2YRCA 5L23A 1H92A 1EFNA 1WLPB 1UGQB 4RTTA 2LRQA 3H0FA 1M3CA 1AWJA 2ROLA 4C92C 2GTJA 3VUZA 2LTOA 4E7ZA 3CBOA 3OYCA 1BI2A 5EG2A 1M27C 1KFZA 3CCSA 2M51A 3UF4A 1NM7A 1VQ6T 1YJWA 3GF5A 2L3RA 4C8QE 5GAN4 1ABOA 3LH5A 2HSPA 2QA4Q 1K9MC 2MF2A 1K8AU 3OS1A 1KD1U 3UWNA 4F17A 1R77A 3TSZA 1TWBA 3M4GA 2PTKA 3CPWA 1B34B 4KDLA 3OW2A 1RL2A 1VQLQ 1D0XA 4M7DD 1WHGA 1MMDA 3SEMA 2GQVA 2HNIA 3H6ZA 3VJPA 2HQXA 1TG0A 1IRXA 2WSCE 2I2LA 3C94A 2A0FB 2EWNA 4XAXB 3J80E 2E64A 1E7OA 1YN8A 1BKBA 1VQNT 2YUNA 2EYZA 2JMAA 5A2QE 4BDZA 1QVFA 5CAIA 1U5SA 1UFFA 1PM3A 1K9AA 2EKOA 4PJNA 1YI2T 2HL5C 2QG9B 4FW2A 1PSEA 2CP6A 2QQAA 1VQLA 3HU2A 4QW2A 5CQYA 1W70A 2OTLT 4E7SA 2OAUA 2JS0A 1YCYA 1WJSA 3BW1A 3LWHA 2FO0A 2H8HA 2MCNA 2X4XA 3UPUA 5FTNA 2CZ6B 2E5QA 3BE3A 3EG3A 3SWNA 2DTOA 2FPFA 2M9UA 4PFZA 5GMKh 4QQGA 1D1AA 2JVVA 4AFUC 2P84A 1PSFA 5GAOp 3KBGA 5C0MA 3JB9D 3G71T 5A0DA 5FRMA 3VU3C 3CCJT 4PJJA 3OBYA 1JU5C 2ZZDA 1KC8U 3X24B 2QTXA 4OMQA 5FU7B 4D8DA 5KYWA 1NJIC 1RAAB 1QVGS 5D6YA 4J7IA 2R5MA 1LPLA 3OYDA 2RNAA 2B8AA 4HCCA 2LQKA 3MHXA 3OMCA 1VQOA 1NEGA 1PG5B 2WSFE 3CCUQ 3G6ET 2JXBA 2HL3A 4AS1A 4HT8A 4KGVB 2F2XA 2HBWA 2FPEA 4AMCA 4FM4B 1YIJA 1M8MA 5IAYA 5GMKi 2RQUA 1VQKQ 1OQKA 2ZPIB 4EDUA 1MGQA 4M77B 3CCLQ 3WXMB 2MMPA 1IO6A 4JJCA 1RLPC 2Z0WA 5I11A 1JBMA 2A3LA 1G5VA 3MPUB 5CKBA 3H9NA 1S72T 3EAEA 5I22A 1BK2A 4JUVA 1K9MU 2AKLA 4XTVA 3GBQA 2RQVA 1VQ6A 4C5GA 2JJ9A 3R6OA 2COYA 3A8LB 3QO3A 3M0SA 4AT1B 1AZGB 4IUUA 2IIMA 2Q1DX 3VS3A 1QVGA 1VQNQ 1Y96B 4Y28E 4KO8A 1Q82R 1YWOA 4OMLA 4Z88A 2JW4A 2KROA 1NPRA 2DO3A 2YXYA 1VQ9T 2VGMA 1SHFA 1H641 2YLBA 3ME9A 2BKDN 5KE2A 3OQ5A 1R7RA 2QQBA 2K6DA 3OYJA 4R56A 1EIFA 2DL4A 4BDYA 2NUTA 4J83A 4F7UG 4HCBA 4DBHA 3CCRQ 1EX4A 1VQNA 3EG9B 1UTIA 1VQMA 2L5QA 3M58A 3O8VA 3M57A 2FZCB 2JUFA 3JCMb 1M1KR 3PTAA 2QGFB 1VYTA 4C92G 3CC4Q 2RQTA 1KG1A 3LHDA 3ER0A 1YI2A 1RLQC 5GMKj 1BCOA 4OGEA 1NLPC 3TEEA 4JRQA 5EQJB 3E19A 1M90R 2RJCA 5I2SA 3LWIA 3X28B 1C0MA 1HK9A 2KYBA 2RB6A 3CCJQ 2OTLA 3JB9I 4C8QD 2LC4A 2K2MA 5CR2A 1I0CA 4JS4A 1QP2A 1N6AA 3UT1A 1YJNT 1T0HA 3MP6A 1WHLA 3NGPA 2M0YA 4OF1A 1CKBA 4C0FA 4CRIA 4MZPA 1U06A 4A4KA 3I35A 3G6EQ 2D0QB 2EVRA 4WCIA 5GJVB 1MMAA 5ECAA 3CBPA 1OPLA 1OV3A 3ZFJA 1T0JA 2V26A 4MDXA 3EGDB 2DBKA 3GIBA 4PFOA 1FMKA 1IGUA 1ZUKA 3PIOA 3G71A 5CKEA 4PJMA 1VQ7Q 3SWNC 3OS0A 2KXDA 4J9BA 1XJWB 3JRZA 1H3HA 2L2PA 3EHQA 1YHQA 5FTJA 2O2OA 2R57A 3VS0A 1LOJA 5KYXB 3NTKA 4KBMB 2LCSA 4PL6A 4RMOA 1X6BA 3CCVT 1WI7A 1S72Q 1BBZA 3G6EA 4M7DB 2LX9A 4ORZA 3MEAA 2VXFA 3A8GB 2EYXA 1K73C 5CIUA 1E6GA 1I9GA 1UJYA 1NG2A 1QMCA 1EZZB 3LGFA 2DVJA 4XTUA 4L5GA 2K5IA 5GANf 2HSEB 2EBPA 2WACA 1ARKA 4LDUA 3UDCA 4UC4A 3THKA 3TVTA 2ZGWA 2X4JA 4QT7A 3JCMe 2D9TA 3HU1A 1ZHIA 4LDYA 5L8RE 5LJ5g 5FU6B 1MNDA 1ZUUA 1S72A 2KGTA 1QQJA 3VS4A 1MNEA 4FT2A 1M5Q1 1RI9A 3FRNA 1QLYA 1I81A 2X3XD 1NPPA 2X51A 2YUQA 2FG0A 2RHIA 2M1HA 1PRLC 5CVIA 2EQMA 4XTXA 5IHKA 4Y92A 3RNJA 3J7AF 2J6KA 4A4EA 5I21A 2ATCB 4MZMA 5LJ5j 3HRSA 1UHCA 5CQXA 2DYIA 3VYGA 5GANh 3P8HA 2KMTA 4BD3A 2K7AA 4JPBW 3M54A 1OULA 1VQ9A 4FYWB 4PJOA 1C1AA 5IHIA 4ARCA 4M7AA 1UE9A 2DILA 4ZGEB 1X75C 2HMAA 2PQWA 1YJNQ 3QWYA 1Y7XA 1KQSP 3BQBA 1ZBJA 2YVLA 3AT1B 4X1VA 2IG0A 4LD9K 4CQNA 4RTYA 3ZL7C 2DPPB 1ZUYA 3M0TA 1WJQA 3HTRA 3M5AA 2DNUA 2X4YA 4IIMA 1HD3A 2LCLA 5IH2A 2PUKB 4AFQC 1ZQ1A 3CCMA 2XDPA 2C06A 3OB9A 3M55A 3S3MA 4F7UB 2SRCA 3MJXA 3ZEHA 4E2FB 1B3QA 4FYVB 4PJOF 3BY7A 2JTEA 3V7SA 2YLCA 5KE3A 3OS2A 1VQ4T 3CCQT 4C92B 1NE8A 3VS6A 4EPCA 2L0AA 3VUBA 1H8KA 4HXJA 2XDBA 5AYFA 1YWPA 1FYNA 1TS9A 3L2QA 3IQLA 3RKYA 2FEIA 4BI8B 4J9FA 3T9NA 3VS7A 2EYWA 2NUPB 4M78A 3CMEQ 7AT1B 1VQPA 4F14A 5FW9A 2FRYA 3FJ5A 2QQSA 3EFRA 1I1JA 2E4HA 2DJZA 2EJFA 4JDSA 4M7DC 3OY9A 2OTJQ 2QASA 3JCMJ 1JQQA 1M3AA 2E5KA 2QA4T 1K73U 4MMLA 1GFDA 4HKEA 5J26A 2W0ZA 3HSBA 4DOWA 3CCVA 3LW5E 2V8JA 2DBMA 2KQWA 2DXBA 3QKJA 5LJ3e 5GANg 4LD6A 3Q1JA 1U8RA 1AD5A 1YFNA 4LE9A 2DEQA 3HHTB 3V7CA 3CMAT 4M78F 3S3NA 4PJOE 3JCMX 1Q7YC 4M7AE 3I56T 2Q1AX 3EH2A 1WNLA 4N4IA 1UUEA 2JTFA 5GANj 4RTUA 4OB0B 1UEBA 1R8OB 3QXEB 5FROA 3S3OA 3FPUA 2MPXC 5FTKA 2MYSA 1BI1A 2QTVA 1PNJA 1KD1R 2DX1A 2K79A 4XU0A 2B25A 2CH4W 3QG1A 1W1FA 2CREA 4C8QB 4E7HA 3HU3A 2EYQA 1JJ2A 1GRIA 3I9QA 1ZSZB 2G6FX 1AVZC 2IPOB 3CXCP 1OZ2A 2LZ6B 5C6SA 4A53A 3L2WA 3OYEA 2DF6A 4BI4A 2CDTA 4JRIA 1CR5A 1RAGB 1G3YA 2IVWA 3OYYA 2LJ1A 1OX9A 1LVKA 1CSKA 2PWYA 2E70A 4EMKB 2A08A 1N5ZA 5GAMe 2KK4A 2XICA 2K57A 3QC8A 2XIDA 1K76A 3VRZA 4ESRA 3EG1A 2EGCA 2X9HA 3OYAA 2DETA 3S6WA 3EFOA 2NWMA 4M75F 4M78E 4RG8A 2K5FA 5IN1A 5GAN7 4M7AC 1G3TA 1VQ5T 1JB0E 2DRKA 1GCPA 1AHJB 2MM2A 1AOJA 1U1TA 4B6MA 4GY5A 2CUDA 1WXUA 3CCUT 3FEOA 4J9HA 4KODA 5KYYB 1RAIB 3GLXA 1VQ4A 1VUBA 3CCQA 4OB2B 3MKDA 1Z9QA 1IHVA 5GAN3 2L8DA 1VQKT 1FMWA 2DIQA 3X25B 3CCLT 1K0SA 2YRVA 2RD1A 4ZTJA 1X6GA 2D6FA 2HD0A 4XQ3A 3CCEQ 1KC8R 2P0QA 3JAME 1D3BA 3PT9A 2DERA 2EIFA 5KYUA 4BE0A 3CMAQ 4PJLA 4PLIA 4J8OA 1D0YA 1N27A 1TTHB 1SHGA 3L42A 3I56Q 2Q18X 1M1FA 2CYZB 3PFSA 1HJDA 2FZKB 2QA4A 5GJWB 4XK8E 1D09B 2QGGA 2F2WA 2RO0A 3G4SQ 3JCMV 2K3YA 2VUBA 2CSIA 3KXTA 4CC3A 2YUOA 5GAN2 2A7YA 1Q7YU 3SDZA 1XTDA 2Y4XA 4QKUA 4RCBA 3CMAA 4OMMA 3I56A 1I4K1 2M16A 1XOVA 4C0GA 5GLFA 2PZ1A 2I0NA 4C8QC 1CZ4A 1KQSS 3CCRT 1MHNA 2EAYA 1JXOA 1PKTA 3GPLA 1V1CA 1W2BS 3CBMA 3RMQA 3PNWC 1SSFA 1R0BG 1OX8A 3RBBB 3CC4T 3OSSC 5LJ5d 1ZSZC 1OEBA 2DLPA 3JV3A 2CP0A 2EW3A 1M30A 3VS1A 4CC4B 2LNHB 1Q81C 2CSQA 1VIEA 4JS5A 4M7DG 2ENMA 1M2VA 2ESWA 4WTOB 1BIAA 2YT6A 2CT3A 2JM9A 3H0IA 3M4YA 2RHYA 4EMKC 3FPTA 1VQ5Q 1N8RC 4HVUA 4AFZC 1N9RA 4XTZA 4KGXB 1KHIA 3I5RA 1I07A 2LDMA 4FYYB 2XD0A 4XU3A 3REBB 3SWNB 1NLOC 2Q19X 4JRKA 2GTOA 2YHTA 4M77A 2DZCA 4QVCA 1JO8A 2DTIA 4Z89A 2ZPGB 4PJOD 2P4TA 4DEYA 4M7AD 4HVVA 2AK5A 2NLUA 4JLIA 3A1PA 1VQ7T 1KQSA 1W4SA 2QDYB 3GNFB 2KNBB 2E3IA 5KH6A 5HY6A 3NTIA 3EG0A 3H0HA 1WX6A 3ZBDA 1E32A 2LQNA 3ZGZA 3EH1A 3CCUA 1IGQA 1Y96A 1QW1A 2BZYA 3OYGA 2HQEA 1WLFA 4M77F 5LJ5f 2HDAA 3OYFA 1M1KC 1VQKA 4E7JA 3LX7A 3JB9G 3RUXA 2A28A 3CCLA 1PCXA 1J3TA 9ATCB 1KK7A 3M0RA 1M8VA 3A5ZB 4RCCA 2DK3A 3G1JA 3E9GA 4JLGA 3LGLA 3UA6A 2LX7A 3QDRB 2Q1CX 2EGAA 1F1BB 3EG9A 1AWXA 1GCQA 4YTLA 2W10A 3NFCA 1VIFA 1PWTA 5M9OA 2AKKA 2O9VA 2DXUA 4M78D 5KCOA 4ARIA 1BI0A 2RJDA 1RAEB 4Y91A 1DJ7B 3MB5A 4M7AG 3QBYA 2DTHA 8ATCB 2XK0A 5LJ5h 4CI0C 4LDVA 3PVLA 4QVDA 1RI0A 