5ERGB

Crystal structure of the two-subunit trna m1a58 methyltransferase trm6-trm61 in complex with sam
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
375
structure length
324
Chain Sequence
b'NCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTFAFVHVLQPTPELWTLSLPHRTQIVYTPDSSYIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVGHLFSFEFHHIRYEQALEEFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHKIKEGDSNYKWKEVTKMEAEIKSHTSYLTFAFKVVNRSRDDEKVNEIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subu
molecule tags Transferase
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Crystal structure of the two-subunit tRNA m(1)A58 methyltransferase TRM6-TRM61 from Saccharomyces cerevisiae.
pubmed doi rcsb
total genus 84
structure length 324
sequence length 375
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5ergB01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ergB02
5B1SA 4RTLA 2CKDA 1EJ6A 1RI3A 3VC2A 2ZBPA 4LG1A 4PIMA 1VQ1A 5M5BA 2OXTA 1M6YA 2CMHA 3KQYA 5BXYA 2EFJA 4Y30A 3I53A 2AOTB 3M6WA 4FSDA 5DLYA 2PLWA 3KQWA 3IYLW 5DT2A 4EVIA 1AV6A 4XUDA 1NV8A 3CJRA 3KQMA 2Z6QA 1MHTA 3LHDA 5FUBA 5EEGA 3G8BA 1RJFA 1U2ZA 2XVMA 1JQ3A 4FSXA 4FT2A 2G70A 3E05A 5EG5A 5HZMA 1O9GA 2CMGA 2GS9A 1SVUA 5CVUA 3PS9A 3PT9A 5EKXA 3DP7A 3ELYA 1JQEA 5K0BA 3ORHA 1KXZA 2P41A 3MB5A 3BWMA 1NE2A 3LCCA 2R3SA 3M4XA 4H0NA 1YZ3A 2ORED 2HR1A 3A7EA 4CKCA 1BC5A 3EVGA 3MTEA 5HIJA 4QQKA 4AUKA 2PJDA 1QANA 2OY0A 3I9FA 5FULA 4C05A 2UYHA 2P7IA 2ZULA 4HTFB 1YFJA 4FZVA 1ZHFA 2AVDA 1L3BA 1UWVA 4GF5A 4YMGA 3KR1A 3GDHA 5CIYA 2JHCA 2ONZA 3DMHA 1JSZA 4X63A 4WVLA 1NT2A 2HV9A 4DA4A 2K4MA 3NVKI 1XVAA 3KHKA 3O7WA 3DMGA 3G5TA 4YUVA 2HWKA 3FPHA 3EMDA 5JUWA 1JG2A 3B5IA 3OFJA 4DCMA 4GEKA 4RVHA 5DM4A 4A6DA 1M6EX 3C3PA 3KPWA 5FA8A 4HRAA 3EVAA 3EVZA 3M6VA 3TR6A 3G5LA 2KW5A 5CM2Z 5H02A 3X0DA 1ZQ9A 2VDVE 3O4FA 4IKPA 4CKEA 4RSRA 4PYLA 4PGGA 3TKAA 4C08A 1VP9A 5FHQA 5FWDA 2OPBA 2ZWAA 1JG1A 3UJ6A 1VLMA 4XUCA 4OBXA 3KR0A 3EVBA 1JG4A 4AX8A 1FP2A 5LQAA 3M6XA 3DULA 3PX2A 5HFJA 4PYMA 4HTFA 4C03A 3FUVA 4C07A 1VBFA 2XYQA 5EIFA 1FBNA 1RJDA 1XCLA 4RVGA 4F86A 5KVAA 2YUIA 4OA8A 3DLIA 3MTIA 3BGDA 4O29A 5E1MA 4AZTA 3NWBA 2H1RA 2PBFA 3GU3A 1KHHA 4YUWA 2I6GA 3OU6A 2I7CA 1QAMA 3HCAA 4ER0A 3ANXA 4RTPA 1RJEA 3KQVA 2UYOA 1VPTA 1RI2A 2F8LA 3OE5A 1XCJA 2BR4A 3LX6A 1JG3A 3DMFA 4P7GA 5DPMA 2BM9A 4CTKA 5K0EA 5K03A 2BH2A 4V0RA 3SMQA 4E30A 5MHTA 5ERGB 3M70A 5E9QA 2CWWA 1I9GA 1SQGA 5CUQA 5E8RA 2IH4A 5G02A 3BGIA 1F3LA 3GWZA 3AJDA 2H11A 5EMMA 3PVCA 4JXJA 4KW7A 4RTSA 3OE4A 1NW8A 2C7RA 1AQJA 1UFKA 3ELUA 4R8SA 4E31A 1HMYA 4GOOD 2AZTA 2H00A 4CTJA 4MQ4A 4PWYA 1QYRA 1ZGJA 1N7JA 4ER7A 3T7RA 3ERCA 4OX9Y 3CKKA 4RWZA 4LWOA 4FS8A 3UJDA 3A26A 3DXYA 2JJQA 2P35A 2IGTA 2FK8A 1N7IA 4PYNA 3HM2A 4P7JA 1KP9A 2P3OA 3G89A 3LSTA 5DTMA 1NW3A 1XTPA 3P97A 4QDJA 4QDKA 1L1EA 5EHIA 4PYJA 5HOQA 3MGGA 4GOLD 2EG5A 3C6KA 4HGZA 5C9ZA 1IY9A 2IDKA 1Y8CA 1JR4A 3LDGA 3P2KA 3P9KA 3UA4A 5EVJA 2V7EA 2YR0A 5K0GA 3HCEA 1KR5A 2Y1WA 4GQBA 2XYVA 3ME5A 1P91A 5GP1A 2Z6UA 2NP6A 3CCFA 3LKZA 3LCVB 5D1NA 2AN4A 2N47A 3IEIA 1Q0TA 4PNEA 2PX8A 1FPQA 3IHTA 3P9CA 1F38A 4XCXA 5D1HA 2ZZNA 3OU2A 4YV1A 3FUTA 3E23A 5LR6A 1XDSA 1EG2A 1X1DA 1G8SA 4OQEA 5LQUA 2LD4A 3HVJA 4X60A 3RIEA 3NVMB 1KPHA 3P71T 3UJ9A 2PGXA 1EIZA 2B2CA 3ER9A 3FZGA 4KIGA 5LQRA 4Y2HA 1I4WA 1WXWA 1L3CA 3FPEA 3KQOA 3LECA 4PCLA 4C04A 4QQNA 1JQDA 2I62A 3EVDA 1KYWA 2O0LA 1O9HA 2P1DA 3R3HA 3EGEA 2ADMA 5DWQA 3V8VA 4DF3A 4YUYA 1R00A 2PT9A 4E33A 2O57A 4MHTA 1G6Q1 2AR0A 1YB2A 2CL5A 4DZRA 1R8XA 3DUWA 3BGVA 2AN5A 4KDRA 2Q41A 4M37A 1BOOA 5JR3A 4ATNA 4PONA 4RTNA 3B89A 1OR8A 4YUZA 2QYOA 2ZIFA 4NECA 1VIDA 1N2XA 2R6ZA 1KPIA 1PRYA 3K6RA 4RVFA 4YV2A 3KPJA 1QAOA 3BWYA 3AWIA 3L8DA 2JHAA 4C06A 2PKWA 2GB4A 4LECA 3KQPA 4CWAA 4CXMA 3HCDA 2IH2A 2IBSA 2GLUA 1T43A 3S68A 2IH5A 1NW5A 3EVFA 4DQ0A 4EMSA 2IPXA 4K6MA 5K0CA 3CVOA 4ER5A 2BZGA 5F2NA 2YXEA 1V39A 2NXCA 3C0KA 4U7PB 1PJZA 3SSOA 1TW3A 1I1NA 3GXOA 5K01A 5KS2A 3GNLA 2ZIGA 3UJCA 3JWIA 3A4TA 1B42A 2PX2A 3KKZA 4OQDA 2YTZA 3A7DA 4EK9A 3PLAE 2GPYA 5GOZA 4RYLA 2QRVA 2FRXA 3KQQA 2PX5A 2NYUA 4OBWA 4X1OA 5CVJA 2OYRA 1SUSA 5GIOE 2C7PA 1YFLA 1G38A 2I9KA 2IP2A 2PWPA 5P8WA 4A6EA 3UFBA 3OZSA 3BXOA 2OB1A 5FADA 4B17A 4YV0A 4R8RA 3T7TA 3ID6C 3BZBA 3PFHA 3M33A 5DTRA 4GOND 2P40A 3EVEA 3PTAA 3FTCA 4RTJA 3FTDA 2FK7A 3P2IA 2YVLA 2PV0A 3G2MA 3P2EA 3P9IA 4ZTBA 3F4KA 2HMYB 3TPZA 2AOVA 1KPGA 3GCZA 4RV9A 2QE6A 3KR9A 2XYRA 3DOUA 5LQJA 3H2BA 3LDUA 2AS0A 1JTEA 4F84A 3HCCA 2ONYA 3M6UA 2ZCJA 2VDUE 3FYCA 1NW6A 3I58A 2ZWVA 4FR0A 5E2AA 5E1DA 2IIPA 4FT4A 3HVKA 2ZLBA 4EQZA 3HNRA 2PSSA 4BP1A 1XDZA 3P8ZA 1R8YA 3MHTA 4RTQA 1Z3CA 3KU1A 4XUEA 1ZGAA 4DM3A 3JWHA 3KQSA 2PXAA 1FP1D 3KR2A 4HGYA 2OB2A 2P8JA 3AXTA 3THRA 2AOTA 1KYZA 1Q0SA 4BY9E 4GOMD 3G88A 3LCUA 1P1CA 2Z6AA 3TLJA 4RTRA 1MJFA 3HA3A 3FRHA 5EHGA 5FQNA 1WG8A 2JHPA 3CC8A 1DCTA 3FTFA 3EPPA 4E32A 2V74B 1X1AA 2PX4A 3BKWA 4KDCA 4PIPA 2FPOA 3FUXA 5DM1A 5EMKA 3TM5A 4CKBA 2PXXA 4EKIA 1D2HA 2IFTA 4X61A 4PINA 4AZSA 2B3TA 3GGDA 5ICFA 4HC4A 5ICEA 3Q7EA 3PB3A 4P58A 3DH0A 3E7PA 4G56A 1ZG3A 3RODA 2QM3A 4RTKA 3KQTA 