2GFAA

Double tudor domain complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
107
Chain Sequence
ALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Jumonji domain-containing protein 2A
publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 107
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfaA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gfaA02
3C4SA 2L3RA 3P8HA 3L2VA 3L2UA 4BDZA 2BIVA 2LCCA 2LRQA 3MEUA 4C5HA 2B8AA 4BD3A 3S3OA 5KH6A 3OQ5A 4II1A 5KCOA 3OMGA 4IUUA 5J26A 2JZ2A 4C5EA 3MP8A 5J39A 4PLIA 4IKFA 2RJDA 3LGFA 3QKJA 4A4GA 2X35A 2EQMA 1WJRA 2RHIA 1WJSA 5C6SA 3LLRA 2XDPA 4E7HA 5FROA 1OZ3A 4RG2A 2JTFA 3O8VA 3EAEA 4N4GA 4HCZA 2M16A 2L89A 2RI5A 3UWNA 2DIGA 2RHXA 2L8DA 2RO0A 4IUPA 4ZTJA 3MEWA 4QQDA 3MO8A 1SSFA 3H8ZA 1WJQA 3L42A 2VYTA 3LGLA 3MEAA 2P0KA 3OY9A 3FEOA 5KCHA 2PQWA 4E7JA 3DB4A 4QVZA 4C5IA 2X4XA 2BUDA 1MHNA 3QBYA 3L2QA 3KUFA 3OS0A 4PLLA 3QJ6A 3ZEHA 3LX7A 4FL6A 3NTHA 4OVAA 2HQEA 5D6WA 1OYXA 5C0MA 3GOXA 5FRMA 5IAYA 2M0OA 2R57A 2R5MA 2CKKA 5KE2A 4FU6A 2XK0A 3M9QA 4A4HA 4IUQA 4X34A 4A4FA 3OS1A 3OYNA 3OYKA 4E7IA 3P8DA 3OYCA 2DAQA 2GFAA 4A4EA 2LDMA 3E9GA 3LYIA 5D6XA 1OZ2A 3OYAA 5M9OA 3ME9A 4IURA 2K3YA 3FLGA 3PFSA 2O4XB 2F5KA 3L2RA 4QW2A 2K3XA 1WGSA 3MP6A 4BE1A 1H3ZA 4CRIA 3OYDA 2QQRA 3E9FA 3NTIA 4BE2A 2RJFA 4BACA 2BKDN 4N4IA 3DB3A 3ASKA 2EQKA 3SD4A 3OS2A 3OA6A 2MWPA 3PMIA 3META 3OYBA 2MWOA 2RHUA 2YRVA 3S3NA 4Z02A 3Q1JA 4LD6A 3OYHA 3FC3A 5D6YA 4B9WA 3UT1A 1KHCA 3QIIA 1OI1A 3CEYA 3OYGA 3S3MA 4E7KA 2GFUA 2E6NA 2RI3A 4L59A 3LH0A 3F70A 4GY5A 4BE0A 2RJCA 1RI0A 3PMTA 4NS5A 2D9TA 4E7LA 3PNWC 2LTOA 2WACA 2GF7A 3OYMA 2E5QA 2FHDA 2LVMA 2X4WA 5CIUA 3OB9A 4C5GA 1G5VA 4ZTFA 3NTKA 3S6WA 2R5AA 2RI2A 4IUTA 3OYFA 3BDLA 3H6ZA 4PL6A 2NLUA 2O4XA 3MP1A 4QQGA 3OYIA 4B9XA 3OYJA 5KE3A 2EKOA 2RHZA 5FRNA 4IUVA 1XNIA 4Q5WA 3L2WA 2R58A 4N4HA 3OYLA 2RJEA 2X4YA 3MEVA 2G3RA 3DLMA 2DIQA 4QQ6A 2RHYA 5IN1A 4UC4A 3OYEA 1N27A 2HQXA 2EFIA 2M1HA 2EQUA 2QQSA 4BDYA 3FDRA 3OMCA 4EDUA 2IG0A 2EQJA
chains in the Genus database with same CATH superfamily