2AT1B 3CXCS 4IUPA 4DQ2A 1MV3A 4J6YA 5GANd 1VYVA 3C4SA 2PJHB 4MMKA 4KRTA 2DIGA 1UGPB 3EFSA 2HAXA 4LDXA 2NUTB 2YSQA 3CCRA 5C1BA 3VS2A 3EGDA 4IIOA 5DM7R 3M9QA 4N0AA 2HZYA 1Q81U 3CC4A 3MEUA 1TH7A 2ZPFB 3FLGA 4KUDK 3P8BB 3HPWA 1KSWA 1NJIU 4HA8A 4R55A 1N8RU 2E3HA 2BZ8A 1RABB 3CCJA 2V8IA 4MDWA 2E6NA 3MP8A 3FPRA 2X4WA 4M75D 3V8KA 4DOVA 3HFOA 2ROTA 3URGA 3OW2P 3SFMA 4XTWA 2RK2A 3CXCA 4C0DB 1PHTA 3M53A 2FZGB 1MMNA 2J7IA 3F70A 1R0CB 1UGRB 6AT1B 3FIFA 2VGNA 3ASKA 2FYKA 3CMET 3JCMW 1LCKA 2KSSA 2FPDA 5CCAA 1GXIE 1HYOA 3HRUA 3JB9J 1BIBA 1VQ7A 1KQ1A 4HCZA 5CK9A 2HKNA 1SF9A 2DRMA 4C8QG 2QYZA 4RKUE 2OTJT 3MEWA 4B9XA 4IKFA 4KH1B 5DLQE 2LT4A 4M7DF 5LL6S 1YITT 1Q86R 1PD0A 5D7UA 5FLXE 1WHJA 1X43A 5HKCA 1M1KU 3OYBA 2RM4A 2A36A 1SSHA 4JJBA 3SHWA 3CC2T 4Z02A 3GP8A 1S3SA 2DL5A 3M59A 5HK3A 2KRNA 4K11A 5DYIA 2E6ZA 4C5EA 1K0XA 2VV5A 1HSQA 4GBQA 4L59A 3QJYA 5C18A 2O9SA 4HVWA 2DD4A 1ZC1A 4J6WA 1Y71A 3GOXA 1K73R 3OYMA 2GGRA 1X6OA 5CCBA 3UATA 4NOYA 2KR3A 2XKOC 1JRIA 1T3LA 1G3SA 2O4XA 4CC7A 1W2BP 3CEYA 1QCOA 4F7UA 1G3WA 2BTTA 2VASA 1FMVA 2RHUA 2CUBA 3RR6A 2F2VA 3SD4A 2R5AA 2D8HA 4C92A 3FJPA 3PIPA 1WXBA 1WHHA 4BUGA 2EGEA 3ZJTA 4M7AB 1RUWA 3NPFA 2P0KA 4JJNK 4RTXA 1VQ8Q 2RHZA 1D1CA 5A0GA 1YJNA 2H3JA 2QDLA 4VUBA 4E47A 2CGHA 2FHDA 2QXFA 1WFWA 4EMHA 5GAN5 5IXFA 1S1NA 3EGXB 4F7UF 1BB9A 2VYTA 2R58A 4KH0B 4II1A 2F5TX 4C0DC 4C92F 2OAWA 2RHXA 3QZ5B 2RQWA 2JTMA 2EJ9A 4NL2A 4A4GA 4OMNA 3P8DA 4BE1A 4C5IA 5CO7A 3MP1A 3H41A 1PRMC 4RTZA 1YITQ 3JCMQ 1D1BA 2E12A 1Z9ZA 2DXTA 2RN8A 1VYUA 3EG2A 3CCET 4N4GA 2XDDA 1B7TA 2RI2A 1I8FA 2DM1A 3CC2Q 3O5ZA 4A4HA 3CMEA 1E6HA 3QIIA 4M78B 3WVDB 3NTHA 4LNPA 4M77D 4LUDA 2J6FA 2JT4A 2OTJA 1Q95G 1N9SA 5DY9A 4FL6A 2CP7A 3A8OB 4PNOA 1YJ9Q 5EC7A 3UA7A 4J9CA 8AT1B 1YITA 3L2ZA 1OI1A 3DLMA 1K8AR 3G4ST 2OJ2A 4RUGA 2BIVA 4LN2A 4HT9A 4F7UE 1SEMA 3QSUA 4IUTA 4ZTFA 1GFCA 4M75A 4AFSC 1ZX6A 3G7ZA 1TU0B 1SRMA 2ZAEA 3BDUA 2GFAA 1QCNA 5GAMd 2LVMA 4LXCA 4F16A 1KJWA 2BZXA 2XMFA 5LJ3f 1G83A 2KRMA 4KUIA 2RQRA 4J9EA 2RI5A 2V1RA 2HCKA 2SEMA 2L89A 1TUDA 3JCMg 2JN0A 1QKWA 4C8QF 2CKKA 3ZJUA 1TXQA 1U1SA 2LQ8A 2QI2A 2XHCA 1AT1B 2L3SA 1RACB 2ED0A 3U23A 2DL3A 1PKSA 2RJEA 3V7RA 3MCAB 3VYHB 3OYLA 3CF2A 4KDIA 2KI7A 2QEXT 1ZBXA 4PJOC 2ZPEB 4F04B 2P0PA 2EQUA 4FYXB 2NYSA 2DD5A 3CPWS 4PK4A 3OW2S 4AQ7A 2DXCA 4ELYC 5LJ3h 3EHRA 2MK5A 4QQDA 1KQ2A 4MZTA 1M1GA 2KAFA 3QYGB 2RK1A 3LYIA 3VKIA 3EFOB 1B34A 4DA4A 5FTLA 2Y4YA 5GMKe 1QVFS 2O88A 2RPNA 2KDSA 3QJ6A 2NUZA 3OA6A 1UECA 4KT0E 4BI3A 4A63B 2X3WD 1AWOA 2MWPA 5GAMf 2JS2A 1ZSGA 4ATOA 4GLKA 4EIKA 1WDXA 2J05A 1AZEA 1BCMA 4ZNXA 3QDFA 1ZLMA 1X2QA 4OMFB 1KIKA 1IB8A 1K1ZA 1WIEA 1O54A 2A37A 2EQIA 2GQIA 4DBQA 1QWEA 4D6WA 1Y0MA 3A8MB 4M75E 3CD6T 2MAMA 4FU6A 2LW6A 2QQ9A 4X34A 1M9SA 4M78C 4J9GA 2M0OA 1ZA2B 1WJRA 3N5BB 1TSFA 1WZOA 3CCEA 2KE9A 2J06A 3C0CA 1PD1A 1WHKA 1MV0B 1D3BB 1QCFA 2XG8D 3LH0A 5KYUB 4BY6C 5GAMh 2JZ2A 1MMGA 1VQMT 2L3PA 3D7SB 1K9MR 2KRSA 1NYGA 3FB9A 2KBTA 4J9DA 1D0ZA 2RI3A 1M4ZA 3OBWA 1ZA1B 3DB4A 1O75A 2DMOA 3GNGA 3ZJVA 3PGGA 1U3OA 5HCKA 3TREA 1WA7A 3G4SA 4ZN1A 4FCYA 1YBYA 2P4RA 2D0NA 3QHSA 4V2SA 5FRNA 1GBQA 5LJ3g 2RA2A 4J6XA 2GCXA 4B9WA 2QEXQ 3JB9H 1VQOQ 1QP3A 4O6JA 3QPHA 2CH4A 4E7KA 2BUDA 5GAN8 1LNXA 2XI9A 4M75C 1YIJQ 1TOVA 2COWA 5LJ3j 2WSEE 1AEYA 1O9SA 2GFUA 3M56A 2XU8A 2ZPHB 3PMTA 1SG5A 2J6OA 5LJ5e 1IXDA 1QWFA
chains in the Genus database with same CATH topology
1Q82C 1YHQT 4X9CA 4MDWA 2E6NA 3MP8A 1UGQB 2X4WA 4M75D 3V8KA 3VUBA 4DOVA 4ZGJB 3FPRA 4BACA 2LRQA 3HFOA 2QEXA 2XDBA 5AYFA 3URGA 3SFMA 4XTWA 2RK2A 3L2QA 3CXCA 3RKYA 4C92C 1VQ5A 4C0DB 1W2BA 3VUZA 2LTOA 2K5LA 3JCMP 3CBOA 4OVAA 4Q5WA 2FVUA 4IUVA 3OYCA 1BI2A 5EG2A 4BI8B 5CKDA 3CCSA 2MM0A 3M53A 3T9NA 3OYNA 4M78A 1VQ6T 3F70A 1VQPA 1UGRB 1YJWA 3FIFA 4C0ZA 2VGNA 4BE2A 2RJFA 4ME7A 2QQSA 3GF5A 3ASKA 2L3RA 2FYKA 4C8QE 5GAN4 3HL8A 2KSSA 3CMET 1FWZA 3EFRA 3JCMW 2EJFA 2DJZA 4M7DC 4JDSA 4C92D 5CCAA 1K9MC 1GXIE 2MF2A 3HRUA 3OY9A 3L2VA 3OS1A 1K8AU 3JB9J 1BIBA 1KD1U 1VQ7A 3UWNA 2X35A 1KQ1A 4HCZA 5CK9A 3JCMJ 5GAMg 2EQJA 2Y90A 5GAOq 4C8QG 2QA4T 1K73U 4MMLA 2JOYA 4RKUE 2OTJT 3LLRA 4HKEA 3MEWA 5J26A 4B9XA 4IKFA 3HSBA 5DLQE 4DOWA 3CCVA 2LT4A 3LW5E 3TU4K 4M7DF 5CCXA 2V8JA 3M4GA 2KQWA 2DXBA 3CPWA 1B34B 3QKJA 5LL6S 5LJ3e 5GANg 5GAOr 1YITT 4KDLA 4FIBA 3OW2A 4LD6A 5J39A 1RL2A 3Q1JA 1M90C 5FLXE 4M7DD 4PLLA 5HKCA 1M1KU 1U8RA 3OYBA 2GQVA 2HNIA 2RM4A 3H6ZA 2AHJB 3VJPA 2HQXA 1UB4A 2DEQA 3HHTB 3L2UA 4XU1A 2WSCE 3PMIA 3V7CA 4KLNA 3CC2T 2I2LA 3CMAT 4Z02A 5GAOl 3C94A 4M78F 3GP8A 5GAMj 3S3NA 4PJOE 2EWNA 3HU1A 3JCMX 1S3SA 4XAXB 1Q7YC 3J80E 4M7AE 2E64A 4QQ6A 3I56T 1BKBA 3M59A 5HK3A 5GAOn 2Q1AX 1VQNT 1WNLA 4N4IA 5A2QE 4BDZA 5DYIA 3QQ8A 2JTFA 1QCSA 4KULA 4PJOG 5GANj 2E6ZA 2RH2A 5CAIA 1QVFA 4OB0B 3CD6A 1UEBA 4C5EA 1R8OB 2E41A 2EKOA 2VV5A 3QXEB 5FROA 3S3OA 3FPUA 5FTKA 4L59A 4BB7A 1BI3A 2PU9B 3QJYA 1YI2T 5C18A 1BI1A 3HFNA 1QVPA 2DD4A 4XU0A 1ZC1A 4IUQA 2B25A 1PSEA 1Y71A 2QQAA 4J6WA 3GOXA 1VQLA 3QG1A 3E1SA 4QW2A 3HU2A 2VC8A 5CQYA 3OYMA 4C8QB 4E7HA 1X6OA 5CCBA 3MEVA 3L1AA 2OTLT 2OAUA 3HU3A 2EYQA 2MWOA 3DKMA 4NOYA 4NS5A 1JJ2A 1YCYA 1WJSA 3BW1A 2XKOC 3LWHA 4FSXA 3FC3A 3H8ZA 1JRIA 2O4XA 1G3SA 2X4XA 3UPUA 4M77E 1OZ2A 2CZ6B 5FTNA 5C6SA 2E5QA 4A53A 3L2WA 2EJGA 3OYEA 3MO8A 2FB7A 3CEYA 4BI4A 4F7UA 2PVGB 1G3WA 4JRIA 3SWNA 2DTOA 1CR5A 2RHUA 1G3YA 1P92A 2IVWA 3OYYA 5GAOm 5B6CA 1WGSA 2M9UA 2R5AA 3SD4A 3CCMT 3CC7T 1FXXA 4ZN3A 5GMKh 4QQGA 2PWYA 2E70A 4C92A 4EMKB 1XNIA 2V8KA 3FJPA 2JVVA 3PIPA 2JNGA 2O01E 1PSFA 2KK4A 5GAMe 5GAOp 2XICA 3C12A 3KBGA 2K57A 5C0MA 3JB9D 3QC8A 2XIDA 3G71T 5A0DA 1WPYA 4BUGA 3QYHB 3VU3C 3CCJT 5FRMA 4M7AB 3ZJTA 3BFMA 3OBYA 3OYAA 2ZZDA 1Y07A 2K2VA 2E65A 2P0KA 4JJNK 3S6WA 2RHZA 3X24B 2QTXA 4E7LA 1KC8U 5FU7B 5GANe 4M75F 4M78E 1NJIC 5A0GA 1YJNA 4RG8A 2LT1A 2H3JA 2K5FA 1QVGS 1VQ8T 5D6YA 3DB3A 5IN1A 5GAN7 4M7DA 4M7AC 4VUBA 1G3TA 4J7IA 4E47A 1Q86C 1VQ5T 2R5MA 2CGHA 3OYDA 4M78G 2B8AA 4HCCA 2LQKA 2FHDA 2QXFA 3MHXA 3OMCA 1VQOA 5FU7C 1JB0E 2VXEA 2WSFE 4EMHA 5GAN5 3G6ET 1AHJB 2MM2A 4J7FA 1U1TA 1UGSB 2DVEA 4AS1A 4GY5A 4F7UF 1Q82U 3RMSA 4HT8A 1KHCA 1VQPT 3CCUT 3FEOA 3KUFA 3QWZA 4KODA 3C95A 2VYTA 3JCMd 4FM4B 1YIJA 5IAYA 2R58A 3GLXA 4II1A 2F5TX 2DZ9A 5HK0A 2ZPBB 5GMKi 1VUBA 4C0DC 4C92F 3CCQA 1VQ4A 2RHXA 3J81E 3QZ5B 4OB2B 5D6WA 