4GUAA 4OA5A 1WS6A 3T0IA 3FUUA 4AZWA 2O05A 2IBTA 5E2BA 1AF7A 3CBGA 1IXKA 2GH1A 2GAFA 3QOXA 5CCXA 2JH9A 4BLUA 4E70A 5F2KA 3BWCA 4M7RA 2PWYA 3HVHA 2P3QA 2AOWA 2EJTA 2GA9A 2ZZKA 3EMBA 3TRKA 1NKVA 3QOWA 3LGAA 3GIWA 2B9EA 1ZKDA 2P3LA 2PT6A 1ORHA 1P39A 5E1OA 3EVCA 3DR5A 4KVZA 3C6MA 2AVNA 2PY6A 3ELWA 3G2OA 4IV8A 5EGSA 3EEOA 3R6TA 3DTNA 5HIMA 3TOSA 4BLVA 5DRTA 3OZRA 1WY7A 2UYQA 5IH3A 4ER3A 3BWBA 2G72A 5BW4A 5HIIA 4RTMA 5EQJB 3B3GA 1P1BA 2NXNA 4E2XA 2AOXA 5CVEA 2XVAA 2Y1XA 3LL7A 3UA3A 5K0NA 1G55A 5DTQA 5E9WA 4KIFA 1SKMA 1QZZA 2ZZMA 1NBHA 3LKDA 3PX3A 4GC5A 5T64A 5DSXA 1FJXA 2FHPA 3SSMA 1DL5A 5K05A 1XJ5A 3QV2A 1HNNA 1X1CA 2NNWB 3SR4A 2NXJA 3JWGA 1X1BA 5ICGA 3JWJA 2ZIEA 3TMAA 5K0LA 3SX0A 5K8VA 5EZSA 1IM8A 5HILA 3OFKA 4L7VA 2O06A 2OO3A 1INLA 1VL5A 2BM8A 3UJBA 5EMJA 3TM4A 5FCDA 4RVDA 3MCZA 3FPFA 5DM0A 4DCGA 3BUSA 4DMGA 5E8JA 3VYWA 4UOEA 1D2CA 3R9XB 4ISCA 5EIWA 5EEHA 5LSAA 3DXZA 3I64A 3GO4A 2HNKA 3PFGA 5EC8A 1EJ0A 2ESRA 3R0QA 3G2QA 1M0EA 5GM1A 1D2GA 3LDFA 2YQZA 3RW9A 5DX8A 2YXLA 3FTEA 4P7FA 2WA1A 4Z2YA 4HH4A 5C1IA 1L9KA 2EJUA 5DX1A 4R05A 3SSNA 3UJAA 4QVGA 4E2ZA 3AY0A 5CVVA 2B78A 5HEKA 2P7HA 3OPNA 3P9NA 2BR5A 2NXEA 3UJ7A 2WK1A 3NDJA 5KQSA 2B25A 3GRZA 5F2OA 1BHJA 2FYTA 3KPVA 5T6BA 3HP7A 5DXAA 1JTFA 4PYQA 1WXXA 5BW5A 3BT7A 1VE3A 3GRUA 5EPEA 4POOA 1EQAA 4IWNA 3CJQA 5GM2A 5HIKA 1JSXA 1UIRA 3GRRA 1H1DA 4MTLA 5DSTA 3DXXA 4ER6A 4PYOA 1NW7A 3ELDA 5FA5A 3HTXA 5C0OE 3UJ8A 3D2LA 3THSA 4KRGA 4F85A 4YMHA 2EX4A 4DKJA 3HCBA 4IV0A 3B3JA 3HCFA 4PYKA 3UWPA 4R6WA 5CCBA 2DPMA 2ERCA 2VP3A 2VS1A 2ZVJA 5EOVA 2FCAA 3UZUA 2IDJA 4LWPA 3MQ2A 5GINE 3IV6A 2QY6A 1XDUA 5LQKA 4PGHA 1NV9A 2VDWA 1RI4A 5T67A 1QAQA 2O07A 3AXSA 4BP3A 3NJRA 4MIKA 3TFWA 3G2PA 4PYIA 3HVIA 3MERA 3U81A 3GRVA 3NTVA 5FHRA 5DXJA 4QPNA 2NP7A 3A25A 1WZNA 1R6AA 2OBFA 3B7PA 3LBFA 5EMLA 5LQCA 4PCAA 5DRYA 4R6XA 1RJGA 2PVCA 4FGZA 3HA5A 3TQSA 2G1PA 1O54A 1YUBA 1YZHA 3DLCA 3EEYA 2PXCA 3CJTA 4X41A 5KQRA 4HG2A 4RX1A 3CGGA 1KIAA 5DM2A 4AZVA 1RI1A 3MAGA 4U7TB 3TKYA 4YUXA 2UZ4A 5LQNA 2C7OA 3KPYA 3LPMA 1YF3A 4E2YA 2OKCA 3LBYA 1TW2A 3FUWA 3T7SA 2XBMA 1SUIA 2YX1A 3E8SA 4QVKA 2G8NA 3NMUF 1G60A 1BKYA 2E5WA 3I5UA 3SVZA 2JG3A 3G7UA 3ER8A 5EKUA 3GRYA 2ZSUA 3NDIA 2HTEA 5E1BA 4E2WA 3NW9A 1TPYA 3FPJA 5KYGA 2WA2A 2DULA 5EZQA 2ZBQA 4M38A 5FWAA 1R74A 3REOA 5GIPE 1R18A 4C4AA 5IKMA 3EGVA 3SGLA 3V97A 2JH8A 1SG9A 5U4XA 5CD1A 4RTOA 3GJYA 2AN3A 3WSTA 3O31A 3VC1A 2G71A 3SXJA 2ZTHA 3OU7A 5DX0A 1NBIA 5FTWA 9MHTA 4QPPA 7MHTA 2UYCA 1DUSA 2QRVB 8MHTA 4V0QA 3C3YA 5E9JA 1G8AA 5K0JA 3UBTA 1XXLA 3HEMA 4GC9A 5CVDA 5BP7A 4MWZA 2OZVA 2A14A 1L3IA 4EKGA 3OCJA 3EGIA 4KWCA 5K09A 2ZFUA 3BKXA 2VZ9A 5FQOA 3MCTA 3Q87B 3FYDA 1VP3A 2AOUA 3A27A 1AQIA 3G8AA 3HA7A 4HSGA 4P7KA 3OZTA 4QTTB 2BR3A 2ZBRA 2AOUB 2ZW9A 3KPUA 4QTUB 4FP9A 2YXDA 4BLWA 3K0BA 5K0FA 4GBED 4WXHA 3NWEA 4M36A 1ORIA 3VSEA 1RI5A 3B3FA 10MHA 3FRIA 1EAMA 5ICCA 2C7QA 3R24A 3SM3A 1SQFA 1X19A 3FPGA 5GWXA
chains in the Genus database with same CATH superfamily
2EKDA 1J8MF 3ZIAA 1EJ6A 2QEQA 4R9RA 1M66A 4PLPA 1CETA 1TC2A 1D04A 3FNEA 4MRRA 4UNQA 3RFVA 4BVAA 1XDWA 2AG0A 3DOFA 2RKOA 2W6IA 3T1OA 1EFAA 3FA2A 3I53A 2FPGB 4WADA 3M6WA 1O8BA 2FPRA 2GO7A 3W0LB 2GNOA 4G8CA 3CJRA 3NUZA 4J07A 4CIDA 3K16A 4DIEA 1YJBA 4XLZA 4MPPA 2PT5A 4WWHA 2DPGA 3PQ4A 1N6KA 5ENVA 4IEIA 2G70A 3E05A 5YASA 3UTCA 3WNBA 3OBIA 1NAHA 3RU3A 4C1BA 1NUHA 2OZKA 4DWOA 3VVCA 1KDPA 3TTSA 2R96A 3B1KA 3M1IA 2ENWA 3QBTA 1KSFX 1L5VA 4ILKA 4NYMR 4MP3A 4DJDC 2HR1A 1QX4A 1PD1A 1Q57A 1ACLA 3ONEA 3CUKA 2F9MA 2M98A 1YASA 1B43A 3QVLA 4TXNA 3ZUGA 2HI0A 1JJIA 3EVGA 3MTEA 1KAOA 5FBKA 1KU6A 1JU9A 4TTSA 2R25B 3M9LA 2ZULA 4RCVA 4B4WA 2GN0A 4JLSA 1S7GA 4KR9A 1OYYA 4DSAA 1M0SA 5CW2A 5L7WA 3SR0A 4YP0A 1IMJA 3NAQA 1KC1A 2BEWA 3C97A 1A96A 4EUHA 1Q6ZA 4BAGA 4WBNA 1SHUX 2X6TA 2LTAA 1Z5UA 2V4ZA 4G2TA 4LE2A 1QU2A 2GYWA 1KOFA 1YI0A 2YMPA 1ZR4A 3M83A 2HCBA 2FVXA 3WB1A 4LJ5A 1XZNA 2HRBA 3FDZB 4MW6A 3SKYA 1UAAA 2OVFA 4XM0A 2R6JA 4LNUA 4ZK6A 2GARA 1BVUA 1JLRA 3FB1A 4B4VA 3DOHA 3M6VA 4G8JA 4QXOA 3R7FA 2DECA 3CU5A 1N6LA 2R85A 2ZKIA 2D2FA 3IVCA 4JJ6A 2VDVE 3JAMA 1MH9A 3ZV4A 2BMAA 2BPOA 1C9DB 3L7CA 4QJBA 1F6WA 3LY8A 3GLGB 1EUYA 1G1MA 2I54A 2UZ0A 1JR3E 3L93A 4W5OA 1Z4PX 4PQRA 1M1YE 3DTVA 3OF5A 2JD1A 4HGRA 3J7AC 4AY2A 1XQYA 4I6JA 5FEMA 4RKWA 3JYQA 3REQB 2FEWB 1TQ6A 4S1OA 3V2HA 1QNLA 2XMBA 3R74A 1ESDA 1AA6A 2AQIA 5C8XA 2VLBA 4EECA 1TAHA 1GPBA 3VU3A 4CEJA 1B15A 1JP7A 1TM4E 3O2QB 1RWWA 2X4IA 4B79A 2WHPB 4BMPB 3FCSB 4Q7MB 3W5HA 1C2TA 1SVNA 4LC9A 3HNPA 3WMGA 3TGLA 3RYCA 1JQAA 4BN0A 4UBLA 4CHTA 1G5RA 5CDUA 5D86A 3ZWCA 4P7GA 1JG3A 4PLFA 1KEUA 1HT1E 3L7JA 4LC1A 5COQA 5ERGB 4UUAA 3R0XA 3LT0A 4HO1X 4B4OA 4IKEA 4TOIA 1Y3CE 1RHKA 2BHRA 5I9TA 1I6LA 1RDFA 1NW8A 1SRQA 4CFZA 4G5QA 4BFTA 2AD5A 4GZ3A 2QZPA 3GOHA 1MPXA 1OGYA 3DTYA 4AIRA 1Z28A 4BO3A 2D0OB 3IQFA 4ND6A 3VOBA 4CTJA 2JJ8A 3E7XA 2AR7A 3MXTA 4HN2A 1VYUA 2NTVA 5BT8A 4GQIA 3S8YA 5CXXA 2GZDA 4PLCA 1CYDA 4WUTA 2REQA 2PGDA 2QVZX 2I55A 4UJ5A 1MOPA 1DKNA 3HJAA 5IKXA 2G88A 5BWBA 3HSKA 1SBZA 3DAFA 4GOLD 3TQCA 3HDGA 3I2YX 4AJLA 3NXSA 1V43A 5D2CA 2J87A 3UMGA 2RGNA 1JSRA 3UWDA 3UW3A 1EVIA 2FSHA 2DQSA 