2JTMA 2CS7A 2EJ9A 4NL2A 4P5NA 4A4GA 2ZPIB 4EDUA 1MGQA 3P8DA 4M77B 5GAN3 4BE1A 4C5IA 2L8DA 4RV0A 5CO7A 1VQKT 3WXMB 2MMPA 3MP1A 4WF2A 4IURA 2DIQA 3X25B 3CCLT 2YRVA 1JBMA 2A3LA 2RD1A 4ZTJA 2D6FA 1G5VA 2HD0A 4XQ3A 4M77C 5A0LA 3JCMQ 2F69A 5CKBA 2P0QA 3JAME 2E12A 3EAEA 1D3BA 1S72T 2DXTA 3RKWA 3PT9A 4JUVA 1K9MU 5DYGA 3CCET 4N4GA 2EIFA 4XTVA 4BE0A 1VQ6A 2LNVA 2DKGA 3OSVA 4C5GA 2XDDA 3V8JA 2RI2A 1I8FA 3R6OA 4A4HA 2K4YA 4PLIA 4J8OA 3A8LB 3CMEA 5CKFA 1N27A 3QO3A 3QIIA 4M78B 5EPPA 3WVDB 3L42A 4IUUA 4JRPA 3NTHA 1M1FA 2Q18X 3QQ7A 2Q1DX 2JV2A 3I55T 1QVGA 3META 1Y96B 4M77D 4Y28E 2CYZB 4KO8A 3PFSA 2QA4A 1M90U 2OTJA 4XK8E 1N9SA 3JSCA 5DY9A 4FL6A 1NPRA 3A8OB 4PNOA 2DO3A 3HKSA 2E10A 2RO0A 3JCMV 1YITA 4M75G 1VQ9T 2K3YA 2VUBA 2VGMA 3RESA 3KXTA 3L2ZA 1H641 2YLBA 5GAN2 1YJ9T 3ME9A 1OI1A 3DLMA 2A7YA 2BKDN 1Q7YU 5KE2A 3G4ST 3OQ5A 3SDZA 1OYXA 2BIVA 2QQBA 5CKHA 1R7RA 4HT9A 1XTDA 2K3XA 3QZ9B 4F7UE 4R56A 3OYJA 4OB3B 1IREB 2Y4XA 3QSUA 4IUTA 1EIFA 4RCBA 3CMAA 4ZTFA 2CZ0B 3HP9A 4M75A 5J3BA 4BDYA 3G7ZA 2PVOB 4J83A 3I56A 4F7UG 1I4K1 4A4FA 4HCBA 1QDNA 3BDUA 2M16A 2GFAA 1VQNA 1VQMA 2L5QA 3M58A 1XOVA 2CZ7B 3O8VA 3M57A 4C0GA 1OZ3A 5GLFA 3JCMf 2JUFA 5GAMd 2LVMA 4C8QC 1CZ4A 1KQSS 3CCRT 1MHNA 3JCMb 2EAYA 3PTAA 4C92G 3GPLA 3OS5A 5LJ3f 1KG1A 3LHDA 5KCHA 1W2BS 3CBMA 4KUIA 3ER0A 3RMQA 3PNWC 1YI2A 1SSFA 2RI5A 5GMKj 3DLLA 3CC4T 3OSSC 5LJ5d 2L89A 1HXDA 4OGEA 3JCMg 3TEEA 4JRQA 1H3ZA 2JN0A 3E19A 4C8QF 4M7DE 5EQJB 2RJCA 5I2SA 3JB9F 5ERGB 2CKKA 3LWIA 3X28B 3ZJUA 1HK9A 1U1SA 2RB6A 2OTLA 2LQ8A 3JB9I 2QI2A 4C8QD 2LC4A 1Q81C 1VIEA 5CR2A 1NZ9A 2XHCA 4JS5A 1QP2A 4JS4A 4PJOB 4M7DG 2F5KA 1N6AA 3E9FA 3UT1A 1YJNT 4ZGDB 2RJEA 1BIAA 3MP6A 3M4YA 3V7RA 5CD1A 2RHYA 4EMKC 3FPTA 3MCAB 3VYHB 3OYLA 3CF2A 4KDIA 2EQKA 4OF1A 5IT9E 4C0FA 1N8RC 2QEXT 4E7IA 1ZBXA 4CRIA 2ZPEB 4PJOC 2P0PA 4MZPA 3L2RA 2EQUA 2O4XB 3X26B 4A4KA 2DD5A 2D0QB 1N9RA 4XTZA 1KHIA 3CC7A 2LDMA 3CPWS 2XD0A 3JCMh 4QVZA 3CBPA 4XU3A 3OW2S 3SWNB 3ZFJA 3A8HB 3CCST 2Q19X 4JRKA 4MDXA 4AQ7A 2DXCA 2YHTA 4ELYC 3GIBA 5GAN6 4M77A 5LJ3h 1XQHA 2DZCA 5D6XA 4QVCA 2DTIA 3PIOA 3G71A 1YJWT 4M7AF 2PUOB 2ZPGB 5CKEA 1LJOA 4QQDA 3OYIA 1Q86U 4PJOD 3JCMc 2P4TA 4OP0A 1KQ2A 3SWNC 2ZCFB 3OS0A 4M7AD 1M1GA 2KAFA 4MZTA 3JRZA 3QYGB 5LJ3d 2NLUA 4JLIA 2RK1A 3LYIA 1VQ7T 1KQSA 1YHQA 4N0AC 5FTJA 1VQ8A 2R57A 1LOJA 1W4SA 3OYHA 3VKIA 2YUJA 3NTKA 1CZ5A 4KBMB 1B34A 4N4HA 4DA4A 2Y4YA 4PL6A 5GMKe 3SB2A 4RMOA 1BYMA 5FTLA 2QDYB 3GNFB 3FDRA 3VV0A 1QVFS 4A54A 2E1HA 2KDSA 3CCVT 3QJ6A 1K8AC 5KH6A 5HY6A 3G6EA 1KD1C 3OA6A 3NTIA 4M7DB 2GF7A 4KT0E 4BI3A 2LX9A 2PVDB 3MEAA 3ZBDA 2VXFA 3A8GB 1K73C 1E32A 5CIUA 2MWPA 5GAMf 3CCUA 1I9GA 3ZGZA 3LGAA 1Y96A 4OGCA 4ATOA 1QW1A 3LGFA 4GLKA 2DAQA 4L5GA 4XTUA 3OYGA 2HQEA 1WLFA 2K5IA 4C5HA 3BDLA 4M77F 5LJ5f 4OMFB 2WACA 5GANf 1JJ2S 4LDUA 3UDCA 3OYFA 4UC4A 1M1KC 1VQKA 4E7JA 3LX7A 2ZGWA 2X4JA 4EMGA 3JB9G 3RUXA 3JCMe 1O54A 1X01A 2D9TA 4D6WA 3CCLA 4FT4A 3A8MB 5FTMA 2CZ1B 4M75E 1M8VA 3CD6T 2MAMA 4FU6A 3V8LA 1ZHIA 2QQ9A 2MI6A 3A5ZB 1M9SA 4X34A 4LDYA 4RCCA 4M78C 5L8RE 5LJ5g 2DK3A 5FU6B 2M0OA 3E9GA 1S72A 1WJRA 3N5BB 4C8QA 4BY6B 4FT2A 4TVRA 4JLGA 1M5Q1 2KY9A 3LGLA 3CCEA 1I5LA 3QDRB 3FRNA 2Q1CX 1I81A 1VQLT 1D3BB 1NPPA 5GMKl 5FU6C 4YTLA 2RHIA 2M1HA 2XG8D 4X9DA 3LH0A 3OMGA 2EQMA 5CVIA 3NFCA 4XTXA 3RIRA 4BY6C 3CC2A 1VIFA 3J7AF 5M9OA 2DXUA 5GAMh 3I55A 4M78D 2JZ2A 5KCOA 1VQMT 4XTYA 4A4EA 5I21A 4ARIA 1BI0A 2RJDA 4NL3A 2QQRA 4MZMA 4Y91A 4C92E 1DJ7B 3HRSA 5LJ5j 3MB5A 4O5VA 4M7AG 3FB9A 3QBYA 2DTHA 5CQXA 2RI3A 1M4ZA 2XK0A 3VYGA 5LJ5h 3P8HA 2KMTA 4BD3A 3OBWA 4LDVA 4CI0C 5GANh 4EMKA 3M54A 4QVDA 3DB4A 1RI0A 1O75A 3GNGA 1VQ9A 3CXCS 3HRTA 3TCJA 3ZJVA 4IUPA 4DQ2A 3PGGA 1FX7A 1YJ9A 3AHUA 4PJOA 3TREA 2EFIA 4J6YA 1WQWA 4ZN1A 5GANd 3G4SA 1WQ7A 4M7AA 4ARCA 3CPFA 3C4SA 2PJHB 2G3RA 1YBYA 3QHSA 4ZGEB 3RERA 1X75C 4V2SA 4MMKA 5FRNA 5LJ3g 2RA2A 2PQWA 2DIGA 1Y7XA 4J6XA 3BQBA 2GCXA 2YVLA 1UGPB 2IG0A 3EFSA 2HAXA 4LD9K 4B9WA 4M75B 4LDXA 4CQNA 2HBPA 3OYKA 4XU2A 3WVEB 4LDWA 3CCRA 2DPPB 3JB9H 1WJQA 5GMKm 3M5AA 1QP3A 5C1BA 3QUIA 3QPHA 4O6JA 4RG2A 3RKXA 2X4YA 3M9QA 5DM7R 4E7KA 4N0AA 4M77G 1KC8C 2LCLA 2BUDA 1VQOT 5GAN8 1LNXA 2PUKB 1Q81U 4L6V5 3CC4A 3MEUA 2XI9A 1TH7A 2ZPFB 1ZQ1A 4M75C 5I2MA 3FLGA 3X20B 2FL7A 3CCMA 2LW6A 1IZ6A 2XDPA 3OB9A 2C06A 4ELZC 3P8BB 3HPWA 3M55A 4OB1B 4KUDK 3S3MA 4F7UB 3TIWA 2KVQG 1V29B 5LJ3j 2WSEE 4J5YA 3ZEHA 1O9SA 2GFUA 3M56A 1NJIU 4HA8A 5DLOA 3INZA 4PKCC 1YIJT 4R55A 4PJOF 3BY7A 1N8RU 2XU8A 3V7SA 2ZPHB 2YLCA 3PMTA 5KE3A 3OS2A 3CCJA 1VQ4T 3CCQT 2V8IA 5LJ5e 2LCCA 4C92B 1NE8A 4EPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGF A;  3OYE A;  3MO8 A;  3CEY A;  3ME9 A;  1OI1 A;  2DAQ A;  3DLM A;  2E6N A;  2BKD N;  3OYG A;  2HQE A;  3MP8 A;  2RHU A;  2X4W A;  3OQ5 A;  2BIV A;  1OYX A;  5KE2 A;  1WGS A;  2K3X A;  2R5A A;  3SD4 A;  3BDL A;  4C5H A;  2LRQ A;  3OYJ A;  2WAC A;  4BAC A;  3OYF A;  4UC4 A;  4IUT A;  3L2Q A;  4QQG A;  4E7J A;  3LX7 A;  4ZTF A;  1XNI A;  2D9T A;  4BDY A;  2LTO A;  4OVA A;  4Q5W A;  4IUV A;  3OYC A;  5C0M A;  4A4F A;  2M16 A;  4FU6 A;  2GFA A;  5FRM A;  4X34 A;  3O8V A;  3OYN A;  1OZ3 A;  3OYA A;  2M0O A;  2LVM A;  3E9G A;  2P0K A;  3F70 A;  1WJR A;  3S6W A;  2RHZ A;  4E7L A;  1MHN A;  4BE2 A;  2RJF A;  2QQS A;  3LGL A;  3ASK A;  2L3R A;  5KCH A;  3PNW C;  5D6Y A;  1SSF A;  2RI5 A;  3DB3 A;  5IN1 A;  3OY9 A;  3L2V A;  3OS1 A;  2L89 A;  2R5M A;  3UWN A;  2RHI A;  3OYD A;  2M1H A;  2X35 A;  4HCZ A;  2B8A A;  1H3Z A;  3LH0 A;  2FHD A;  2EQM A;  3OMG A;  3OMC A;  2EQJ A;  2RJC A;  2CKK A;  5M9O A;  3LLR A;  3MEW A;  5J26 A;  4B9X A;  2JZ2 A;  5KCO A;  4IKF A;  4A4E A;  2RJD A;  2QQR A;  4GY5 A;  1KHC A;  3FEO A;  3KUF A;  2F5K A;  3QKJ A;  2VYT A;  3E9F A;  3UT1 A;  3QBY A;  4LD6 A;  5IAY A;  5J39 A;  2R58 A;  2RI3 A;  2RJE A;  2XK0 A;  3MP6 A;  3P8H A;  3Q1J A;  4II1 A;  4BD3 A;  2RHY A;  4PLL A;  3OYL A;  3OYB A;  2RHX A;  3DB4 A;  1RI0 A;  2EQK A;  5D6W A;  3H6Z A;  2HQX A;  4IUP A;  4A4G A;  4EDU A;  3L2U A;  3P8D A;  4E7I A;  4CRI A;  4BE1 A;  3PMI A;  4C5I A;  2L8D A;  2EFI A;  3L2R A;  2EQU A;  2O4X B;  3MP1 A;  4Z02 A;  3C4S A;  4IUR A;  3S3N A;  2G3R A;  2DIQ A;  2LDM A;  4QVZ A;  4QQ6 A;  2YRV A;  4ZTJ A;  5FRN A;  1G5V A;  4N4I A;  2PQW A;  4BDZ A;  2DIG A;  2JTF A;  3EAE A;  5D6X A;  2IG0 A;  4B9W A;  4C5E A;  4QQD A;  3OYI A;  4N4G A;  4BE0 A;  2EKO A;  3OYK A;  5FRO A;  4C5G A;  3S3O A;  4L59 A;  2RI2 A;  3OS0 A;  1WJQ A;  4A4H A;  2NLU A;  4PLI A;  3LYI A;  4RG2 A;  2X4Y A;  3M9Q A;  4IUQ A;  1N27 A;  3QII A;  4E7K A;  3GOX A;  2R57 A;  2BUD A;  3L42 A;  4QW2 A;  3OYH A;  3OYM A;  3NTK A;  4IUU A;  3NTH A;  3MEU A;  4N4H A;  4PL6 A;  3MEV A;  4E7H A;  3FLG A;  3MET A;  2XDP A;  3FDR A;  3OB9 A;  3PFS A;  3S3M A;  3QJ6 A;  2MWO A;  4NS5 A;  5KH6 A;  1WJS A;  3ZEH A;  3OA6 A;  3NTI A;  2GF7 A;  2GFU A;  3FC3 A;  4FL6 A;  3MEA A;  3H8Z A;  5CIU A;  2MWP A;  2O4X A;  3PMT A;  5KE3 A;  3OS2 A;  2RO0 A;  2LCC A;  2X4X A;  1OZ2 A;  5C6S A;  2E5Q A;  2K3Y A;  3L2W A; 