3QOFA 2A35A 3FCYA 3GAZA 2HB6A 1ZN8A 1DKUA 2G8LA 1NXVA 3JZFA 2B6NA 5IDWA 4PO1A 1JF8A 3E23A 3K3PA 3ZGXA 2NXWA 1X1DA 1TD1A 3H8VA 2H8GA 2LD4A 3OTWA 1W8IA 1E89A 2W8BA 3RIEA 1E2HA 4TPKA 5DLEA 1EIZA 1KS9A 3H9BA 3IHWA 4MS1A 5BR8B 1OH6A 4ZV9A 3RE1A 5TPWB 1M2WA 1PZEA 4BVFA 4YCCA 4Y2HA 1E2GA 1TMOA 1L3CA 2J5BA 4N5DA 2UUPA 3WXMA 1IMOA 2HPVA 1PS0A 1YWGO 2IHTA 2YNMA 4YN3A 4FKMA 4F2HA 1GG2A 2SKCA 5T4EA 3AEUA 1FOEB 4YUYA 5HRCA 1BS9A 2O57A 3OIVA 5CX1B 1JTVA 1TF5A 3NBXX 1KI7A 1EZ1A 3S2IA 8OHMA 3VPFA 1WBJB 5SZIA 3KQLA 2WU4A 2QNBA 2XW6A 3E9CA 4RADA 4BO4A 4G25A 1BWQA 1IE3A 4YUZA 4K6GA 3T7EA 3VKWA 2ZJ6A 5BNZA 3SYLA 1U6KA 5IEBA 1Y8AA 4RVFA 4TL7A 2PM8A 4YV2A 4GR4A 1SD5A 2OTCA 2ROQA 4PZDA 1NTRA 5J58A 2Q18X 1NT4A 3KQPA 2XCQA 3NVAA 3A2MA 3EGOA 4LXTA 3YASA 4MKHA 2RGBA 2XT9A 3VISA 4QUHA 4J0HA 5FV7A 1RAFA 5K0CA 1KJQA 2C5AA 2HH9A 4ER5A 1KP2A 5BR4A 2W2LD 2NXCA 4CF6A 1PFVA 1G8FA 2X41A 5K4GA 3PEWA 4MIOA 1PJZA 3SSOA 1NVAA 4IDNA 1YV9A 2ZT6A 5CA1F 2Z8YM 3S2YA 1UAYA 5GOZA 1XDGA 2JFHA 1AKNA 1HOTA 2NYUA 2QLLA 3QFCA 4D9HA 2C78A 1U3VA 4FQ8A 1YZYA 2YMLA 3M5CA 3OPYI 4R40A 4YTEA 4OHZA 3EEFA 2CDBA 2X40A 3QWFA 4RKRA 4XFJA 4WKOA 1J2JA 4OQMA 2AZMA 2JGKA 2ZWOA 1T5SA 4HLDA 2FPIA 4G1CA 3KLNA 4MW4A 3TQQA 2WNIA 3FTCA 1YQQA 3INRA 4OGKA 4CCSA 2ZJ3A 1ZI8A 3G2MA 1OA1A 2PEYA 3I1IA 3TVDA 1FTWA 4AJHA 3HHEA 5IJ0A 4KH0A 4YAFA 3D1LA 1DCKA 1E1QA 3NHRA 2Q3BA 4UKDA 4WOCA 3UAYA 1D2EA 4BMYA 1GIAA 1XBTA 2ONYA 4FFDA 2OHGA 1N5JA 2PCJA 2VDUE 2BHNA 4IYJA 5F51A 2H9AA 1IN6A 3LGSA 4X71A 5CK5A 2WOJA 1V7PC 4D3ZA 3K05A 4A92A 3COPA 2FN3A 3NIWA 3G0IA 3KQSA 3LF1A 1SAYA 4QRIA 5KIAA 2OB2A 2ZAYA 2QAJA 1DFIA 1IUKA 5CURA 4BKRA 2J9FB 3TQOA 1N2ZA 2IEAA 1PQUA 1T9CA 2J7PD 3LQRA 2IU4A 2XMDA 3GELA 3OD1A 3MLEA 3WL6A 1Y4ZA 1D4OA 3BMOA 2X3UA 1YTUA 4FHFA 5K2MA 5EHGA 3OMXA 1W1UA 1A8QA 5AK5A 2ZI9A 2XDWA 4LHEA 5CRIA 4E7PA 2W0SA 3ABQB 5LB4A 5KHOC 3LTNC 3BDIA 1PU2A 5DM1A 1TLFA 3PICA 1D2HA 1GZVA 1XDBA 5CJPA 2ZQZA 3AHJA 3L5OA 1G9TA 4HAVA 4YLEA 4DLUA 5TF0A 3HPQA 1ZG3A 3HUEA 5F1PA 3X2FA 5LMZA 3LRTA 1ZCFA 2ZUTA 2BJHA 1NJGA 1AF7A 1QFYA 1ZEMA 1YUMA 2VAXA 4IIUA 5G40A 3RU9A 3HNOA 3H8SA 3PNSA 2C2GA 3DV2A 4BVBA 1E9CA 3GMIA 2EC5A 5JFGA 4ZDIA 3ED1A 4YR9A 4GE0A 5E1OA 3AVTA 2GT1A 5FNVF 4F38A 4FZRA 3JYNA 2B37A 5EGSA 2COUA 2UZ1A 2J5KA 2FFQA 3WL5A 4A7PA 3PBKA 3IB3A 2YNMD 1ZXBA 3F4BA 3UUWA 1EH5A 1BMQA 3MJSA 5BWOA 1LTKA 5TMDA 4F04A 4ER3A 3E82A 3BWBA 4HDMA 2OAGA 4E46A 3NM4A 1MEJA 3LTEA 3W6NA 3R0JA 4LRYA 1M6VA 4JT8A 4S12A 3GZTB 5I6DA 1FXUA 2RSLA 1J0XO 3BIFA 3KU4A 4D4HA 4MVJH 5C1PA 2WJ3A 4V38A 4D4KA 2CXNA 3NHKA 3BXEA 3T06B 1GVHA 1B74A 3A6FA 4YRSA 1JDVA 2PKQP 2W6QA 4QHYA 5K0NA 1SKMA 4Z4EA 2EKBA 4GOXA 2X15A 4D3SA 4DOMA 3NB0A 1L7NA 2ENUA 3H04A 5DSXA 1P7YA 3PUJA 1F8UA 3L7NA 2HXSA 1CZUA 5F5XA 1HNNA 1DIGA 3QVJA 2FXVA 3M34A 3GFPA 1UMCB 1ST3A 1JIQA 4YJHA 4BE4A 2F1OA 3PQ8A 3NHPA 2CF5A 1WTCA 3O4GA 5B7QA 1CD5A 2R1TB 2WHYA 1LB1B 3SC6A 3P9YA 2CEAA 5ALKA 4QGFA 2Q62A 4ZU6X 5IAEA 4YRIA 3ORQA 1AUOA 1D2CA 1L1QA 1QYWA 3AFOA 2D5BA 3BMQB 3FYTA 4QQ8A 5AVJA 1BWPA 3DXZA 3IUNA 4M0FA 1MR3F 1E59A 5CBPB 5DKFA 3W5JA 4IG9A 2FWAA 5FIUA 1P0CA 1DKQA 5JI2E 2E3JA 4MV6A 5EFOA 1S02A 4MV5A 4OJKA 4X20A 3VU1A 4Q7QA 5KNCD 3P52A 2I2WA 4YJHB 3AUSA 5IM4F 1A4XA 4EB3A 2JIZA 1M1YA 4CMIB 4J4BA 4DQXA 3E5MA 1JL3A 3OPNA 3ULKA 4BQRA 4KAXA 4D3FA 3VR5H 1UDWA 2ON6A 4O4HF 4ZCLA 2JCYA 4HN9A 1A7KA 3CLUD 3KPVA 1PT6A 3PDJA 5BSHA 3F6YA 1OROA 1Y9AA 2HLPA 2JCGA 2BI4A 3DE6X 3LYHA 4JLVA 3QVSA 2BFPA 6CHYA 2X4DA 3QHAA 3QIVA 1FLDA 1R50A 3JYOA 4FWIB 2YWDA 2ODEA 3FVRA 3WGMA 5LIRA 2R60A 1RXUA 3W8FA 2PNJA 1G2IA 1XTJA 3EXFA 3PE6A 3PL5A 2B2XA 3PPWA 3FNHA 3WK5A 2NSDA 1VC2A 1ENOA 3HCBA 3UATA 5CA1A 1X3LA 4D9BA 1VPLA 2V7TA 2QQRA 2JJ1A 2ERCA 3AKYA 4AI6A 2YCLA 3ZWAA 4BWGA 1BHQ1 1NVVQ 4RORA 1HYEA 5CVCA 2CBGA 5J3JA 1V35A 4DC0A 2W4QA 4HVAA 1OHHD 4R98A 2O3SA 4Y1GA 4ESHA 4YT5A 1XDUA 3FHCB 3BHNA 5TGTA 3DLAA 3G0OA 5KCZA 5FBLB 3W79A 3L7BA 3PNQA 2GCOB 1J0CA 4MIKA 4DMRA 1E1KA 3A06A 3ZW9A 1EUDA 5MN5A 5JNVA 2BBWA 3LUJA 2FZVA 4QEKA 2R8YA 3KZNA 2GRJA 3K0KA 1JW9B 1EIWA 3WYDA 3I83A 3PPVA 3IUPA 4QUJA 5AXAA 4X97A 1ONSA 4KZPA 5LQCA 2I1QA 2J32A 1C14A 5DRYA 1IUOA 5E4TA 1TTPB 4TM7A 3O8LA 2I7TA 3VNVA 3NTOA 4X41A 1W0KA 3A1NA 3DT9A 3RTGA 3MT8A 2OFPA 3H13A 4B2LA 5I01A 5G0WA 5JQGF 5EJ4A 3DV0A 1GA1A 2X7XA 5AQEA 2DGDA 4E2YA 4EG3A 2BGGA 4AP6A 1C5KA 3AVUA 3FUWA 1FDSA 3IULA 7REQA 1SEVA 3P2OA 1G60A 2XOKD 1OH7A 1E4EB 2V6JA 1FLAA 1N4DA 1PEDA 3G7UA 4D8WA 3KT6A 1M34B 1FPMA 4F3YA 3V1KA 4D57A 4LK2A 3L79A 2Q07A 1DWOA 2RHJA 2UZAA 2PO7A 3FFAA 1CIJA 3GFRA 1T5DX 2DQZA 2WKWA 1T2VA 5KQLA 5BUZA 5BRAA 1UM8A 2OLJA 2ZS8A 4ZAZA 1O0BA 1P4RA 4JP3A 1J8VA 4HQRA 1SG9A 3EY4A 3MWGA 4U0KA 5EKSA 5JBNA 4LI0A 3ZH2A 3VKVA 3K4PA 3H0CA 3AB3A 2ANCA 4OLAA 3EG9A 2W6ID 4WXEA 2Y1LA 4YT4A 1U2TA 2ZVPX 3FWKA 4NZZA 2AXEA 1PDOA 1P5JA 4X9XA 1MF7A 2PQ6A 4ML3A 5EIEA 3BTSA 3CGWA 3BWVA 1UKYA 3CR7A 2GYUA 5KX5A 3A9WA 4YRKA 3UBTA 3S4YA 1T35A 4GC9A 1U9ZA 4L0CA 3V48A 2DMRA 1T9ZA 2OZVA 3EUWA 3RYTC 2BMVA 3LUDA 1NMXA 2R47A 4DSUA 2WB2A 1L3IA 3QMMA 5BOVA 1OZHA 3U7QB 3BKXA 3DE4X 1H6AA 1UZLA 4HWGA 3MCTA 3NDRA 4ZI3A 2FCRA 1MX1A 3EOZA 4E5DA 4P4NA 1CUWA 3G8AA 4HSGA 