#chains in the Genus database with same CATH topology
 1Q82 C;  1YHQ T;  4X9C A;  4ZGJ B;  1UDL A;  4BAC A;  1M2V B;  2QEX A;  4ANJ A;  2V1Q A;  1MUZ A;  1VQ5 A;  5KYW B;  1W2B A;  1X27 A;  2K5L A;  4OVA A;  3JCM P;  4Q5W A;  2FVU A;  4IUV A;  4OMO A;  1VQ6 Q;  5CKD A;  2MM0 A;  1K4U S;  1I5O B;  3OYN A;  4C0Z A;  4BE2 A;  2YRD A;  2RJF A;  4ME7 A;  3HL8 A;  1FWZ A;  1Q81 R;  4C92 D;  5B6C A;  3L2V A;  2HEQ A;  2MOX A;  2X35 A;  2M02 A;  5GAM g;  2EQJ A;  2Y90 A;  5GAO q;  3CD6 Q;  2JOY A;  1NJI R;  3LLR A;  2C0O A;  1N8R R;  3TU4 K;  5CCX A;  5GAO r;  4FIB A;  5J39 A;  1M90 C;  4JJD A;  4PLL A;  2KT8 A;  2AHJ B;  1JJ2 P;  2PNI A;  1X69 A;  1UB4 A;  4HCK A;  3L2U A;  4XU1 A;  4KLN A;  3PMI A;  4RTV A;  5GAO l;  4DBF A;  4M4Z A;  5GAM j;  1VQM Q;  2YUP A;  4QQ6 A;  1A0N B;  5GAO n;  4DEX A;  3QQ8 A;  4KUL A;  4PJO G;  3CD6 A;  5KYN A;  2RH2 A;  1OOT A;  1YI2 Q;  1VA7 A;  2H3E B;  2E41 A;  4BB7 A;  1WHM A;  1BI3 A;  2ED1 A;  2PU9 B;  3HFN A;  1QVP A;  2OTL Q;  4IUQ A;  3E1S A;  2VC8 A;  1ABQ A;  3MEV A;  3L1A A;  1UJ0 A;  2MWO A;  3DKM A;  4NS5 A;  2JMC A;  4FSX A;  3FC3 A;  3H8Z A;  4AG1 C;  3M0U A;  4M77 E;  1PC0 A;  2OX7 A;  2DA9 A;  1TUG B;  3TSW A;  2EJG A;  3MO8 A;  2FB7 A;  1ACM B;  2PVG B;  1P92 A;  5GAO m;  2DJQ A;  3PVQ A;  1WGS A;  2EPD A;  1OPK A;  3CCM T;  3CC7 T;  2C0T A;  1CKA A;  1FXX A;  4ZN3 A;  1SPK A;  3G71 Q;  1XNI A;  2V8K A;  3M0P A;  2JNG A;  2O01 E;  3VRY A;  3C12 A;  1OU9 A;  1WPY A;  4GLM A;  3QYH B;  4E6R A;  3BFM A;  1YHQ Q;  1Y07 A;  2K2V A;  2E65 A;  5KYX A;  4E7L A;  5GAN e;  2RMO A;  2LT1 A;  1RAD B;  1VQ8 T;  3DB3 A;  4M7D A;  2DFU A;  1Q86 C;  4JZ4 A;  3CPW P;  4M78 G;  1UG1 A;  5FU7 C;  2VXE A;  4J7F A;  1UGS B;  2DL8 A;  2DVE A;  1T3S A;  1GL5 A;  2F1L A;  3RMS A;  1Q82 U;  1KHC A;  1VQP T;  3QWZ A;  3KUF A;  3C95 A;  3JCM d;  3REA B;  5HK0 A;  2DZ9 A;  2ZPB B;  2LJ3 A;  1BU1 A;  3J81 E;  5D6W A;  2C0I A;  2CS7 A;  4P5N A;  3NHN A;  4RV0 A;  2KT1 A;  1QVF P;  4WF2 A;  4IUR A;  3M0Q A;  4M77 C;  5A0L A;  2F69 A;  2DEU A;  3RKW A;  2GNC A;  5DYG A;  2KXC A;  1G2B A;  2LNV A;  2DKG A;  3OSV A;  2BE7 D;  3V8J A;  2K4Y A;  4DBR A;  2LQW A;  5CKF A;  5EPP A;  1JXM A;  3ULR B;  2MIO A;  4JRP A;  3QQ7 A;  2JV2 A;  3I55 T;  3MET A;  1M90 U;  4FSS A;  3JSC A;  1VQ9 Q;  3HKS A;  2E10 A;  2ABL A;  2LP5 A;  5AT1 B;  2BE9 B;  4M75 G;  3RES A;  2YDL A;  2JM8 A;  1YJ9 T;  1RAF B;  2HKQ B;  2O31 A;  1OYX A;  5CKH A;  2K3X A;  3QZ9 B;  4OB3 B;  1IRE B;  3R6N A;  2CZ0 B;  3HP9 A;  2CP2 A;  2QK0 A;  5J3B A;  2B86 A;  2PVO B;  5IHN A;  2EYY A;  4A4F A;  1QDN A;  2CZ7 B;  1OZ3 A;  4RTW A;  3JCM f;  2VB6 A;  2QAZ A;  2DL7 A;  3OS5 A;  3CCM Q;  3CC7 Q;  4KGZ B;  5KCH A;  3DLL A;  1GCQ C;  3E2U A;  1HXD A;  2VVK A;  1H3Z A;  1Y57 A;  4M7D E;  2D8J A;  5ERG B;  3JB9 F;  2L3Q A;  1M3B A;  2KEA A;  1QCS A;  1NZ9 A;  4PJO B;  1YNZ A;  2F5K A;  3E9F A;  4ZGD B;  1NEB A;  5CD1 A;  2EQK A;  2FRW A;  3TQ7 P;  5IT9 E;  3EGX A;  4E7I A;  3L2R A;  2O4X B;  3X26 B;  4R0K A;  2NUP A;  3CC7 A;  2YWW A;  1UGV A;  4D8K A;  3JCM h;  2ECZ A;  4QVZ A;  2K3B A;  1VQP Q;  3A8H B;  3CCS T;  5GAN 6;  1RAH B;  2KYM A;  1X2K A;  1XQH A;  5D6X A;  1YJW T;  4M7A F;  2PUO B;  1LJO A;  2AZV A;  2VWF A;  3OYI A;  1Q86 U;  1QVG P;  3JCM c;  4OP0 A;  2ZCF B;  3EGU A;  5LJ3 d;  2K9G A;  4N0A C;  2D1X A;  1VQ8 A;  3OYH A;  2YUJ A;  3CCV Q;  1CZ5 A;  4N4H A;  1BYM A;  5FWB A;  3SB2 A;  3FDR A;  3VV0 A;  4A54 A;  2E1H A;  1K8A C;  2VKN A;  1KD1 C;  3I5S A;  2GF7 A;  3NMZ C;  2LJ0 A;  2PVD B;  1TUC A;  3RDV A;  3LGA A;  1NYF A;  2RF0 A;  4OGC A;  1YP5 A;  3CQT A;  2DAQ A;  2HQH A;  2CT4 A;  3I55 Q;  4C5H A;  1SRL A;  1B07 A;  3BDL A;  1JJ2 S;  2GBQ A;  4LUE A;  4PFP A;  4EMG A;  1X01 A;  4FT4 A;  5FTM A;  2CZ1 B;  4JZ3 A;  1OU8 A;  3V8L A;  2MI6 A;  1WXT A;  1W6X A;  4C8Q A;  4BY6 B;  4TVR A;  1NBE B;  1JEG A;  2KY9 A;  1I5L A;  2AZS A;  2EKH A;  1VQL T;  5GMK l;  5FU6 C;  1ZSZ A;  4X9D A;  3OMG A;  1WYX A;  3RIR A;  3CC2 A;  1GBR A;  3I55 A;  4XTY A;  4Z8A A;  4NL3 A;  2COZ A;  2QQR A;  1UHF A;  4C92 E;  4O5V A;  3PE0 A;  2OI3 A;  5IXB A;  5FWC A;  4EMK A;  1G8X A;  3HRT A;  3TCJ A;  1FX7 A;  1YJ9 A;  4J9I A;  3AHU A;  2EFI A;  1WQW A;  1WQ7 A;  3CPF A;  2G3R A;  2AIR B;  1VOM A;  3RER A;  1SKU B;  2DE0 X;  1AWW A;  1YCS B;  4FW1 A;  3QWX X;  4OMP A;  2DYB A;  2CP5 A;  3VS5 A;  4M75 B;  2HBP A;  3OYK A;  4XU2 A;  3WVE B;  4LDW A;  4AG2 C;  4CC2 A;  1Q7Y R;  3A98 A;  1V76 A;  1QKX A;  5GMK m;  3QUI A;  4RG2 A;  3RKX A;  1M2O A;  1KC8 C;  4M77 G;  1VQO T;  4L6V 5;  5KYY A;  3CCS Q;  5I2M A;  3X20 B;  2FL7 A;  1IZ6 A;  1C6V X;  4ELZ C;  4OB1 B;  3TIW A;  2CP3 A;  2KVQ G;  1YJW Q;  1V29 B;  1VQ4 Q;  4J5Y A;  3CCQ Q;  1IHW A;  5DLO A;  3INZ A;  4PKC C;  1YIJ T;  2LMJ A;  2LCC A;  3KFV A;  2YRC A;  5L23 A;  1H92 A;  1EFN A;  1WLP B;  1UGQ B;  4RTT A;  2LRQ A;  3H0F A;  1M3C A;  1AWJ A;  2ROL A;  4C92 C;  2GTJ A;  3VUZ A;  2LTO A;  4E7Z A;  3CBO A;  3OYC A;  1BI2 A;  5EG2 A;  1M27 C;  1KFZ A;  3CCS A;  2M51 A;  3UF4 A;  1NM7 A;  1VQ6 T;  1YJW A;  3GF5 A;  2L3R A;  4C8Q E;  5GAN 4;  1ABO A;  3LH5 A;  2HSP A;  2QA4 Q;  1K9M C;  2MF2 A;  1K8A U;  3OS1 A;  1KD1 U;  3UWN A;  4F17 A;  1R77 A;  3TSZ A;  1TWB A;  3M4G A;  2PTK A;  3CPW A;  1B34 B;  4KDL A;  3OW2 A;  1RL2 A;  1VQL Q;  1D0X A;  4M7D D;  1WHG A;  1MMD A;  3SEM A;  2GQV A;  2HNI A;  3H6Z A;  3VJP A;  2HQX A;  1TG0 A;  1IRX A;  2WSC E;  2I2L A;  3C94 A;  2A0F B;  2EWN A;  4XAX B;  3J80 E;  2E64 A;  1E7O A;  1YN8 A;  1BKB A;  1VQN T;  2YUN A;  2EYZ A;  2JMA A;  5A2Q E;  4BDZ A;  1QVF A;  5CAI A;  1U5S A;  1UFF A;  1PM3 A;  1K9A A;  2EKO A;  4PJN A;  1YI2 T;  2HL5 C;  2QG9 B;  4FW2 A;  1PSE A;  2CP6 A;  2QQA A;  1VQL A;  3HU2 A;  4QW2 A;  5CQY A;  1W70 A;  2OTL T;  4E7S A;  2OAU A;  2JS0 A;  1YCY A;  1WJS A;  3BW1 A;  3LWH A;  2FO0 A;  2H8H A;  2MCN A;  2X4X A;  3UPU A;  5FTN A;  2CZ6 B;  2E5Q A;  3BE3 A;  3EG3 A;  3SWN A;  2DTO A;  2FPF A;  2M9U A;  4PFZ A;  5GMK h;  4QQG A;  1D1A A;  2JVV A;  4AFU C;  2P84 A;  1PSF A;  5GAO p;  3KBG A;  5C0M A;  3JB9 D;  3G71 T;  5A0D A;  5FRM A;  3VU3 C;  3CCJ T;  4PJJ A;  3OBY A;  1JU5 C;  2ZZD A;  1KC8 U;  3X24 B;  2QTX A;  4OMQ A;  5FU7 B;  4D8D A;  5KYW A;  1NJI C;  1RAA B;  1QVG S;  5D6Y A;  4J7I A;  2R5M A;  1LPL A;  3OYD A;  2RNA A;  2B8A A;  4HCC A;  2LQK A;  3MHX A;  3OMC A;  1VQO A;  1NEG A;  1PG5 B;  2WSF E;  3CCU Q;  3G6E T;  2JXB A;  2HL3 A;  4AS1 A;  4HT8 A;  4KGV B;  2F2X A;  2HBW A;  2FPE A;  4AMC A;  4FM4 B;  1YIJ A;  1M8M A;  5IAY A;  5GMK i;  2RQU A;  1VQK Q;  1OQK A;  2ZPI B;  4EDU A;  1MGQ A;  4M77 B;  3CCL Q;  3WXM B;  2MMP A;  1IO6 A;  4JJC A;  1RLP C;  2Z0W A;  5I11 A;  1JBM A;  2A3L A;  1G5V A;  3MPU B;  5CKB A;  3H9N A;  1S72 T;  3EAE A;  5I22 A;  1BK2 A;  4JUV A;  1K9M U;  2AKL A;  4XTV A;  3GBQ A;  2RQV A;  1VQ6 A;  4C5G A;  2JJ9 A;  3R6O A;  2COY A;  3A8L B;  3QO3 A;  3M0S A;  4AT1 B;  1AZG B;  4IUU A;  2IIM A;  2Q1D X;  3VS3 A;  1QVG A;  1VQN Q;  1Y96 B;  4Y28 E;  4KO8 A;  1Q82 R;  1YWO A;  4OML A;  4Z88 A;  2JW4 A;  2KRO A;  1NPR A;  2DO3 A;  2YXY A;  1VQ9 T;  2VGM A;  1SHF A;  1H64 1;  2YLB A;  3ME9 A;  2BKD N;  5KE2 A;  3OQ5 A;  1R7R A;  2QQB A;  2K6D A;  3OYJ A;  4R56 A;  1EIF A;  2DL4 A;  4BDY A;  2NUT A;  4J83 A;  4F7U G;  4HCB A;  4DBH A;  3CCR Q;  1EX4 A;  1VQN A;  3EG9 B;  1UTI A;  1VQM A;  2L5Q A;  3M58 A;  3O8V A;  3M57 A;  2FZC B;  2JUF A;  3JCM b;  1M1K R;  3PTA A;  2QGF B;  1VYT A;  4C92 G;  3CC4 Q;  2RQT A;  1KG1 A;  3LHD A;  3ER0 A;  1YI2 A;  1RLQ C;  5GMK j;  1BCO A;  4OGE A;  1NLP C;  3TEE A;  4JRQ A;  5EQJ B;  3E19 A;  1M90 R;  2RJC A;  5I2S A;  3LWI A;  3X28 B;  1C0M A;  1HK9 A;  2KYB A;  2RB6 A;  3CCJ Q;  2OTL A;  3JB9 I;  4C8Q D;  2LC4 A;  2K2M A;  5CR2 A;  1I0C A;  4JS4 A;  1QP2 A;  1N6A A;  3UT1 A;  1YJN T;  1T0H A;  3MP6 A;  1WHL A;  3NGP A;  2M0Y A;  4OF1 A;  1CKB A;  4C0F A;  4CRI A;  4MZP A;  1U06 A;  4A4K A;  3I35 A;  3G6E Q;  2D0Q B;  2EVR A;  4WCI A;  5GJV B;  1MMA A;  5ECA A;  3CBP A;  1OPL A;  1OV3 A;  3ZFJ A;  1T0J A;  2V26 A;  4MDX A;  3EGD B;  2DBK A;  3GIB A;  4PFO A;  1FMK A;  1IGU A;  1ZUK A;  3PIO A;  3G71 A;  5CKE A;  4PJM A;  1VQ7 Q;  3SWN C;  3OS0 A;  2KXD A;  4J9B A;  1XJW B;  3JRZ A;  1H3H A;  2L2P A;  3EHQ A;  1YHQ A;  5FTJ A;  2O2O A;  2R57 A;  3VS0 A;  1LOJ A;  5KYX B;  3NTK A;  4KBM B;  2LCS A;  4PL6 A;  4RMO A;  1X6B A;  3CCV T;  1WI7 A;  1S72 Q;  1BBZ A;  3G6E A;  4M7D B;  2LX9 A;  4ORZ A;  3MEA A;  2VXF A;  3A8G B;  2EYX A;  1K73 C;  5CIU A;  1E6G A;  1I9G A;  1UJY A;  1NG2 A;  1QMC A;  1EZZ B;  3LGF A;  2DVJ A;  4XTU A;  4L5G A;  2K5I A;  5GAN f;  2HSE B;  2EBP A;  2WAC A;  1ARK A;  4LDU A;  3UDC A;  4UC4 A;  3THK A;  3TVT A;  2ZGW A;  2X4J A;  4QT7 A;  3JCM e;  2D9T A;  3HU1 A;  1ZHI A;  4LDY A;  5L8R E;  5LJ5 g;  5FU6 B;  1MND A;  1ZUU A;  1S72 A;  2KGT A;  1QQJ A;  3VS4 A;  1MNE A;  4FT2 A;  1M5Q 1;  1RI9 A;  3FRN A;  1QLY A;  1I81 A;  2X3X D;  1NPP A;  2X51 A;  2YUQ A;  2FG0 A;  2RHI A;  2M1H A;  1PRL C;  5CVI A;  2EQM A;  4XTX A;  5IHK A;  4Y92 A;  3RNJ A;  3J7A F;  2J6K A;  4A4E A;  5I21 A;  2ATC B;  4MZM A;  5LJ5 j;  3HRS A;  1UHC A;  5CQX A;  2DYI A;  3VYG A;  5GAN h;  3P8H A;  2KMT A;  4BD3 A;  2K7A A;  4JPB W;  3M54 A;  1OUL A;  1VQ9 A;  4FYW B;  4PJO A;  1C1A A;  5IHI A;  4ARC A;  4M7A A;  1UE9 A;  2DIL A;  4ZGE B;  1X75 C;  2HMA A;  2PQW A;  1YJN Q;  3QWY A;  1Y7X A;  1KQS P;  3BQB A;  1ZBJ A;  2YVL A;  3AT1 B;  4X1V A;  2IG0 A;  4LD9 K;  4CQN A;  4RTY A;  3ZL7 C;  2DPP B;  1ZUY A;  3M0T A;  1WJQ A;  3HTR A;  3M5A A;  2DNU A;  2X4Y A;  4IIM A;  1HD3 A;  2LCL A;  5IH2 A;  2PUK B;  4AFQ C;  1ZQ1 A;  3CCM A;  2XDP A;  2C06 A;  3OB9 A;  3M55 A;  3S3M A;  4F7U B;  2SRC A;  3MJX A;  3ZEH A;  4E2F B;  1B3Q A;  4FYV B;  4PJO F;  3BY7 A;  2JTE A;  3V7S A;  2YLC A;  5KE3 A;  3OS2 A;  1VQ4 T;  3CCQ T;  4C92 B;  1NE8 A;  3VS6 A;  4EPC A;  2L0A A;  3VUB A;  1H8K A;  4HXJ A;  2XDB A;  5AYF A;  1YWP A;  1FYN A;  1TS9 A;  3L2Q A;  3IQL A;  3RKY A;  2FEI A;  4BI8 B;  4J9F A;  3T9N A;  3VS7 A;  2EYW A;  2NUP B;  4M78 A;  3CME Q;  7AT1 B;  1VQP A;  4F14 A;  5FW9 A;  2FRY A;  3FJ5 A;  2QQS A;  3EFR A;  1I1J A;  2E4H A;  2DJZ A;  2EJF A;  4JDS A;  4M7D C;  3OY9 A;  2OTJ Q;  2QAS A;  3JCM J;  1JQQ A;  1M3A A;  2E5K A;  2QA4 T;  1K73 U;  4MML A;  1GFD A;  4HKE A;  5J26 A;  2W0Z A;  3HSB A;  4DOW A;  3CCV A;  3LW5 E;  2V8J A;  2DBM A;  2KQW A;  2DXB A;  3QKJ A;  5LJ3 e;  5GAN g;  4LD6 A;  3Q1J A;  1U8R A;  1AD5 A;  1YFN A;  4LE9 A;  2DEQ A;  3HHT B;  3V7C A;  3CMA T;  4M78 F;  3S3N A;  4PJO E;  3JCM X;  1Q7Y C;  4M7A E;  3I56 T;  2Q1A X;  3EH2 A;  1WNL A;  4N4I A;  1UUE A;  2JTF A;  5GAN j;  4RTU A;  4OB0 B;  1UEB A;  1R8O B;  3QXE B;  5FRO A;  3S3O A;  3FPU A;  2MPX C;  5FTK A;  2MYS A;  1BI1 A;  2QTV A;  1PNJ A;  1KD1 R;  2DX1 A;  2K79 A;  4XU0 A;  2B25 A;  2CH4 W;  3QG1 A;  1W1F A;  2CRE A;  4C8Q B;  4E7H A;  3HU3 A;  2EYQ A;  1JJ2 A;  1GRI A;  3I9Q A;  1ZSZ B;  2G6F X;  1AVZ C;  2IPO B;  3CXC P;  1OZ2 A;  2LZ6 B;  5C6S A;  4A53 A;  3L2W A;  3OYE A;  2DF6 A;  4BI4 A;  2CDT A;  4JRI A;  1CR5 A;  1RAG B;  1G3Y A;  2IVW A;  3OYY A;  2LJ1 A;  1OX9 A;  1LVK A;  1CSK A;  2PWY A;  2E70 A;  4EMK B;  2A08 A;  1N5Z A;  5GAM e;  2KK4 A;  2XIC A;  2K57 A;  3QC8 A;  2XID A;  1K76 A;  3VRZ A;  4ESR A;  3EG1 A;  2EGC A;  2X9H A;  3OYA A;  2DET A;  3S6W A;  3EFO A;  2NWM A;  4M75 F;  4M78 E;  4RG8 A;  2K5F A;  5IN1 A;  5GAN 7;  4M7A C;  1G3T A;  1VQ5 T;  1JB0 E;  2DRK A;  1GCP A;  1AHJ B;  2MM2 A;  1AOJ A;  