2CGEA 2NG1A 3VC3A 1XLTC 4QO8A 1P1RA 4B6OA 4LF5B 3ISVA 3OUUA 4KKXB 3L0IB 5K0FA 4QNMA 1Z18A 1YOVB 4GZ5A 1EQUA 2NTJA 1V3VA 3VSEA 5K6AC 3D7RA 1KMQA 2PX0A 5H82A 4V3CA 1U7PA 5JOQA 5GWXA 4CJXA 1TUEA 4JN6B 2QM7A 4YCDA 4ZKEA 4A73A 5HKAA 3COJA 2ZBPA 1XN1A 4LG1A 1L4UA 1WTAA 1VQ1A 2ECKA 3H5VA 4HLQB 4PIMA 5BSRA 1Z2AA 4MW0A 3TCXB 4B75A 5BPFA 5BW8A 1VMAA 4NEQA 2GDZA 2I67A 4ROTA 2AC4A 3U17A 3GRCA 1Z06A 4DDHA 3TNFA 5LMNB 1JDPA 1D3AA 1H69A 3OT5A 3ZS9A 3FNFA 2H8KA 4IP0A 1F20A 1OI4A 2RGDA 4FT2A 3B70A 5MFPA 1C4XA 2ZYSA 3PL1A 3B2QA 3COYA 3GFGA 4Q39A 4YP5A 5AJYA 5T41A 1G9XA 1FVHA 1L5SA 3VO1A 1P0FA 1GO2A 4KGZA 3BD7A 1ZIPA 3IAXA 1W0JD 5E7QA 2NUPB 4Q00A 3S2EA 3WV5A 2A0XA 3P45A 1HNWB 3HJGA 2QSZA 4P4UA 4EY7A 3HRHA 3T3PB 3CPSA 4C21A 5AVXA 4YHBA 1PV1A 2ZE8A 4BWVA 1QANA 1U3TA 3AJAA 5EJFA 4HDSA 4OPMA 2IYAA 3VH3A 4EW2A 4YRDA 1O6BA 2Q2OA 3EVNA 2H63A 1MORA 4HAOA 3D5EA 4I81A 5CX4A 3ZQJA 1YFJA 1XDDA 2KLHA 3QX7A 3AEQA 2WR8A 4TYNA 1N5KA 2NWQA 3W04A 3WZ2A 3LLUA 1R6DA 3UENA 3V33A 2ZI3A 2R86A 1N2EA 5EZ5A 2O59A 3ETGA 1ADCA 1XMPA 3C4JA 1DKMA 2LIPA 3C15C 3VU0A 4QO7A 3TEMA 4AICA 4M46A 1KYVA 4MWOA 3H0KA 1CQWA 1CUGA 5B55A 2DAPA 3SDBA 4R1PA 4IUYA 4K88A 1ZOSA 3QELA 4LJ4A 4RMJA 1DHTA 3UXMA 3WVNA 1L5FA 3L7DA 2JRLA 1E6MA 1J0AA 5JHGB 4LF6B 1JKJB 1FS6A 1F9EA 1RJ9A 2ZIAA 2RGUA 3K9LA 3N5CA 3OCYA 4PC1A 1JJBA 1H3NA 4TXHA 4U63A 4US0R 3X1JA 5ITZA 2ZRNA 4M4SA 1C7ZA 2VOJA 4BUJA 2WHRA 3WQBA 1F4LA 1V9LA 1HDEA 3NETA 5NULA 1MT0A 4I5IA 4WBSA 3JQFA 3UB2A 1KK2A 3BH6A 1OFVA 2RGNC 4NMXB 4PZCA 3TXXA 3ZE7A 4UTNA 3PX2A 1BGVA 4GPIB 1OFUA 1SUFA 2OESA 4RK0A 1Z7YA 2BMEA 4NBKA 4CIYA 1UMDB 1FBNA 2GVDC 1XCLA 2ZWMA 3D6JA 1QBGA 4UJ3A 1JFFB 3GFQA 4EP1A 4XVUA 5ADVA 1VLQA 2JAPA 2YVKA 4BQNA 1E2QA 5AVTA 4L02A 3HCOA 1J2YA 1OLXA 3OWHA 2FE1A 4HP8A 2PWAA 1X7HA 4BGEA 4LVCA 4MA4A 4R9SA 5CCEA 2DHCA 1P81A 4P80A 1QBKC 2BDUA 3F8SA 3HV0A 3W8NA 1K08A 2FJUA 2OBLA 4W5JA 4BDTA 2CT8A 4COOA 3I30X 5A1JA 1C1XA 1Y6JA 3AG6A 4KKVA 3B53X 5B5SA 5J1TB 5KTNA 3U0VA 5BQOA 4KRFA 4KDLA 1RRCA 4Q12A 5FBWB 5G02A 3T61A 5C7LO 3EGXB 4DR3B 1QHSA 4Y9TA 1PO7A 1UMDA 1G5QA 2IRWA 2VT3A 1K7YA 2QUAA 2A1IA 5GONB 1FSFA 1EFCA 1NFFA 4X8LA 1ANKA 2NV0A 3O2SB 4EY3A 3KKOA 4BC1A 1PYOA 3W5BA 3TO5A 4M0UA 3JRWA 4MKFA 1K86A 4JX8A 1B1CA 4Y2QA 3ROFA 3E7DA 4KGVA 5E6UB 1KAEA 4C76A 5E3HA 1IY0A 1P6UA 4B44A 1XYYA 2HCRA 5FNZA 1LZLA 1U28C 1CSEE 4UHBA 3QUTA 2QRNA 5B57C 5AI8A 1U0LA 5G4LA 1Y5LA 1C7EA 5JO0A 5DN9A 3SCZA 4K6KA 4GPD1 5IT0A 4I4TA 1DI0A 4CU2A 5K0GA 2X8JA 1MO4A 3LKZA 4BVKA 1Z2NX 5EZ6B 4K26A 1MDBA 2OO5A 1XKQA 3D0RA 4TKMA 4XX0B 5HIAA 2DG2A 1XLTA 4PX3A 1OZGA 2CHQA 3OU2A 4QBIA 2I2FA 2IVZA 5FLEX 4XZ3A 4URXR 1DJMA 1OFHA 5JMOA 2FEPA 2P79A 3H19A 5KYTA 2D7DA 5K7SA 1XRRA 2JI9A 2YVUA 4Q1CA 4N6GA 3ZU6A 3C8HA 4BGIA 4PE5B 2ZROA 1B3BA 4RS4A 4D8TA 1YA4A 1DEKA 5LQRA 2DKFA 1LPSA 3BFJA 3O1LA 1JQDA 1RQGA 1B6TA 1JIKA 3G7NA 4QQNA 4RZXA 2XAUA 3QPAA 4P0TA 4BLTA 4DIUA 4D46A 4V1CI 4YWJA 1FS4A 2QN2A 3WTBA 3WFJA 4YT8A 4BE7B 1QO0D 1XR3A 4J8PA 4WGFA 3UAVA 4BN5A 4M8IA 1RYBA 1YH3A 5IK2D 3V7FA 2V65A 5BV7A 1WE2A 3A6KA 2VDQB 3ILHA 3FFTA 5B3LA 2VTKA 3LUBA 3TR5A 1QH8B 3JARB 3RRNA 4WLEA 5LXTF 2FZKA 4O1IA 3RV3A 5SICE 1QAOA 4OQPA 4BB6A 1H8EA 2MSDB 2QTTA 4G9GA 2PKWA 5DHRA 1JEEA 4IMPA 4CXMA 5CFLA 3M9WA 3KTOA 1NAIA 3VZSA 4ZEMA 3A32A 4BRSA 3KJHA 1K0UA 4K6MA 2GJAA 5DHTA 5IC5A 4E6EA 4FB4A 1LUAA 1NQWA 4L16A 1JLHA 4QOIA 3ZIAD 4AO6A 1H22A 1H9AA 1AO0A 4FIZA 1E3SA 1YRWA 1Z8DA 4EZBA 3A4TA 2GK6A 3G79A 3ETEA 3KKZA 5IAKA 4EK9A 5B1EA 3VSDA 4N8EA 1GUBA 1I1QB 1ND5A 3W6OA 3W5VA 1HLGA 1FDVA 4XAQA 1K4MA 3SHFA 4EYKA 2Q3DA 5L3RA 5FWNA 5KWJA 1W4RA 1Z34A 3OZSA 4ZALA 4K9QA 4DMHA 3ID6C 3TSOA 2JBAA 3FZNA 1QXSA 3MQFA 1WR8A 5KJEA 3M7IA 1ZC3A 3PE3A 3IELA 1E77A 1JVNA 1O6ZA 1I4LD 3VPCA 3P2EA 1Y0BA 1ZYUA 3JQ6A 1P7PA 1H1LA 1MUUA 1FU7A 1ST2A 2WSBA 1ZVMA 2DPYA 4U4AA 1NLYA 3IUQA 4RHXA 3JX9A 4EG1A 4D9CA 2EFHB 3OF3A 4IHKA 3MHTA 2HXGA 3VYSB 1SXHA 2OHFA 2PWZA 3HN2A 5LC1A 5JYBA 2VH5R 1XRJA 3MPUA 1PNRA 2PXAA 4FYWA 3VKGA 4WQMA 1FP1D 1E9BA 3ENQA 3OAAD 1RXVA 2DLDA 3X1YA 4BECA 1QRRA 2QR2A 5A7GA 1NLZA 4XPIB 1SULA 4B3GA 4L28A 4B3IA 1RQPA 1M6VB 2UUBB 1R5JA 2H2FA 5IDQA 2XLCA 2XTJA 5DCWA 3FRHA 2PSEA 1DCTA 1XPJA 2RHRA 1CIPA 2AA3A 2AZXA 4YI3A 1J42A 1K6MA 1NRWA 2FPOA 3FH0A 3FUXA 5F7JA 2PXXA 2WJAA 3UMCA 3B20A 2ZJAA 1BOFA 4F06A 1K7XB 3IMCA 3QQPA 4PRZA 1XNGA 4BZQA 2NUAA 1KTIA 3OE7A 1EE9A 2B83A 4N4AA 2CXTA 2WSMA 1G18A 1IJBA 2ID7A 3E2PA 2W9XA 4MR9B 1P19A 3N2YA 2B5OA 3Q8LA 3I28A 1JXQA 3LD9A 4I1YA 1HFWA 2IYXA 3CF4A 3K1ZA 4Y1RA 5AVSA 1ZVVA 2PWYA 5KVSA 4FDTA 1AO3A 1EP2B 4G07A 5IKEA 5SYMA 2K7FA 2PUAA 2FVYA 1G63A 3ZLUA 1N1DA 4BVLA 1P39A 2B34A 1DC6A 2PTGA 1YS9A 1Z4KA 3H9GA 3ZNOA 1A7AA 3UEOA 5KTPA 4TVSA 3BFPA 2DWPA 3FD8A 3NYIA 5HIMA 5L8VA 2J7PA 5LOVB 2BTQA 5FYQA 1E2EA 3LZCA 4GT1A 4RH1A 4S3MA 4XDZA 4D5GA 2G72A 4HDRB 3EZYA 1SG6A 2VP4A 4IDEA 5HTOA 3W77A 3E18A 3GLFA 1YAHA 2HN9A 1JMVA 4ND5A 5CT5A 1NF9A 1EUQA 3N58A 2CK3D 3QKUA 4E2XA 2H7YA 4G3XA 1NVWQ 1PEYA 2P27A 1L8QA 2A9PA 3HR7A 1JG7A 4DV2B 5DE3A 1FF9A 4N9WA 1BTOA 2HY7A 4QECA 1C9EA 4CCWA 1NOKA 1MA0A 3T9DA 2VNSA 1BVRA 4GKJB 3L0OA 4DT1A 4CQMB 2CFIA 3KQKA 2DUJA 4EA9A 4Z1MD 2AF4C 