1U1T A;  4B6M A;  4GY5 A;  2CUD A;  1WXU A;  3CCU T;  3FEO A;  4J9H A;  4KOD A;  5KYY B;  1RAI B;  3GLX A;  1VQ4 A;  1VUB A;  3CCQ A;  4OB2 B;  3MKD A;  1Z9Q A;  1IHV A;  5GAN 3;  2L8D A;  1VQK T;  1FMW A;  2DIQ A;  3X25 B;  3CCL T;  1K0S A;  2YRV A;  2RD1 A;  4ZTJ A;  1X6G A;  2D6F A;  2HD0 A;  4XQ3 A;  3CCE Q;  1KC8 R;  2P0Q A;  3JAM E;  1D3B A;  3PT9 A;  2DER A;  2EIF A;  5KYU A;  4BE0 A;  3CMA Q;  4PJL A;  4PLI A;  4J8O A;  1D0Y A;  1N27 A;  1TTH B;  1SHG A;  3L42 A;  3I56 Q;  2Q18 X;  1M1F A;  2CYZ B;  3PFS A;  1HJD A;  2FZK B;  2QA4 A;  5GJW B;  4XK8 E;  1D09 B;  2QGG A;  2F2W A;  2RO0 A;  3G4S Q;  3JCM V;  2K3Y A;  2VUB A;  2CSI A;  3KXT A;  4CC3 A;  2YUO A;  5GAN 2;  2A7Y A;  1Q7Y U;  3SDZ A;  1XTD A;  2Y4X A;  4QKU A;  4RCB A;  3CMA A;  4OMM A;  3I56 A;  1I4K 1;  2M16 A;  1XOV A;  4C0G A;  5GLF A;  2PZ1 A;  2I0N A;  4C8Q C;  1CZ4 A;  1KQS S;  3CCR T;  1MHN A;  2EAY A;  1JXO A;  1PKT A;  3GPL A;  1V1C A;  1W2B S;  3CBM A;  3RMQ A;  3PNW C;  1SSF A;  1R0B G;  1OX8 A;  3RBB B;  3CC4 T;  3OSS C;  5LJ5 d;  1ZSZ C;  1OEB A;  2DLP A;  3JV3 A;  2CP0 A;  2EW3 A;  1M30 A;  3VS1 A;  4CC4 B;  2LNH B;  1Q81 C;  2CSQ A;  1VIE A;  4JS5 A;  4M7D G;  2ENM A;  1M2V A;  2ESW A;  4WTO B;  1BIA A;  2YT6 A;  2CT3 A;  2JM9 A;  3H0I A;  3M4Y A;  2RHY A;  4EMK C;  3FPT A;  1VQ5 Q;  1N8R C;  4HVU A;  4AFZ C;  1N9R A;  4XTZ A;  4KGX B;  1KHI A;  3I5R A;  1I07 A;  2LDM A;  4FYY B;  2XD0 A;  4XU3 A;  3REB B;  3SWN B;  1NLO C;  2Q19 X;  4JRK A;  2GTO A;  2YHT A;  4M77 A;  2DZC A;  4QVC A;  1JO8 A;  2DTI A;  4Z89 A;  2ZPG B;  4PJO D;  2P4T A;  4DEY A;  4M7A D;  4HVV A;  2AK5 A;  2NLU A;  4JLI A;  3A1P A;  1VQ7 T;  1KQS A;  1W4S A;  2QDY B;  3GNF B;  2KNB B;  2E3I A;  5KH6 A;  5HY6 A;  3NTI A;  3EG0 A;  3H0H A;  1WX6 A;  3ZBD A;  1E32 A;  2LQN A;  3ZGZ A;  3EH1 A;  3CCU A;  1IGQ A;  1Y96 A;  1QW1 A;  2BZY A;  3OYG A;  2HQE A;  1WLF A;  4M77 F;  5LJ5 f;  2HDA A;  3OYF A;  1M1K C;  1VQK A;  4E7J A;  3LX7 A;  3JB9 G;  3RUX A;  2A28 A;  3CCL A;  1PCX A;  1J3T A;  9ATC B;  1KK7 A;  3M0R A;  1M8V A;  3A5Z B;  4RCC A;  2DK3 A;  3G1J A;  3E9G A;  4JLG A;  3LGL A;  3UA6 A;  2LX7 A;  3QDR B;  2Q1C X;  2EGA A;  1F1B B;  3EG9 A;  1AWX A;  1GCQ A;  4YTL A;  2W10 A;  3NFC A;  1VIF A;  1PWT A;  5M9O A;  2AKK A;  2O9V A;  2DXU A;  4M78 D;  5KCO A;  4ARI A;  1BI0 A;  2RJD A;  1RAE B;  4Y91 A;  1DJ7 B;  3MB5 A;  4M7A G;  3QBY A;  2DTH A;  8ATC B;  2XK0 A;  5LJ5 h;  4CI0 C;  4LDV A;  3PVL A;  4QVD A;  1RI0 A;  2AT1 B;  3CXC S;  4IUP A;  4DQ2 A;  1MV3 A;  4J6Y A;  5GAN d;  1VYV A;  3C4S A;  2PJH B;  4MMK A;  4KRT A;  2DIG A;  1UGP B;  3EFS A;  2HAX A;  4LDX A;  2NUT B;  2YSQ A;  3CCR A;  5C1B A;  3VS2 A;  3EGD A;  4IIO A;  5DM7 R;  3M9Q A;  4N0A A;  2HZY A;  1Q81 U;  3CC4 A;  3MEU A;  1TH7 A;  2ZPF B;  3FLG A;  4KUD K;  3P8B B;  3HPW A;  1KSW A;  1NJI U;  4HA8 A;  4R55 A;  1N8R U;  2E3H A;  2BZ8 A;  1RAB B;  3CCJ A;  2V8I A;  4MDW A;  2E6N A;  3MP8 A;  3FPR A;  2X4W A;  4M75 D;  3V8K A;  4DOV A;  3HFO A;  2ROT A;  3URG A;  3OW2 P;  3SFM A;  4XTW A;  2RK2 A;  3CXC A;  4C0D B;  1PHT A;  3M53 A;  2FZG B;  1MMN A;  2J7I A;  3F70 A;  1R0C B;  1UGR B;  6AT1 B;  3FIF A;  2VGN A;  3ASK A;  2FYK A;  3CME T;  3JCM W;  1LCK A;  2KSS A;  2FPD A;  5CCA A;  1GXI E;  1HYO A;  3HRU A;  3JB9 J;  1BIB A;  1VQ7 A;  1KQ1 A;  4HCZ A;  5CK9 A;  2HKN A;  1SF9 A;  2DRM A;  4C8Q G;  2QYZ A;  4RKU E;  2OTJ T;  3MEW A;  4B9X A;  4IKF A;  4KH1 B;  5DLQ E;  2LT4 A;  4M7D F;  5LL6 S;  1YIT T;  1Q86 R;  1PD0 A;  5D7U A;  5FLX E;  1WHJ A;  1X43 A;  5HKC A;  1M1K U;  3OYB A;  2RM4 A;  2A36 A;  1SSH A;  4JJB A;  3SHW A;  3CC2 T;  4Z02 A;  3GP8 A;  1S3S A;  2DL5 A;  3M59 A;  5HK3 A;  2KRN A;  4K11 A;  5DYI A;  2E6Z A;  4C5E A;  1K0X A;  2VV5 A;  1HSQ A;  4GBQ A;  4L59 A;  3QJY A;  5C18 A;  2O9S A;  4HVW A;  2DD4 A;  1ZC1 A;  4J6W A;  1Y71 A;  3GOX A;  1K73 R;  3OYM A;  2GGR A;  1X6O A;  5CCB A;  3UAT A;  4NOY A;  2KR3 A;  2XKO C;  1JRI A;  1T3L A;  1G3S A;  2O4X A;  4CC7 A;  1W2B P;  3CEY A;  1QCO A;  4F7U A;  1G3W A;  2BTT A;  2VAS A;  1FMV A;  2RHU A;  2CUB A;  3RR6 A;  2F2V A;  3SD4 A;  2R5A A;  2D8H A;  4C92 A;  3FJP A;  3PIP A;  1WXB A;  1WHH A;  4BUG A;  2EGE A;  3ZJT A;  4M7A B;  1RUW A;  3NPF A;  2P0K A;  4JJN K;  4RTX A;  1VQ8 Q;  2RHZ A;  1D1C A;  5A0G A;  1YJN A;  2H3J A;  2QDL A;  4VUB A;  4E47 A;  2CGH A;  2FHD A;  2QXF A;  1WFW A;  4EMH A;  5GAN 5;  5IXF A;  1S1N A;  3EGX B;  4F7U F;  1BB9 A;  2VYT A;  2R58 A;  4KH0 B;  4II1 A;  2F5T X;  4C0D C;  4C92 F;  2OAW A;  2RHX A;  3QZ5 B;  2RQW A;  2JTM A;  2EJ9 A;  4NL2 A;  4A4G A;  4OMN A;  3P8D A;  4BE1 A;  4C5I A;  5CO7 A;  3MP1 A;  3H41 A;  1PRM C;  4RTZ A;  1YIT Q;  3JCM Q;  1D1B A;  2E12 A;  1Z9Z A;  2DXT A;  2RN8 A;  1VYU A;  3EG2 A;  3CCE T;  4N4G A;  2XDD A;  1B7T A;  2RI2 A;  1I8F A;  2DM1 A;  3CC2 Q;  3O5Z A;  4A4H A;  3CME A;  1E6H A;  3QII A;  4M78 B;  3WVD B;  3NTH A;  4LNP A;  4M77 D;  4LUD A;  2J6F A;  2JT4 A;  2OTJ A;  1Q95 G;  1N9S A;  5DY9 A;  4FL6 A;  2CP7 A;  3A8O B;  4PNO A;  1YJ9 Q;  5EC7 A;  3UA7 A;  4J9C A;  8AT1 B;  1YIT A;  3L2Z A;  1OI1 A;  3DLM A;  1K8A R;  3G4S T;  2OJ2 A;  4RUG A;  2BIV A;  4LN2 A;  4HT9 A;  4F7U E;  1SEM A;  3QSU A;  4IUT A;  4ZTF A;  1GFC A;  4M75 A;  4AFS C;  1ZX6 A;  3G7Z A;  1TU0 B;  1SRM A;  2ZAE A;  3BDU A;  2GFA A;  1QCN A;  5GAM d;  2LVM A;  4LXC A;  4F16 A;  1KJW A;  2BZX A;  2XMF A;  5LJ3 f;  1G83 A;  2KRM A;  4KUI A;  2RQR A;  4J9E A;  2RI5 A;  2V1R A;  2HCK A;  2SEM A;  2L89 A;  1TUD A;  3JCM g;  2JN0 A;  1QKW A;  4C8Q F;  2CKK A;  3ZJU A;  1TXQ A;  1U1S A;  2LQ8 A;  2QI2 A;  2XHC A;  1AT1 B;  2L3S A;  1RAC B;  2ED0 A;  3U23 A;  2DL3 A;  1PKS A;  2RJE A;  3V7R A;  3MCA B;  3VYH B;  3OYL A;  3CF2 A;  4KDI A;  2KI7 A;  2QEX T;  1ZBX A;  4PJO C;  2ZPE B;  4F04 B;  2P0P A;  2EQU A;  4FYX B;  2NYS A;  2DD5 A;  3CPW S;  4PK4 A;  3OW2 S;  4AQ7 A;  2DXC A;  4ELY C;  5LJ3 h;  3EHR A;  2MK5 A;  4QQD A;  1KQ2 A;  4MZT A;  1M1G A;  2KAF A;  3QYG B;  2RK1 A;  3LYI A;  3VKI A;  3EFO B;  1B34 A;  4DA4 A;  5FTL A;  2Y4Y A;  5GMK e;  1QVF S;  2O88 A;  2RPN A;  2KDS A;  3QJ6 A;  2NUZ A;  3OA6 A;  