3OM1A 3AZQA 5JZMA 3PC3A 4J3NA 5BQPA 3BK1A 1DWPA 2C3UA 4AY3A 4N5MA 2HK9A 3KWMA 5ENZA 1I7QB 1U0HC 2WYUA 5BSUA 5JV5A 1Y1KE 3LPAA 6REQA 3NX4A 5ELXA 5DBEX 1M9NA 1XHEA 1YK0A 1L7XA 2EIHA 3G2NA 4K46A 4PHFA 3MXOA 3O1IC 4DCGA 4MEAA 2FFRA 3D4LA 2PUEA 2CDCA 4EKEA 1LCIA 2QWXA 1WJGA 2IYPA 2II6A 1U81A 3IILA 1ZITA 4O2AA 5G4KB 5ALVA 1Z6TA 1M34E 4AC9A 4O4JA 1SURA 2DLCX 4FD2A 3EQ9A 3FHLA 2HJGA 3AL3A 5K8CA 2NQTA 4JL8A 1I3OA 1NVDA 2GCOA 2PGAA 4HH4A 1SCBA 3A3YA 1KL7A 5AFSA 2DT8A 2XJ4A 1U4OA 2F2TA 3UBMA 2KBFA 1ODTC 3QYPA 4H31A 1A9RA 3LLSA 3RGGA 4B0OA 3LNTA 2P7HA 4UDOA 2I65A 3GC6A 2YS6A 4MIEA 4HMQA 4R9UC 4NOKA 3GGJA 1H2FA 3JVUA 3DMTA 2QRQA 2CBXA 4PX2A 5JXJA 1ZH6A 1VRWA 2ONKA 1ISHA 4YQEA 5KU1A 4HXGA 2ZRAA 3KLPX 4R0NA 3GUCA 2RHHA 4PR0A 2Y1DA 3OE7D 1D03A 3I4CA 3GRUA 4WOBA 4EJFA 4POOA 2YIJA 4OXIA 4X64B 3DHWC 4IWNA 2WJIA 4FEGA 5KO2A 2I71A 2W0MA 3MTGA 1CS0B 1XCBA 2EJWA 3GFBA 3F6EX 3PGKA 1C0KA 3FPTA 1MW9X 1NBMA 5KAMA 3JVIA 3HDVA 1YHZA 2YJ6A 2FQXA 4YMWA 4EZIA 3HVRA 3B3JA 3IERA 2B4QA 3SDSA 3BTVA 1PGNA 5IU6A 3SN6A 1PNQA 1TJ4A 2VK1A 4LWPA 4M83A 4HQLA 3ZDAA 5KPJA 1SMKA 4LDPA 3SHOA 1NVEA 4OH1A 3H1AA 4KXUA 2ZB2A 1WZIA 3N0VA 3T7CA 4QXQA 3TW8A 3I2IA 1QUFA 5M7EA 2O3TA 3IESA 1Z2OX 3ONFA 4I5FA 4J75A 5BSFA 4ZCPA 4PYIA 3HVIA 3KV3O 5B6CA 2ZIZA 2IODA 2VXOA 2BEVA 3V3KA 5HHTA 3Q5GA 2Z2IA 3EUAA 4NMMA 2BEUA 4HLUA 4D80A 5HPYB 5JIBA 3WP0A 2OR3A 4NZOA 1B23P 3ZCQA 2IXAA 3B2EA 1DPFA 3KEGA 1L4KA 2IA5A 3JWPA 4EYGA 2A86A 3N39C 4HG2A 1Q84A 1W88A 1TOAA 3L4EA 1C0PA 3N76A 4GVPA 2HDHA 3M4NA 4JJAA 2HMAA 2JZOA 2YFYA 3L0SA 1K27A 3C3AA 4OB6A 4O5OA 3UHAA 1SUIA 4YRGA 3A28A 5G3ZA 1JDSA 3DD5A 4L6AA 2XB9A 3OBBA 4LOHA 4FFWA 4MWBA 3PZRA 3HEBA 2JG3A 4O4IB 3C7AA 2FX5A 4HI0E 1QYIA 9GPBA 1OWMA 1W8DA 2Z83A 1WBDA 2UUAB 3LVRE 2DULA 2LGJA 1GGEA 2ZWIA 4UUOA 5JW6A 5M34A 2AJLI 1RXEA 2R1TA 3KL4A 3KRTA 5F33A 1O6CA 1R18A 3ANNA 4MUKA 4CV1A 1LJ8A 1L8LA 5F3WB 3HB1A 4KUHA 3IQIX 3SVLA 3ESCA 3A11A 4LY9A 3PHJA 4Q1AA 5ETJA 5J5CA 5U4XA 3ROQA 1NULA 3HGQA 4GYKA 2H1VA 6PFKA 6Q21A 4BP8A 1WBBA 3TEJA 4WESA 4O08A 4YONB 4NK5A 1Y42X 5DX0A 1L1FA 1JQLB 4M1ZA 2MSEB 4L8GA 2Y0CA 7MHTA 2C57A 4BU0A 2WIJA 1DUSA 2QRVB 3KYIB 3WK6A 2XBLA 3KKEA 4ALIA 1AOXA 3G1WA 2WOOA 5CVDA 3OTIA 2O3UA 4PC6A 3GLKA 2L2QA 2HA3A 4HDNA 2AN9A 3HXPA 3ZTWA 4EKGA 1VIMA 2L18A 3CNQS 1DX4A 4D45A 2ZFUA 2O8EB 4MKZA 1Z36A 1R4ZA 2WP8J 4H35A 1QHHA 5EWMB 1F3OA 1EDBA 2IV3A 3TRIA 4D9FA 4MMZB 2R9VA 4GSKA 2BR3A 3RUFA 2XGJA 1DT3A 2HJ9A 5ESXA 1AKVA 1Z15A 1GZUA 3WL4A 3AEZA 2CBZA 3CUVA 4X93A 2H4WA 4AN4A 2G1UA 1HE4A 1K3TA 1LFAA 1XMVA 2PUDA 4QTXA 4Q66C 1DDGA 3ORHA 3PJDA 1JEOA 4MQFB 3S1SA 3KE9A 4GPAA 1W19A 3D43A 1PBNA 1Z0JA 2AMVA 3JPWA 3EPLA 4J0KA 3WQQA 4UE6A 4ZVQA 2GHTA 1AV6A 1YHYA 4WAUA 4XUDA 1T3LA 1TK2A 2X42A 3N8HA 3IVAA 5CM8B 4A0RA 1KYYA 3FY4A 4U7FA 3ZI7A 1CK4A 1U2ZA 2PKRA 3F1KA 3UYKA 1SZJG 3PUIA 1I0LA 1TKAA 1KF0A 5AK3A 5FD8A 1WQ4A 1ILWA 5J1SB 3DP7A 3NCHA 4CKCB 2CDRA 3G17A 1E3QA 3ORRA 3T9CA 4JITA 9ATCA 3AOEC 4JSRA 5CLLA 1L4FA 5K8TA 1SUEA 3HEAA 4ZO7A 1Y7LA 3DL4A 4QOFA 3RREA 4AUKA 1I33A 3Q8XB 3TVTA 3ZJ4A 5F1YA 4XCQA 1A77A 2Z8XA 3OJLA 4JJKA 3NDBB 2I6FA 4G0XA 2TMGA 5TNXA 1PW7A 1O1YA 3F96A 1A8SA 3E61A 5AK0A 1E6LA 3TXYA 3UMMA 4BNDA 3ZHVA 5DLDA 3IP3A 2G0AA 4M53A 3DMDA 3WXBA 5IFLA 3BPSA 1RRKA 1CQJB 2EFGA 4OXQA 1KZ1A 1RM3A 1NNLA 2FH5B 4ZAFA 5MDHA 2F3RA 2ID4A 2HU5A 2MYUA 3I6YA 5B2EA 1U8UA 2H5LA 3OIDA 4EI8A 2QRLA 2ZIWB 3QPUA 1NR5A 3ANSA 4TGLA 2EX0A 3OPQA 1LRKA 4F4CA 1B8VA 1MABB 1NRJB 3JPYA 4PN3A 1LA2A 1A9XA 1M6WA 2KW5A 4LTDA 5H02A 4JNKA 4RUKA 2EQBA 3DDHA 1BXZA 3E9RA 3MYRA 4PYLA 5JSHA 2ECQA 1VP9A 2IYZA 1MB0A 3B82A 3GNQA 5LPNA 4F6RB 3GQBB 1X1EA 1WO8A 3CUUA 1VCOA 1RWBA 2VJMB 1GPYA 2GYVA 2I9PA 2O4CA 3IPLA 1NW9B 4Y9UA 3SZGA 4JVMA 1P2DA 2J48A 1K6JA 4WHMA 1A5TA 1Y3BE 4P4SA 1S3SA 2HSEA 1AU9A 3HXKA 3DFFA 3ES9A 3JYPA 4JCCA 1N2HA 2RGAA 5TS3A 3MTIA 3LVBA 3DDCA 1QQ6A 1FZTA 5DNCA 4J9UE 4DMLA 3X0DA 4IUCS 4H60A 5A02A 3WADA 2PGIA 5TEVA 3ITEA 4DV5B 1VBMA 2X7JA 1W35A 1UOEA 4G8BA 4A36A 1WMAA 5ABPA 1B26A 4HZGA 2MSLA 3PUXA 5CITA 2MWMA 1TYDE 3QXJA 2C5BA 2XQJA 3H9EO 3DAHA 4V0RA 5KMGA 4M0LA 2VP5A 3UV3A 1FDUA 5KKNB 4D2IA 2D4HA 1CY4A 3KUDA 3S7TA 4AWAA 4BJ3A 4R1TA 1CIVA 3I32A 4KO2S 3ZJTA 1G66A 1K6XA 2QG4A 4GKKB 4W6QA 1MX9A 4XQ9A 2VJPA 3ELUA 3OQIA 4JOBA 3HZRA 1NYTA 1PV2A 3IAM1 1Z6ZA 3RADC 1KKUA 4JVNA 5HJEA 3KZ1E 4MQ4A 2JIRA 1AK2A 4GBJA 2EDCA 1O08A 1RMTA 1P2UA 4MRMA 4ZPXA 5JALA 1N34B 1GPWB 1UBCA 2UVDA 3A4YA 1D6JA 4B2IA 3ZWPA 1UR5A 7YASA 4LGCA 1TM1E 4ZVPA 2YRFA 1ILEA 4HCJA 3A6EA 1YGYA 4HMOA 4OUDB 3SQLA 2CVPA 4BS9A 5JJKA 3JYHA 1A27A 3R3UA 3TSYA 1K7FB 1BXRB 3MGGA 3TMYA 1AV7A 1VE1A 2JAXA 1E5VA 1YKSA 3NBYC 1II0A 1HDRA 3ESZA 3QG1A 4FI3F 2ZTMA 5F3RA 3TLYA 2V5VA 4AMYA 3TI7A 3EPJA 2Z6UA 1GQRA 4G24A 2IS2A 3TLAA 1DAHA 2E85A 4HTAA 2AMYA 4UQPA 1TM3E 2VPPA 2QQ5A 1KZ7B 5DI9A 4W7HA 3IHTA 3TDNA 2BUAA 1LVHA 2DBZA 4TTAA 1U8AA 4I9FA 4OHRA 2Q1UA 3L4BC 4OHUA 2FWNA 4C7XA 4GZLA 3UJ9A 2WG2A 4F91B 5GLFA 2C4KA 4JASB 3LO5A 5IRCD 2HJVA 3AHFA 3BDAA 3K8YA 4KIGA 1E0DA 4G65A 3C6QA 3LECA 3SYMA 2Y6UA 3FPEA 3VZCA 3WA6A 1KMCA 4C04A 3CZQA 5KTKA 1JHPA 2I62A 2GN9A 2FMUA 3R3WA 4MW9A 2FUKA 5K8IA 4DV0B 3OFVA 