1UEC A;  4KT0 E;  4BI3 A;  4A63 B;  2X3W D;  1AWO A;  2MWP A;  5GAM f;  2JS2 A;  1ZSG A;  4ATO A;  4GLK A;  4EIK A;  1WDX A;  2J05 A;  1AZE A;  1BCM A;  4ZNX A;  3QDF A;  1ZLM A;  1X2Q A;  4OMF B;  1KIK A;  1IB8 A;  1K1Z A;  1WIE A;  1O54 A;  2A37 A;  2EQI A;  2GQI A;  4DBQ A;  1QWE A;  4D6W A;  1Y0M A;  3A8M B;  4M75 E;  3CD6 T;  2MAM A;  4FU6 A;  2LW6 A;  2QQ9 A;  4X34 A;  1M9S A;  4M78 C;  4J9G A;  2M0O A;  1ZA2 B;  1WJR A;  3N5B B;  1TSF A;  1WZO A;  3CCE A;  2KE9 A;  2J06 A;  3C0C A;  1PD1 A;  1WHK A;  1MV0 B;  1D3B B;  1QCF A;  2XG8 D;  3LH0 A;  5KYU B;  4BY6 C;  5GAM h;  2JZ2 A;  1MMG A;  1VQM T;  2L3P A;  3D7S B;  1K9M R;  2KRS A;  1NYG A;  3FB9 A;  2KBT A;  4J9D A;  1D0Z A;  2RI3 A;  1M4Z A;  3OBW A;  1ZA1 B;  3DB4 A;  1O75 A;  2DMO A;  3GNG A;  3ZJV A;  3PGG A;  1U3O A;  5HCK A;  3TRE A;  1WA7 A;  3G4S A;  4ZN1 A;  4FCY A;  1YBY A;  2P4R A;  2D0N A;  3QHS A;  4V2S A;  5FRN A;  1GBQ A;  5LJ3 g;  2RA2 A;  4J6X A;  2GCX A;  4B9W A;  2QEX Q;  3JB9 H;  1VQO Q;  1QP3 A;  4O6J A;  3QPH A;  2CH4 A;  4E7K A;  2BUD A;  5GAN 8;  1LNX A;  2XI9 A;  4M75 C;  1YIJ Q;  1TOV A;  2COW A;  5LJ3 j;  2WSE E;  1AEY A;  1O9S A;  2GFU A;  3M56 A;  2XU8 A;  2ZPH B;  3PMT A;  1SG5 A;  2J6O A;  5LJ5 e;  1IXD A;  1QWF A; 
#chains in the Genus database with same CATH homology
 1Q82 C;  1YHQ T;  4X9C A;  4MDW A;  2E6N A;  3MP8 A;  1UGQ B;  2X4W A;  4M75 D;  3V8K A;  3VUB A;  4DOV A;  4ZGJ B;  3FPR A;  4BAC A;  2LRQ A;  3HFO A;  2QEX A;  2XDB A;  5AYF A;  3URG A;  3SFM A;  4XTW A;  2RK2 A;  3L2Q A;  3CXC A;  3RKY A;  4C92 C;  1VQ5 A;  4C0D B;  1W2B A;  3VUZ A;  2LTO A;  2K5L A;  3JCM P;  3CBO A;  4OVA A;  4Q5W A;  2FVU A;  4IUV A;  3OYC A;  1BI2 A;  5EG2 A;  4BI8 B;  5CKD A;  3CCS A;  2MM0 A;  3M53 A;  3T9N A;  3OYN A;  4M78 A;  1VQ6 T;  3F70 A;  1VQP A;  1UGR B;  1YJW A;  3FIF A;  4C0Z A;  2VGN A;  4BE2 A;  2RJF A;  4ME7 A;  2QQS A;  3GF5 A;  3ASK A;  2L3R A;  2FYK A;  4C8Q E;  5GAN 4;  3HL8 A;  2KSS A;  3CME T;  1FWZ A;  3EFR A;  3JCM W;  2EJF A;  2DJZ A;  4M7D C;  4JDS A;  4C92 D;  5CCA A;  1K9M C;  1GXI E;  2MF2 A;  3HRU A;  3OY9 A;  3L2V A;  3OS1 A;  1K8A U;  3JB9 J;  1BIB A;  1KD1 U;  1VQ7 A;  3UWN A;  2X35 A;  1KQ1 A;  4HCZ A;  5CK9 A;  3JCM J;  5GAM g;  2EQJ A;  2Y90 A;  5GAO q;  4C8Q G;  2QA4 T;  1K73 U;  4MML A;  2JOY A;  4RKU E;  2OTJ T;  3LLR A;  4HKE A;  3MEW A;  5J26 A;  4B9X A;  4IKF A;  3HSB A;  5DLQ E;  4DOW A;  3CCV A;  2LT4 A;  3LW5 E;  3TU4 K;  4M7D F;  5CCX A;  2V8J A;  3M4G A;  2KQW A;  2DXB A;  3CPW A;  1B34 B;  3QKJ A;  5LL6 S;  5LJ3 e;  5GAN g;  5GAO r;  1YIT T;  4KDL A;  4FIB A;  3OW2 A;  4LD6 A;  5J39 A;  1RL2 A;  3Q1J A;  1M90 C;  5FLX E;  4M7D D;  4PLL A;  5HKC A;  1M1K U;  1U8R A;  3OYB A;  2GQV A;  2HNI A;  2RM4 A;  3H6Z A;  2AHJ B;  3VJP A;  2HQX A;  1UB4 A;  2DEQ A;  3HHT B;  3L2U A;  4XU1 A;  2WSC E;  3PMI A;  3V7C A;  4KLN A;  3CC2 T;  2I2L A;  3CMA T;  4Z02 A;  5GAO l;  3C94 A;  4M78 F;  3GP8 A;  5GAM j;  3S3N A;  4PJO E;  2EWN A;  3HU1 A;  3JCM X;  1S3S A;  4XAX B;  1Q7Y C;  3J80 E;  4M7A E;  2E64 A;  4QQ6 A;  3I56 T;  1BKB A;  3M59 A;  5HK3 A;  5GAO n;  2Q1A X;  1VQN T;  1WNL A;  4N4I A;  5A2Q E;  4BDZ A;  5DYI A;  3QQ8 A;  2JTF A;  1QCS A;  4KUL A;  4PJO G;  5GAN j;  2E6Z A;  2RH2 A;  5CAI A;  1QVF A;  4OB0 B;  3CD6 A;  1UEB A;  4C5E A;  1R8O B;  2E41 A;  2EKO A;  2VV5 A;  3QXE B;  5FRO A;  3S3O A;  3FPU A;  5FTK A;  4L59 A;  4BB7 A;  1BI3 A;  2PU9 B;  3QJY A;  1YI2 T;  5C18 A;  1BI1 A;  3HFN A;  1QVP A;  2DD4 A;  4XU0 A;  1ZC1 A;  4IUQ A;  2B25 A;  1PSE A;  1Y71 A;  2QQA A;  4J6W A;  3GOX A;  1VQL A;  3QG1 A;  3E1S A;  4QW2 A;  3HU2 A;  2VC8 A;  5CQY A;  3OYM A;  4C8Q B;  4E7H A;  1X6O A;  5CCB A;  3MEV A;  3L1A A;  2OTL T;  2OAU A;  3HU3 A;  2EYQ A;  2MWO A;  3DKM A;  4NOY A;  4NS5 A;  1JJ2 A;  1YCY A;  1WJS A;  3BW1 A;  2XKO C;  3LWH A;  4FSX A;  3FC3 A;  3H8Z A;  1JRI A;  2O4X A;  1G3S A;  2X4X A;  3UPU A;  4M77 E;  1OZ2 A;  2CZ6 B;  5FTN A;  5C6S A;  2E5Q A;  4A53 A;  3L2W A;  2EJG A;  3OYE A;  3MO8 A;  2FB7 A;  3CEY A;  4BI4 A;  4F7U A;  2PVG B;  1G3W A;  4JRI A;  3SWN A;  2DTO A;  1CR5 A;  2RHU A;  1G3Y A;  1P92 A;  2IVW A;  3OYY A;  5GAO m;  5B6C A;  1WGS A;  2M9U A;  2R5A A;  3SD4 A;  3CCM T;  3CC7 T;  1FXX A;  4ZN3 A;  5GMK h;  4QQG A;  2PWY A;  2E70 A;  4C92 A;  4EMK B;  1XNI A;  2V8K A;  3FJP A;  2JVV A;  3PIP A;  2JNG A;  2O01 E;  1PSF A;  2KK4 A;  5GAM e;  5GAO p;  2XIC A;  3C12 A;  3KBG A;  2K57 A;  5C0M A;  3JB9 D;  3QC8 A;  2XID A;  3G71 T;  5A0D A;  1WPY A;  4BUG A;  3QYH B;  3VU3 C;  3CCJ T;  5FRM A;  4M7A B;  3ZJT A;  3BFM A;  3OBY A;  3OYA A;  2ZZD A;  1Y07 A;  2K2V A;  2E65 A;  2P0K A;  4JJN K;  3S6W A;  2RHZ A;  3X24 B;  2QTX A;  4E7L A;  1KC8 U;  5FU7 B;  5GAN e;  4M75 F;  4M78 E;  1NJI C;  5A0G A;  1YJN A;  4RG8 A;  2LT1 A;  2H3J A;  2K5F A;  1QVG S;  1VQ8 T;  5D6Y A;  3DB3 A;  5IN1 A;  5GAN 7;  4M7D A;  4M7A C;  4VUB A;  1G3T A;  4J7I A;  4E47 A;  1Q86 C;  1VQ5 T;  2R5M A;  2CGH A;  3OYD A;  4M78 G;  2B8A A;  4HCC A;  2LQK A;  2FHD A;  2QXF A;  3MHX A;  3OMC A;  1VQO A;  5FU7 C;  1JB0 E;  2VXE A;  2WSF E;  4EMH A;  5GAN 5;  3G6E T;  1AHJ B;  2MM2 A;  4J7F A;  1U1T A;  1UGS B;  2DVE A;  4AS1 A;  4GY5 A;  4F7U F;  1Q82 U;  3RMS A;  4HT8 A;  1KHC A;  1VQP T;  3CCU T;  3FEO A;  3KUF A;  3QWZ A;  4KOD A;  3C95 A;  2VYT A;  3JCM d;  4FM4 B;  1YIJ A;  5IAY A;  2R58 A;  3GLX A;  4II1 A;  2F5T X;  2DZ9 A;  5HK0 A;  2ZPB B;  5GMK i;  1VUB A;  4C0D C;  4C92 F;  3CCQ A;  1VQ4 A;  2RHX A;  3J81 E;  3QZ5 B;  4OB2 B;  5D6W A;  2JTM A;  2CS7 A;  2EJ9 A;  4NL2 A;  4P5N A;  4A4G A;  2ZPI B;  4EDU A;  1MGQ A;  3P8D A;  4M77 B;  5GAN 3;  4BE1 A;  4C5I A;  2L8D A;  4RV0 A;  5CO7 A;  1VQK T;  3WXM B;  2MMP A;  3MP1 A;  4WF2 A;  4IUR A;  2DIQ A;  3X25 B;  3CCL T;  2YRV A;  1JBM A;  2A3L A;  2RD1 A;  4ZTJ A;  2D6F A;  1G5V A;  2HD0 A;  4XQ3 A;  4M77 C;  5A0L A;  3JCM Q;  2F69 A;  5CKB A;  2P0Q A;  3JAM E;  2E12 A;  3EAE A;  1D3B A;  1S72 T;  2DXT A;  3RKW A;  3PT9 A;  4JUV A;  1K9M U;  5DYG A;  3CCE T;  4N4G A;  2EIF A;  4XTV A;  4BE0 A;  1VQ6 A;  2LNV A;  2DKG A;  3OSV A;  4C5G A;  2XDD A;  3V8J A;  2RI2 A;  1I8F A;  3R6O A;  4A4H A;  2K4Y A;  4PLI A;  4J8O A;  3A8L B;  3CME A;  5CKF A;  1N27 A;  3QO3 A;  3QII A;  4M78 B;  5EPP A;  3WVD B;  3L42 A;  4IUU A;  4JRP A;  3NTH A;  1M1F A;  2Q18 X;  3QQ7 A;  2Q1D X;  2JV2 A;  3I55 T;  1QVG A;  3MET A;  1Y96 B;  4M77 D;  4Y28 E;  2CYZ B;  4KO8 A;  3PFS A;  2QA4 A;  1M90 U;  2OTJ A;  4XK8 E;  1N9S A;  3JSC A;  5DY9 A;  4FL6 A;  1NPR A;  3A8O B;  4PNO A;  2DO3 A;  3HKS A;  2E10 A;  2RO0 A;  3JCM V;  1YIT A;  4M75 G;  1VQ9 T;  2K3Y A;  2VUB A;  2VGM A;  3RES A;  3KXT A;  3L2Z A;  1H64 1;  2YLB A;  5GAN 2;  1YJ9 T;  3ME9 A;  1OI1 A;  3DLM A;  2A7Y A;  2BKD N;  1Q7Y U;  5KE2 A;  3G4S T;  3OQ5 A;  3SDZ A;  1OYX A;  2BIV A;  2QQB A;  5CKH A;  1R7R A;  4HT9 A;  1XTD A;  2K3X A;  3QZ9 B;  4F7U E;  4R56 A;  3OYJ A;  4OB3 B;  1IRE B;  2Y4X A;  3QSU A;  4IUT A;  1EIF A;  4RCB A;  3CMA A;  4ZTF A;  2CZ0 B;  3HP9 A;  4M75 A;  5J3B A;  4BDY A;  3G7Z A;  2PVO B;  4J83 A;  3I56 A;  4F7U G;  1I4K 1;  4A4F A;  4HCB A;  1QDN A;  3BDU A;  2M16 A;  2GFA A;  1VQN A;  1VQM A;  2L5Q A;  3M58 A;  1XOV A;  2CZ7 B;  3O8V A;  3M57 A;  4C0G A;  1OZ3 A;  5GLF A;  3JCM f;  2JUF A;  5GAM d;  2LVM A;  4C8Q C;  1CZ4 A;  1KQS S;  3CCR T;  1MHN A;  3JCM b;  2EAY A;  3PTA A;  4C92 G;  3GPL A;  3OS5 A;  5LJ3 f;  1KG1 A;  3LHD A;  5KCH A;  1W2B S;  3CBM A;  4KUI A;  3ER0 A;  3RMQ A;  3PNW C;  1YI2 A;  1SSF A;  2RI5 A;  5GMK j;  3DLL A;  3CC4 T;  3OSS C;  5LJ5 d;  2L89 A;  1HXD A;  4OGE A;  3JCM g;  3TEE A;  4JRQ A;  1H3Z A;  2JN0 A;  3E19 A;  4C8Q F;  4M7D E;  5EQJ B;  2RJC A;  5I2S A;  3JB9 F;  5ERG B;  2CKK A;  3LWI A;  3X28 B;  3ZJU A;  1HK9 A;  1U1S A;  2RB6 A;  2OTL A;  2LQ8 A;  3JB9 I;  2QI2 A;  4C8Q D;  2LC4 A;  1Q81 C;  1VIE A;  5CR2 A;  1NZ9 A;  2XHC A;  4JS5 A;  1QP2 A;  4JS4 A;  4PJO B;  4M7D G;  2F5K A;  1N6A A;  3E9F A;  3UT1 A;  1YJN T;  4ZGD B;  2RJE A;  1BIA A;  3MP6 A;  3M4Y A;  3V7R A;  5CD1 A;  2RHY A;  4EMK C;  3FPT A;  3MCA B;  3VYH B;  3OYL A;  3CF2 A;  4KDI A;  2EQK A;  4OF1 A;  5IT9 E;  4C0F A;  1N8R C;  2QEX T;  4E7I A;  1ZBX A;  4CRI A;  2ZPE B;  4PJO C;  2P0P A;  4MZP A;  3L2R A;  2EQU A;  2O4X B;  3X26 B;  4A4K A;  2DD5 A;  2D0Q B;  1N9R A;  4XTZ A;  1KHI A;  3CC7 A;  2LDM A;  3CPW S;  2XD0 A;  3JCM h;  4QVZ A;  3CBP A;  4XU3 A;  3OW2 S;  3SWN B;  3ZFJ A;  3A8H B;  3CCS T;  2Q19 X;  4JRK A;  4MDX A;  4AQ7 A;  2DXC A;  2YHT A;  4ELY C;  3GIB A;  5GAN 6;  4M77 A;  5LJ3 h;  1XQH A;  2DZC A;  5D6X A;  4QVC A;  2DTI A;  3PIO A;  3G71 A;  1YJW T;  4M7A F;  2PUO B;  2ZPG B;  5CKE A;  1LJO A;  4QQD A;  3OYI A;  1Q86 U;  4PJO D;  3JCM c;  2P4T A;  4OP0 A;  1KQ2 A;  3SWN C;  2ZCF B;  3OS0 A;  4M7A D;  1M1G A;  2KAF A;  4MZT A;  3JRZ A;  3QYG B;  5LJ3 d;  2NLU A;  4JLI A;  2RK1 A;  3LYI A;  1VQ7 T;  1KQS A;  1YHQ A;  4N0A C;  5FTJ A;  1VQ8 A;  2R57 A;  1LOJ A;  1W4S A;  3OYH A;  3VKI A;  2YUJ A;  3NTK A;  1CZ5 A;  4KBM B;  1B34 A;  4N4H A;  4DA4 A;  2Y4Y A;  4PL6 A;  5GMK e;  3SB2 A;  4RMO A;  1BYM A;  5FTL A;  2QDY B;  3GNF B;  3FDR A;  3VV0 A;  1QVF S;  4A54 A;  2E1H A;  2KDS A;  3CCV T;  3QJ6 A;  1K8A C;  5KH6 A;  5HY6 A;  3G6E A;  1KD1 C;  3OA6 A;  3NTI A;  4M7D B;  2GF7 A;  4KT0 E;  4BI3 A;  2LX9 A;  2PVD B;  3MEA A;  3ZBD A;  2VXF A;  3A8G B;  1K73 C;  1E32 A;  5CIU A;  2MWP A;  5GAM f;  3CCU A;  1I9G A;  3ZGZ A;  3LGA A;  1Y96 A;  4OGC A;  4ATO A;  1QW1 A;  3LGF A;  4GLK A;  2DAQ A;  4L5G A;  4XTU A;  3OYG A;  2HQE A;  1WLF A;  2K5I A;  4C5H A;  3BDL A;  4M77 F;  5LJ5 f;  4OMF B;  2WAC A;  5GAN f;  1JJ2 S;  4LDU A;  3UDC A;  3OYF A;  4UC4 A;  1M1K C;  1VQK A;  4E7J A;  3LX7 A;  2ZGW A;  2X4J A;  4EMG A;  3JB9 G;  3RUX A;  3JCM e;  1O54 A;  1X01 A;  2D9T A;  4D6W A;  3CCL A;  4FT4 A;  3A8M B;  5FTM A;  2CZ1 B;  4M75 E;  1M8V A;  3CD6 T;  2MAM A;  4FU6 A;  3V8L A;  1ZHI A;  2QQ9 A;  2MI6 A;  3A5Z B;  1M9S A;  4X34 A;  4LDY A;  4RCC A;  4M78 C;  5L8R E;  5LJ5 g;  2DK3 A;  5FU6 B;  2M0O A;  3E9G A;  1S72 A;  1WJR A;  3N5B B;  4C8Q A;  4BY6 B;  4FT2 A;  4TVR A;  4JLG A;  1M5Q 1;  2KY9 A;  3LGL A;  3CCE A;  1I5L A;  3QDR B;  3FRN A;  2Q1C X;  1I81 A;  1VQL T;  1D3B B;  1NPP A;  5GMK l;  5FU6 C;  4YTL A;  2RHI A;  2M1H A;  2XG8 D;  4X9D A;  3LH0 A;  3OMG A;  2EQM A;  5CVI A;  3NFC A;  4XTX A;  3RIR A;  4BY6 C;  3CC2 A;  1VIF A;  3J7A F;  5M9O A;  2DXU A;  5GAM h;  3I55 A;  4M78 D;  2JZ2 A;  5KCO A;  1VQM T;  4XTY A;  4A4E A;  5I21 A;  4ARI A;  1BI0 A;  2RJD A;  4NL3 A;  2QQR A;  4MZM A;  4Y91 A;  4C92 E;  1DJ7 B;  3HRS A;  5LJ5 j;  3MB5 A;  4O5V A;  4M7A G;  3FB9 A;  3QBY A;  2DTH A;  5CQX A;  2RI3 A;  1M4Z A;  2XK0 A;  3VYG A;  5LJ5 h;  3P8H A;  2KMT A;  4BD3 A;  3OBW A;  4LDV A;  4CI0 C;  5GAN h;  4EMK A;  3M54 A;  4QVD A;  3DB4 A;  1RI0 A;  1O75 A;  3GNG A;  1VQ9 A;  3CXC S;  3HRT A;  3TCJ A;  3ZJV A;  4IUP A;  4DQ2 A;  3PGG A;  1FX7 A;  1YJ9 A;  3AHU A;  4PJO A;  3TRE A;  2EFI A;  4J6Y A;  1WQW A;  4ZN1 A;  5GAN d;  3G4S A;  1WQ7 A;  4M7A A;  4ARC A;  3CPF A;  3C4S A;  2PJH B;  2G3R A;  1YBY A;  3QHS A;  4ZGE B;  3RER A;  1X75 C;  4V2S A;  4MMK A;  5FRN A;  5LJ3 g;  2RA2 A;  2PQW A;  2DIG A;  1Y7X A;  4J6X A;  3BQB A;  2GCX A;  2YVL A;  1UGP B;  2IG0 A;  3EFS A;  2HAX A;  4LD9 K;  4B9W A;  4M75 B;  4LDX A;  4CQN A;  2HBP A;  3OYK A;  4XU2 A;  3WVE B;  4LDW A;  3CCR A;  2DPP B;  3JB9 H;  1WJQ A;  5GMK m;  3M5A A;  1QP3 A;  5C1B A;  3QUI A;  3QPH A;  4O6J A;  4RG2 A;  3RKX A;  2X4Y A;  3M9Q A;  5DM7 R;  4E7K A;  4N0A A;  4M77 G;  1KC8 C;  2LCL A;  2BUD A;  1VQO T;  5GAN 8;  1LNX A;  2PUK B;  1Q81 U;  4L6V 5;  3CC4 A;  3MEU A;  2XI9 A;  1TH7 A;  2ZPF B;  1ZQ1 A;  4M75 C;  5I2M A;  3FLG A;  3X20 B;  2FL7 A;  3CCM A;  2LW6 A;  1IZ6 A;  2XDP A;  3OB9 A;  2C06 A;  4ELZ C;  3P8B B;  3HPW A;  3M55 A;  4OB1 B;  4KUD K;  3S3M A;  4F7U B;  3TIW A;  2KVQ G;  1V29 B;  5LJ3 j;  2WSE E;  4J5Y A;  3ZEH A;  1O9S A;  2GFU A;  3M56 A;  1NJI U;  4HA8 A;  5DLO A;  3INZ A;  4PKC C;  1YIJ T;  4R55 A;  4PJO F;  3BY7 A;  1N8R U;  2XU8 A;  3V7S A;  2ZPH B;  2YLC A;  3PMT A;  5KE3 A;  3OS2 A;  3CCJ A;  1VQ4 T;  3CCQ T;  2V8I A;  5LJ5 e;  2LCC A;  4C92 B;  1NE8 A;  4EPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...