1XXHA 5KVVA 3LQYA 4KE9A 1XPRA 3NC1C 1BMTA 4PRLA 5DSZA 4B3HA 4MHTA 1G6Q1 3D6UA 1QRUA 3H97A 3OP4A 2Q5JA 3DMPA 1PWYE 2YH2A 4MUMA 4MVYA 1YJXA 3K0EA 2Q41A 1UFQA 4M37A 3ODPA 4N3BA 3T0GA 4D6XA 3HBAA 5TQJA 3I2GA 5JZSA 1RBMA 2QYOA 1GQQA 4JL5A 4NECA 1Q15A 3N70A 2IYQA 4PZ9A 1M7BA 2P11A 4KG7A 4MUAA 1ZD5A 2GVNA 3NIGB 3QGMA 1EXWA 1K92A 1L7VC 4IX1A 4PXYA 4BMXA 1XK7A 4OVKA 3VNSA 2F1RA 4CWAA 5C2JB 1N5DA 2C94A 3OX3A 4JEUA 4M21A 3S68A 4ACBA 4RLFA 2SCUA 3NHBA 2XVZA 3CVOA 4EEXA 1C30A 3GFTA 2AX3A 3PFIA 3D0OA 2P68A 4DCJA 2HX1A 5ITSA 4U7PB 1BSVA 4XIGS 5EE3A 5AICA 1QGOA 2OG1A 4TMZA 4Z1MA 4GYYA 1FJ2A 1Y37A 4YB8A 5DW3A 5JADA 4CF4A 3DLBA 2D0PB 1K4KA 3KQQA 4XXHA 1YFLA 2C95A 5E4FA 2PTHA 1SOMA 1DC7A 1T5TA 1W4CA 2Q5QA 1N78A 1TZCA 4DWWA 5LA6A 4ERXA 2H2IA 3DKIA 4KDIA 2NLOA 3ZKWA 1GGMA 2VUIB 5T3YA 1OFUX 3ZCUA 1SCUA 4P83A 4HUQB 1DIOB 1VE5A 3VGPA 3EVEA 5B6JA 4OQ4A 2N46A 4RZ2A 2J0EA 2WHEA 1Y33E 3OWXA 2B82A 4DABA 3A1CA 2QJRA 2Z8YA 2YVLA 3P2IA 3MSXA 4R8VA 3SDZA 4P3YA 4F71A 1Z39A 2HMYB 2KWIA 3GCZA 1JDZA 1ZGHA 1JH9A 4ASUD 1UZNA 2XYRA 3EFOB 3HN7A 4J3FA 4RH0A 1E5DA 1OLOA 1Z4IA 2W2MA 2YJGA 5G2OA 2CXHA 4AD8A 3AR3A 2R6AA 3MW8A 5HKOA 2ZJ1A 4QUEA 3HVKA 4EQZA 2VTVA 3LWBA 3RVPA 3M6IA 2NV2B 4WBNB 1Y9EA 1FMCA 2COEA 2H59A 2QJFA 3KU1A 3LNCA 4PTLA 3NYQA 1AN9A 5JEEA 2H0AA 5J2TB 3DCNA 3T41A 1P75A 3AXTA 3PXBA 2WAAA 2R00C 4QXPA 3SQWA 4MYUA 4PEVA 1W4AA 3I45A 4FFVA 4WA7A 5DTJA 3B6IA 4ARUA 5LL6P 2CD9A 1O97D 4LRWA 3TQHA 1D5CA 1VYVA 3IE2A 2JIZD 3CNEA 4JMLA 5DV9A 4DJFC 3BD8A 3T5MA 1IXRC 1FYEA 2ZR0A 4NABA 2G1JA 4YQFA 5I47A 3DLHA 4OJQA 3P7MA 4Y2VA 1B8PA 2A84A 1EP3B 4HMPA 1QLWA 2ILVA 3OQ1A 4RL6A 2VYND 4EITA 3GEHA 4AKTA 1WSDA 2QD5A 5EWLA 3SXUB 4X7BA 1ZGBA 4PINA 4WZ6A 4HC4A 3FNRA 3QEMB 3CWZA 1FP6A 2HADA 5TE9A 1ZJ5A 1PS8A 1S3FA 2H4XA 2R4QA 4AZWA 1VHQA 2H1FA 3GJRA 1KVUA 5BN4A 4PZZA 4W7SA 1JS1X 3QOXA 2JH9A 2J85A 3L46A 4S1PA 1SN7A 1R0ZA 2BGWA 3QV1A 3OZBA 4FFPA 4G1UC 4MPTA 4N9QA 3MWEA 4RQUA 4EB6B 1JFFA 2FB9A 2PT6A 5KAPA 1H2WA 2X14A 3K1TA 1U1DA 2CD7A 3LU1A 3MQ4A 4FSHA 4TWIA 1VPDA 1LF0A 2JIMA 1IOVA 2CE2X 3CT6A 3IDAA 2RARA 4M1YA 4OB7A 2HZBA 1F7VA 4LF7B 3LY7A 3IHLA 3MINB 4BLVA 4OSOA 5IWAB 1TYZA 2QZ4A 3T9FA 2J3EA 4JLDA 4OYHA 1GTMA 4D8VA 1IEXA 1IQPA 1QJ4A 1QE5A 1TJ3A 3DZGA 4UCQA 3ZWKA 1Q1BA 3RUPA 4NNJA 4DR1B 4G1VA 4KU4A 1L4HA 4HVTA 5KWIA 1G41A 1BRMA 4UUBA 1CDEA 3BG5A 3IIMA 2WPDD 2AOXA 2FZGA 1XKXA 4RGYA 4B81A 3VBEA 1P60A 4R8LA 1RXCA 5H59A 5KYXB 1EVQA 1PJAA 1SB8A 1ZSVA 4WKGA 2J5XA 2FHSA 1OFTA 1YNSA 1X1RA 4ENUA 1TFUA 1KEWA 1RRGA 1JV2B 1YB5A 4NNOA 1N6RA 3DDUA 4JP5A 4KPUB 1FVFA 4RF5A 1NG1A 1WXIA 2K2WA 3JQAB 1E2PA 4YH1A 4DWVA 1KVSA 1NJ6A 1RWMA 5E6UA 4XYMA 3ZH9B 2C0CA 2GQ0A 5CH3A 4IDBA 4O4HB 2D2IA 4H7JA 3EQ8A 3RWMB 2FDCA 2VI5A 5K8VA 1KK3A 3GDGA 1FU4A 4O2BA 4WTOA 4DDWA 1Z0AA 2JFZA 4ASUA 2O1SA 3UJBA 1X8XA 3EDOA 4HATA 3RFCA 1HOXA 4RHCA 5LSAA 1EGQA 2VUTA 2PX3A 2Y93A 5ECDA 1R1DA 1SO8A 1Q1AA 1R4MA 3H5WA 4FDLA 1L8OA 4B9AA 5LLSA 2R6HA 5BOSB 1F6BA 1QIDA 3LDFA 2DE0X 2IOFK 4EUFA 2YQZA 4NCNA 5DX8A 3KG2A 1XTUA 5C1IA 3THXB 2Y66A 1C50A 1JLLB 1N32B 3PK0A 3I72A 2JGNA 2P2LA 3RRBA 3ACBA 3ESAA 5MHTA 4KQHA 3KETA 1ZONA 3ADDA 4Y98A 3P9NA 1B8UA 4L7QA 2CFRA 5AP9A 4CLDA 4J7AA 4H7FA 4TN1A 3X2SA 3ROMA 3GRZA 1JFVA 2NZ8A 1ZEJA 2OCXA 3FTNA 5DO9A 5T5QA 4YDQA 2IPNA 5DASA 3PI6A 5T6BA 5DXAA 2BYTA 4G4SP 3AESB 2O23A 2HBQA 1EQ2A 3BCSA 4ESOA 5AVYA 1BFKA 2IY8A 2ZSKA 1NBAA 5JSQA 1U94A 3ZKAA 2GLTA 2HQOA 3AR8A 4Q4AA 1GN8A 2OD2A 3PQ7A 1QDLB 4ZQFA 3WSVA 1G0OA 4NF2A 4NWIA 5HE8A 4MTLA 2HTFA 3OECA 2B5VA 3QQ8A 4H1UA 4R2XA 4BNNA 5JQGB 1LLQA 5JBIA 5C0OE 4UARA 4WCFA 5TJ9A 2HFKA 1S3GA 3HJUA 4EG6A 1L4YA 4EVRA 2O6LA 5B3JA 1SNYA 2BFOA 2I8CA 5CT6A 4ARAA 4M8KA 2IDJA 3O8QB 3RHTA 4NNPA 4ETWA 3BDVA 2DEUA 3K4HA 1H93A 4CFYA 2CMDA 4XLTA 3WLQA 3JS5A 4DLNA 2B69A 1HORA 5T67A 1Q17A 4L95C 2CE7A 4KHZA 1ZWKA 2ET6A 4IM7A 2F59A 4QYXA 2VC2B 4RSMA 1E3WB 1EK2A 2OORC 1O03A 4PR3A 1P4HA 3SHQA 1GDHA 3HBFA 3U81A 4O8ZA 5FTMA 4BBZA 5TPWA 3L1IA 2VF7A 3IDOA 3UWOA 3GGSA 2PUWA 2QL5A 4PZAA 5EMLA 3NWJA 3GG2A 3RNLA 4EVSA 4C5BA 1TI7A 4EAAA 1RYDA 2JI8A 4CMEA 1XTBA 2OCDA 2NPOA 5IVKA 2XVYA 5G0UA 3NHLA 3GL9A 4KN9S 1EWRA 1TA0A 2Y27A 3G5MA 3PWTA 4L8FA 4LSWA 4TV9A 5FOSA 4AZVA 3MJHA 1BVHA 1S2OA 2XMGA 3NGLA 1EK1A 1MO5A 3IAEA 3KPYA 1PHRA 4DR4B 1BHO1 4BNTA 4G1MB 1IL0A 2IX3A 1S2IA 2YX1A 3FBWA 4FBGA 3KZKA 2GZ1A 4HKTA 3SG0A 4BUCA 5A4KA 1GN9A 4DIFA 1KDVA 3DWEX 1THMA 1JDJA 2QZSA 3B85A 4RESA 5EYPA 1TFRA 1ZM3A 4OI1A 2Y76A 3VJMA 2ISSD 3LZ6A 3WDKA 2KHZA 5JFTA 4BXOA 3KJQA 2IC5A 1AH2A 4XJSA 3FPJA 1ZMOA 3AB7A 3TB6A 5ICMA 3VDXA 4LYDA 5ALRA 1BO6A 4X61A 4YXWA 5DP1A 4P3XA 4AY6A 2QMHA 4DEXA 3B6ZA 3WIOA 3EAGA 4C0KA 1CUJA 2QSYA 3G02A 5DULA 5AKLA 1IG0A 1JGTA 1QR6A 2O2ZA 4YEDA 3ZE0B 2VDJA 3NEAA 3WLKX 1LPMA 2OD9A 2X2PA 2NGRA 1GCUA 1QO7A 1T5LA 4MV3A 4X00A 5FPYA 5JJIA 4QYMA 2CNKA 5GZ3A 5K51A 5CG1A 1STOA 2Y99A 1JEQB 1DB3A 3FMOB 4FBLA 4ZJYA 5BUSA 3ZE2B 4MWGA 3LC0A 4KREA 3M3DA 3FJ1A 2GF9A 3PF8A 4V0KA 1TLTA 2BBOA 3LUAA 1G3RA 5CW1A 3UT5A 3U7GA 2FZCA 1Y8QA 1LLFA 3MJEA 4TTJA 2BHTA 3DOOA 4D79A 221PA 3I73A 1T0PA 2P4SA 4XM2A 3WGYA 2PGOA 5IG2A 1VG8A 2REQB 3F5FA 2YXDA 3EY9A 4HGOA 4OAQA 4K8RB 2NU9B 2LE0A 4KN5A 3QXXA 2AYXA 1LDBA 3M4JA 4Q15A 1E79D 1IZ8A 2EZ4A 3NBFA 2I7VA 1FUIA 3OZCA 1KR2A 4EPWA 2BUBA 4YGYA 3BA6A 3UXHA 3VRHA 3ZE6A 1TMKA 5DYWA 4BV2A 4HDMB 2OFFA 3ROTA 4BGUA 3SKVA 1FQWA 2LCFA 4UNNA 4MAAA 5IEJA 1GRQA 3JQPA 3BL8A 4UUNA 1GP2A 1OHHA 3IVMA 4HWOA 2WU1A 1QKIA 3KQMA 2J3IA 1M2HA 5JY6A 1I80A 4HDKA 1IXSB 1PS9A 4TS9A 5JWHA 5JDIA 2WZDA 5KYYB 2ZCUA 1RJFA 4FSXA 3GOQA 2BGTA 1J9ZA 2RE8A 4BVJA 3TUZC 1GUZA 4MHSA 1DAIA 1TJ5A 1XZLA 2AI3A 2W8ZA 1SVUA 2O20A 4JEMA 4OI4A 4OSEA 2NSLA 2Q3FA 4JJ4A 4N12A 2AWOA 2P67A 1U8FO 2ZPUA 4Q19A 3T3MB 4CMEC 2G5GX 1Y6RA 3JV7A 4TLCA 3MB5A 3BWMA 4EMTA 1ZJJA 4ENRA 1Y4SA 2CVZA 2ORED 1EAYA 4JYZA 1WZEA 1H2RS 1G2PA 2PPVA 3TWOA 2PJDA 5EUQB 1D7OA 1ADYA 1GPNA 3B60A 4OHPA 4RAOA 4CCAA 2WWVD 1BS1A 2CVQA 3QKTA 2JGLA 1R3DA 2JCXA 1UWVA 1NVXQ 3EXAA 3DKKA 3S28A 4DC9A 3ENVA 2IHJA 4E4RA 4Z1OA 3EF3A 3WLAA 1POXA 3GLUA 1W88B 3I1YA 4XLLA 1RU3A 3QHPA 2I66A 3G5TA 3MUFA 5G1PA 1B6GA 3DE7X 3KKQA 2WSSA 3ZLJA 7AT1A 4DCMA 3F6SA 3P0JA 1H65A 1WXGA 4PNPA 2GHQA 2R8OA 4WCFC 5EESA 1AHPA 2WEKA 2RK3A 1OX5A 1NDQA 5THQA 3VR5D 5JQWA 4L57A 2HA2A 2QRUA 3CBQA 1ZQ9A 2W6PA 5CJJA 5JXIA 2O2CA 1JPUA 4L9WA 1YVRA 3QEAZ 2FN7A 5M29A 2W2VA 1HR0B 3GMDA 4G81A 4EI2A 1YA6A 1M73E 4DJAA 3EGDA 2C2KA 4R4JA 1EXNA 1W1WA 1JE0A 5FBZA 4P5EA 1JG4A 2GX6A 2TECE 3EDCA 3HYRA 3PQDA 5FR2A 4TV8A 3VOAA 5A5VA 5HFJA 2CLMB 2Y1KA 1GA4A 1T1IA 1OXKB 1W4ZA 3L43A 1OOEA 3MCAA 1WPXA 4LKRA 3RJ5A 1R6VA 1QHYA 2R84A 4ZYWA 1PNOA 5B6IA 3ENKA 1EM8A 3ANYB 3IXQA 2EOAA 5K3BA 1LSSA 3DB2A 5KTYA 1QAMA 1ZJWA 2WWXA 4JBXA 1CS0A 1C80A 2HWYA 1KERA 2C4NA 2O5RA 4MV1A 2OHOA 1XCJA 3WGLA 4EX7A 3HKCB 4EPRA 4ZVNA 1EBUA 1C1DB 3UQYS 3AKZA 2BH2A 2GAAA 4UVIA 1D1QA 1TZKA 5JSUA 1DJNA 5CTJA 2QYTA 4PQEA 3GPIA 2ZUCA 5WRFA 3NTUA 3Q8KA 1S7CA 1RZVA 2J9GA 3TB4A 3KO8A 4EB0A 2QORA 2WWYA 5CPBA 3L9XA 4FYXA 4PLHA 1AQJA 4OJNA 2RGCA 3PD1A 2EWVA 4TSRA 4B4DA 3U4QB 3IVGA 1Y7IA 2QGNA 4PWYA 4RGVA 3SQXA 2PKYX 3WJ7A 5AUPB 3V1NA 2YFQA 4M6WB 4EKNB 2X58A 1WKVA 3OEHD 4LWOA 1UT8A 5CH8A 2IGTA 4MVWA 3SLGA 1JHAA 1XPUA 5B2FA 2W6MA 3BMOB 3HM2A 3NUQA 4QDJA 2PD6A 2PMWB 3A6LA 3I9V6 2YWFA 4H3HB 2F8MA 4QOSA 1EDZA 2E7ZA 3SX2A 1CQIB 3GPLA 4JELA 1BU5A 2R5NA 1DQSA 1PJLA 2V7EA 1Q6YA 3RYFA 2GPWA 2PAAA 4GQBA 4CKWA 2JLYA 2WVAA 2D0DA 1UP6A 5GP1A 5UKDA 5KB3A 4PU0A 2F43B 3EEIA 3MWLA 4BQIA 2AN4A 2ZBUA 3ONWA 2G5CA 2UDPA 1F38A 1UKAA 5LNK6 2OPHA 1CZ5A 1JHMA 1GGNA 1VJCA 1VKNA 1X8LA 4JBNA 4QICA 4NCHA 5A0TA 1IYZA 3ZHCA 2V6GA 1FNCA 4B84A 3G5UA 4J0EA 4QG7A 1IC6A 4M2LA 4Y2UA 3W7AA 1KXJA 3FLMA 3X1MA 1XD8A 5CXQA 2IE8A 4DNFA 3RM3A 4YCNA 4DV4B 1FW6A 3NM5A 1TMGE 1TKRA 3ICQB 2PGJA 1IAQA 1SQSA 3STYA 3NNDA 4PLWA 2P4EA 3R6DA 4OATA 1D2NA 2JANA 4Y0NA 2Q8PA 4NV0A 1R00A 4C4XA 1ULAA 4KLNA 3PD7A 3T15A 4QGGA 3N2LA 4EJMA 3S3TA 2IVFA 1FMLA 2I87A 3ECAA 3ZWMA 3Q88A 4EABA 1JA9A 1M2OA 2ZSIA 3TX2A 1AG9A 1ABEA 4ENTA 5KYWA 3ZDQA 1EWYA 1X7ZB 2BI7A 5FOUA 1NATA 2GO1A 2HC9A 1PD0A 3QF7A 1QFSA 1P9NA 2XNSA 2AWNA 3GAFA 4V0LA 4W99A 3UJ3X 3K09A 4Q9DA 4GZMA 4FMBB 1KGDA 3OJFA 4BDSA 2AFHE 3G0CA 1PJQA 2G76A 3EYAA 1Z0KA 1NVFA 3ZCTA 2BFDA 2EL9A 2K7ZA 5JE8A 2JLSA 3D2AA 2C83A 3V5NA 4ITUA 4QYIA 4W5WA 4FHDA 2ZREA 3C3CA 1YBVA 3E7FA 4GQAA 2ZPAA 4LK3A 2OGSA 2JKYA 4ZU1X 5H9WA 1BD3A 1GWNA 1KH2A 2BZGA 4ZI5A 1GRCA 1SM4A 3U44B 5CDSA 2XB6A 3O1JC 3X1WA 3HB4X 3S1AA 3BSFA 1T0IA 3UJCA 1UXGA 4QODA 2A57A 3I5MA 3SYTA 4ZZ0A 1I3MA 1MRNA 2D62A 4OQDA 5CLIA 1X7WA 3OQNA 4RYLA 2PX5A 2VL7A 4IHJF 1ISJA 1IZYA 4FYIA 5AHWA 4OHYA 3P96A 3W05A 1T0BA 3V46A 1TZBA 3H2GA 2FSGA 2ATIA 4KYUA 1RHRA 2FEOA 2VPTA 1N8SA 5LQDA 1W0KD 3T7TA 3IPAA 1JECA 1PDVA 2Q9UA 2ZB8A 4QT4A 5EVCA 5J9FA 2AJDA 3AIIA 1BIFA 4UPEA 1UK7A 1YMQA 3D3EA 2HHJA 3NYRA 3VR4D 4BNZA 3O8RA 3ND5A 5HQJA 3OTGA 4FK8A 1C9JA 1T6YA 1JHDA 3H2KA 4EPVA 1ZU5A 4YO7A 4C2TA 3HCCA 3M6UA 1W2WB 4X7RA 1JJFA 3AUUA 3QVXA 4C7VA 4FT4A 3Q2IA 1YUNA 1XFDA 2ZRHA 3AKDA 2VAVA 3CV3A 3DZKA 3KWJA 3P8ZA 4NFLA 4NENB 1NM5A 2VPZA 5AXDA 5CNJA 2DF8A 4ZQIA 3V8QA 2J8ZA 3JWHA 3IE1A 3ANLA 2AFHA 1U1CA 4K28A 2Z98A 3ICOA 3ZHQA 1KYZA 3QE0A 2PRYA 4WCDA 3RS9A 4PSKA 2JJ1D 5EZYB 1CRQA 1KU0A 3G88A 3QU7A 1K4YA 1QHNA 1P1CA 2EW2A 3CH4B 4KOAA 4QBKA 4X1YA 4YREA 4YP1A 1R0CA 4K81B 3AQ4A 2QJWA 3WL7A 2FTKE 3MD9A 2BGKA 5BNIA 3ISTA 4NYJQ 4FONA 4ZYLA 1OB2A 2C5SA 2PX4A 1V4VA 5CH5A 3D3NA 3THYA 2YCBA 3CYFA 1JEJA 5AI0A 3TM5A 1KWKA 1R9GA 4FEYA 1Y6GA 5KKCA 1T1GA 1AUQA 2YC4C 1KE2A 3Q7EA 4DMCA 1N2CE 2UKDA 1BGXT 4H4CA 5FJJA 1OTYA 4G56A 3LOPA 1HT0A 4UUPA 3MGKA 1U3FA 1V3QE 5JTUA 1AIPA 3FUUA 3S0JA 3RGWS 2PN1A 4MUJA 2QN8A 2G9ZA 3I92A 2GUWA 3K70C 1ESNA 4TMYA 2X0NA 1ZM4A 2BBTA 3BFKA 3JQQA 4C3OB 5DI3B 4PZEA 1H1TA 1Q14A 2Z4SA 3H99A 4JCOA 5FUWA 3UAWA 3ROPA 4YY3B 3EVCA 3DR5A 1YRYE 2PRSA 2F3QA 5E6SA 5IASA 2I2XB 4CR7A 4UZFA 4UU7A 5LMCA 4RY8A 3TQFA 1T4CA 3R3YA 1TT5B 3ETHA 3JQEA 3NRCA 5DRTA 3RUHA 3OZRA 3UY4A 1Y1SA 2D5IA 3T52A 1UMKA 4EEZA 1Y5NA 1KJ8A 1ZNXA 4FDVA 1NTOA 5E38A 1GTVA 1QK3A 5EERA 2X0JA 4EFKA 3NT4A 3OJWA 1L5ZA 4RLSA 5TMEA 2WUFA 4HDQB 1PWXA 1ZMRA 2OMEA 2QT0A 3BIXA 2H1IA 4AL4A 2X2EA 1ITZA 2FQ1A 2QRPA 3FAKA 3R7WA 3S7ZA 3ZPXA 4II2A 1ZD1A 5AWFC 3CWQA 5DK4A 3ZZNA 4Y2XA 1L6RA 1R7RA 5B6PA 1C8KA 2PD3A 2YICA 1NBHA 3A2KA 2OGWA 4MCHA 2BLLA 3NR2A 1K89A 1WIWA 5THXA 4GI3A 2HCJB 3B6MA 1HEYA 1SOVA 3OLQA 2O0HA 4F92B 3D5QA 2ZYAA 3JSXA 2BUCA 1G5HA 2NNWB 1AK9A 3QPCA 3I01M 4KQ9A 1Z0SA 1G6OA 2FWJA 1CUUA 1SKUA 1T9BA 1UIMA 2W2TA 2ERXA 2BZ0A 2ZJ0A 3KV1A 3UGJA 3AO0B 4ALKA 1I4DD 5BNTA 3WGKA 1GZ6A 1RPTA 3BICA 1G20E 1INLA 1P29A 3N2GB 3NQ41 3T38A 4B6EA 2H4YA 3G2LA 4F1WA 4DHWA 4I2VA 2A9JA 2X0RA 2QV7A 3HUTA 4YYEA 3R9XB 3WJAA 2JA2A 1L8AA 3LQQA 3C3BA 3QFRA 5KQPA 4W5HA 3LT4A 1TYBE 5E6RB 1U3WA 1YFKA 2BAGA 1L5LA 3W5DA 1BAPA 2P5SA 2R97A 4IIEA 3BCHA 1UT6A 4L74A 5GM1A 4G4GA 5GQSA 2ZJ2A 2VOEA 1GV1A 1J8FA 1E1MA 3IPCA 3IR6A 2A1UA 3OKAA 4AMVA 4E5KA 3FSGA 3AFHA 4MPDA 4YJ3A 2V8OA 4QHTA 4D9NA 1E2IA 2QI9C 4H1HA 4BYMA 5DHQA 1KVTA 3QUAA 3V4FA 2CJYA 3HZOA 9LDBA 4L5JA 5KZMB 3SJZA 1PSDA 2H16A 2J3QA 4RY0A 2Q99A 2P6OA 5FORA 1J90A 1IDN1 2GHIA 1SC3A 1ZI6A 3D4OA 4Q37A 4W9NA 1DQZA 1M2FA 4GL2A 4H0FA 3OY7A 2ECFA 3DZHA 4GLOA 1TCBA 4KIWA 4BFLA 1L7EA 4FUQA 4DDVA 1OWNA 3VAAA 3U7HB 3LC2O 2JLZA 2XMPA 3M6AA 3FLEA 4AJKA 5F5NA 1UP4A 5GM2A 5HIKA 1JQKA 1UIRA 3HCNA 4IQGA 4UM5A 2I3DA 1HETA 4AG3A 1NYLA 1KIFA 1S6YA 1SXPA 4NY1A 1NVUQ 4EZEA 4DKJA 2PR7A 4DN6A 3M6LA 2FF5A 4KL8S 4HJRA 5BYJA 3V32A 3IVXA 3QJ5A 2DWUA 4RHTA 1JR6A 3PEUA 2ANBA 3O4JA 1NMSA 4MV8A 2DM6A 4B3XA 4D41A 4KP7A 4MCIA 2FG5A 4R31A 5LLTA 3IKJA 4U7GA 4OGWA 4F7DA 4TM8A 1DZIA 1E2NA 2BMFA 4M1TA 4UE2A 5C81A 1ARZA 2WDPA 3VZBA 1YZLA 1CZRA 3WNDA 4B33A 4D9GA 3BXFA 3GLVA 4HRYA 4ZVSA 2PMFA 2JBWA 4M76B 1I1HA 1ULZA 3RASA 5FX2A 2FE4A 3H3JA 4C3VA 2X5XA 1L7DA 4I4CA 4DR5B 4Q4JB 2VQDA 4M87A 4S1VA 1TUGA 1BE0A 2X9VA 1PEAA 2EAUA 1PR0A 1RRVA 3EEYA 4LV6A 4CM6A 5KQRA 2IUEA 4IQ8A 1VXRA 4E7OA 3AEYA 2QMOA 3CGGA 4OQYA 3RS7A 1C29B 2EKLA 4JJGA 4U7TB 4JQSA 4XTRA 1M1NB 1YO6A 3LC7O 1OA0A 3B1YA 4MWCA 4OLJA 2NO5A 4DIOA 4B3SB 4M1EA 2AQHA 3DV9A 1MV5A 4PZYA 4PIVA 2XCLA 4GMHA 2CV2A 2XBMA 1GQOA 4MRAA 4BATA 4KSCA 3LSYA 2FEKA 3LPNA 3NOXA 2G6BA 1SK9A 1AXEA 3CW9A 4D74A 1Z7EA 4RHYA 3ZGLA 5EPOA 1ZX1A 4YV7A 1X13A 1A9ZA 1JU3A 2BEJA 5CYFA 4PPYA 3A6DA 5LXTA 4KFSA 1F8XA 4US1R 3FCEA 5BWLA 2PBRA 1KKLA 2JDIA 4C4AA 1W76A 4QX6A 4NXNB 3EGVA 2DUWA 3IT0A 2WD8A 3GCWA 3RC8A 2ZU6A 2FW6A 4HXEB 4DMFA 1JEAA 3KB1A 2CEKA 3WSTA 4DJJA 4Y6OA 3WHIA 1UBHS 3SXJA 2W48A 3O0TA 1A2QA 1E92A 4XCVA 4ZICA 4MR7A 4D4GA 3KYDA 1UJNA 4RPCA 2YHSA 4KJXA 5FTKA 2G36A 2L19A 5A6SB 1FTQA 1P0MA 1T2NA 2ZXEA 2CN1A 3C3YA 2I2BA 3P27A 3QLUA 3WLIA 2DH5A 3FMIA 3QPDA 1ZR2A 2IUUA 3U4CA 4I1SA 4DCOA 1K2WA 2ISQA 3GWGA 2BP7B 4HQ6A 2CYAA 2ZRGA 3EGIA 4ZCSA 4EGJA 2I80A 4LV8B 1KEEB 3OQHA 2F17A 3OT1B 3DO6A 5KJ1A 1W49A 3PSHA 5BNWA 1M33A 2DYKA 2R6GA 3ST7A 4QUKA 4ZI7A 4FP9A 4HLUC 5CT9A 4FFNA 2FKAA 1E9FA 4QXMA 10MHA 5KYVA 3QNUA 4U6NA 2YW9A 2HD4A 5CLHA 2HYDA 2CNWD 1TEHA 5A4JA 3ZDEA 4RTLA 2CKDA 4E22A 4UXJA 2QRZA 1KMHA 2BEKA 3TI9A 4EO4A 1DRUA 1E94E 1KDTA 3ZQUA 4A0GA 5DK6A 3SMVA 3CRVA 4OX9B 2O8BB 2EFJA 3ZW8A 5DLYA 1GV0A 2PLWA 3WKDA 1WX1A 3IYLW 5D5QA 4AJEA 2CFOA 1QFZA 3LHDA 1CLEA 4HX9A 1OXVA 2FP3A 2VIIA 3H11B 3HZZA 4PM4A 4X1KA 5HZMA 1DIRA 5IVPA 1U80A 1W59A 5SZHB 2ST1A 3A37A 1NY6A 3IHKA 4YMSA 2JHGA 4WXYB 5EKXA 3L77A 1T2UA 3EMVA 2M2IA 4H0CA 2BSAA 4NH4A 4KXNA 2YWJA 4RF3A 4TVOA 2ZIXB 3ABSB 3B9QA 5E3JA 4QNNA 4FDUA 3FYUC 1KSGA 3MTBA 1ZZEA 3GT7A 1X87A 3UTDA 4XM1A 3U7RA 4IIXA 1J8QA 1PFQA 2X6RA 4RMGA 2WTXA 3AV0B 3CTMA 3NHSA 3OOJA 4KRYA 3KEFA 3ZNPA 2CUZA 3L40A 2CNOA 1JSZA 3OAAA 1G59A 1H5QA 2E6UX 5JCJA 3C4VA 2E21A 2K4MA 1JIJA 2B6HA 1YDWA 2PXHA 1XJWA 2WV7A 1NN0A 3DMGA 1CY1A 1FMTA 5AI5A 3ZV7A 1JG2A 5MGBA 1PWZA 3AMVA 2CYCA 4GNKA 4L4SA 1JT2A 4RVHA 1N2IA 5AKEA 1U7DA 1KDZA 5A5FA 3AFNA 2QVXX 3GH3A 5IYZF 1ZH4A 3RCBA 3H11A 4X1KB 2C3PA 2ZBFA 3JQFC 5TGZA 2RH5A 2VA8A 2FMIA 4I19A 4KFTA 4N0QA 5IKOA 1M5UA 3WLPA 2EBFX 3FHOA 5IBQA 2RI1A 3GUUA 2YIDA 3QMVA 5JS7A 1VLMA 2YN2A 2XEDA 1ZIDA 2IDMA 4NU8X 1OB5A 1GL7A 3QXGA 4B7AA 1AXGA 1FP2A 4XEUA 4QC2A 2YZNA 2G67A 1YR9A 3NWPA 4JV5B 4CL3A 4OHWA 4PYMA 3M1LA 3THWB 1LGYA 1F2UB 1KI9A 1JIXA 2TRSB 4GKAA 4H7DA 1WNFA 2D5AA 3ZDYB 1UBUS 4HEJA 1TU3A 5HJ5A 4N41A 1GPJA 5FI0B 4ZVRA 2N1BA 4G67A 5C4IA 4ZCQA 2CHFA 3IEXA 2O7VA 2QR3A 3FNGA 3KTDA 3Q3HA 1JZTA 4BNFA 4B40A 1PTKA 2ZQYA 1Y8QB 1QSGA 2R8BA 4FXOA 1MAAA 2BM9A 1RQRA 5A06A 4H6XA 2ZYHA 5KJ6A 1OZFA 1XP5A 5H0IA 2FY8A 2RFLA 4PV7A 1OC2A 1P5HA 2QD3A 4HPWA 4BV8A 4UFPA 3AJDA 3E70C 3OO1A 1NSTA 4JXJA 3C8DA 5ER6A 3WFZA 4N65A 2XECA 1ADFA 1VMKA 4HFRA 4ZT7A 4B6SA 3TFOA 2O8DB 1AQLA 3NONA 2C29D 1G8JA 2J0QA 3G5AA 2OP0A 3F5DA 2GK7A 1OE0A 4FS8A 1DLJA 3A26A 3DXYA 5ILGA 3EH1A 4YAUA 1DFGA 2BRUA 1N7IA 4ZC1A 2FFHA 2C1XA 4MNTA 1N9KA 2R5FA 4RZ3A 2C9CA 1AD2A 1DX6A 1F0YA 2YDXA 3LY5A 4FBMA 3HABA 5AJUA 1M6HA 4FQ5A 5ED0A 5BSTA 3ASVA 5KCMA 2R2AA 4L9AA 5IAAA 3DZFA 5JARA 1RWXA 4XYEA 5AVKA 1P4JA 3PKZA 3FSEA 3X1DA 1HZJA 1A71A 1QYCA 3KUCA 4MQUA 3H75A 1JLLA 4QUDA 4WNYA 3UJPA 1PSWA 1I2BA 4J1NA 3UCEA 4J7XA 4PFQA 4Y7DA 1S3IA 3AJRA 2V1UA 2O8DA 3HK2A 5A4MS 5KVQA 1XGKA 2V7QD 1BD4A 3PCTA 4XA8A 1V0JA 3P9CA 5D1HA 3FPUA 1V16B 2YWXA 2JKVA 3DBLA 2GPAA 3JQ8A 4ID3A 1MZPA 3RLFA 4BEJA 1U9IC 4PXSA 4RU1A 1UXKA 2AB0A 3UOAB 2OV2A 3BK7A 4ONEA 5CNKA 5L51A 4KXXA 2FEXA 4D4JA 2A58A 5AW7A 4Q82A 3OCXA 3IIIA 5EPUA 1HE8B