3P8HA 4M7AB 2BIVA 2FZGB 1D0YA 3JB9G 1PNJA 4A4KA 4KDIA 5DM7R 4LDUA 4IUUA 5HCKA 4QT7A 1ZHIA 4ELYC 2BZ8A 1Y57A 1IHWA 3ZJTA 1PKSA 2F2XA 2YVLA 2KRNA 1AEYA 2J6FA 2CYZB 5GAOp 3I56Q 2IIMA 2QYZA 1RAHB 3MEAA 3VRZA 2HL5C 3EH1A 2VWFA 3VS7A 1I4K1 3QWXX 3OSVA 4XU0A 5FTKA 5GANj 4XTXA 4AMCA 4BI4A 5AYFA 3QJ6A 4C8QE 3CC7T 1EZZB 4HT9A 2L0AA 4M7AE 4A4HA 4M78F 4B6MA 3SEMA 2KQWA 2MAMA 1TH7A 2Q1AX 2AZVA 3MP6A 1SG5A 4J9CA 4XAXB 1TXQA 4NOYA 4MDWA 4KH1B 2DL8A 3LW5E 1W2BP 3CMET 4M75E 1M90C 1WHJA 1E7OA 3Q1JA 3QSUA 5KYUB 3FPTA 2CT4A 1FMKA 1M8MA 2D9TA 1ZA2B 1JEGA 2JM8A 2WACA 2K3BA 5LJ3h 3CCRT 3SB2A 5C1BA 2DO3A 1YWPA 2DXBA 2DZ9A 3MP1A 5L8RE 1FMWA 2DETA 2QA4Q 2K7AA 3P8BB 2KEAA 2VKNA 1S72A 3M5AA 2O2OA 4FM4B 3MJXA 1VQLA 7AT1B 2DTIA 2JN0A 4DQ2A 3QYHB 2K5LA 5KCOA 4F17A 2DL5A 2ZPEB 3LHDA 3OS5A 4OGCA 5J26A 4C5EA 2EJGA 3EGXB 4OMLA 2LCSA 4KLNA 3CCUQ 1NPRA 2VASA 3CC4Q 1BCOA 3QKJA 4PJOG 2A37A 2EQMA 2RHIA 1YI2Q 5I2SA 2A0FB 3LWIA 2QXFA 3FJPA 1BK2A 1YJWA 2K2VA 2V8JA 1QVFP 1YCSB 2AT1B 4AFSC 2MI6A 4HVUA 1VQPQ 3H0HA 2K5FA 4XU2A 2E5KA 1JJ2A 3TIWA 1TTHB 1BI2A 4E7JA 1BI0A 1G3WA 2BUDA 1WFWA 1MHNA 1PHTA 3QO3A 3OS0A 2PTKA 2LJ1A 1HD3A 1NZ9A 1RLQC 1VYUA 2XICA 2EIFA 1QVGS 1M90U 2DTHA 1K4US 4LUEA 5IHNA 4MDXA 1YJ9Q 2O4XB 4CC3A 2SRCA 2GQVA 1FYNA 1Y07A 4JJCA 2QG9B 1TG0A 3RMSA 3CPWP 3META 1BI3A 1UGSB 1Q95G 2CH4W 1FXXA 1PSFA 3S3MA 1X6GA 2YUPA 4OF1A 2CUDA 2HDAA 3CMAT 4M7DB 3UATA 2LVMA 2X4WA 3OW2P 2EJ9A 3GBQA 3A8HB 4IUTA 1T3LA 5A0GA 5CK9A 1NEBA 1NLOC 1Y96A 2CT3A 3CC2Q 1X6BA 5I2MA 4M77G 1RACB 3JRZA 2E1HA 1B3QA 1I5OB 5IN1A 4MZTA 3EFRA 2FEIA 3HHTB 5GAOm 2OI3A 1LJOA 1M1FA 3PTAA 1PKTA 5FWBA 3MP8A 2MCNA 3UA7A 1H641 3C94A 2YWWA 1GFCA 2RJDA 1K0SA 4LDVA 5C6SA 5GAN2 4M7DE 4M75G 5FU6C 3REAB 1RAGB 3NGPA 1MMGA 1MMDA 2QGFB 5EG2A 4JRPA 2EGEA 1QLYA 2GQIA 1VQ6Q 1N9RA 2V1QA 1WJQA 2WSEE 4FT4A 4QVZA 1U5SA 3L2QA 3KUFA 3CXCA 4DOVA 1NM7A 1ZUYA 1OYXA 4KUDK 5KYYA 2DZCA 4F7UG 1Q86R 2I2LA 1AWOA 5CO7A 1LCKA 2IVWA 4C92G 4J9EA 3A8LB 2QI2A 1R0CB 4IURA 2PWYA 2RD1A 1ZSZA 1RAIB 1OX8A 5CKHA 1VQLT 2FVUA 4KT0E 1TUCA 2ZPIB 3CCSA 4KGZB 1VYVA 3OA6A 3PMIA 1W6XA 2YRVA 4F14A 4ANJA 2G6FX 4E7KA 2KR3A 4L59A 1PC0A 3QHSA 5A2QE 1UJ0A 1UG1A 2OJ2A 3BE3A 1VQ5A 2OTLQ 3V7CA 2P84A 1QW1A 4PL6A 2C06A 2W10A 5HKCA 2DRKA 2QDLA 1ZX6A 4FCYA 1VQOA 3VS3A 2P4RA 1HXDA 1N27A 2HQXA 3CCET 2OAUA 3QQ8A 1KD1R 3EG9B 3WVDB 3SHWA 4C5HA 2O9VA 1NG2A 4MZMA 1SPKA 3MHXA 1Q7YR 3PT9A 2M0YA 4F16A 4OB0B 4HXJA 5J39A 1W2BS 2WSCE 3UPUA 1W70A 3CCQQ 1R7RA 1D1CA 2DTOA 2C0OA 4M4ZA 1GFDA 3LLRA 1OPLA 3FPRA 2QEXQ 2KT8A 5FROA 2DLPA 1X69A 1JU5C 2M16A 2AHJB 3JCMQ 2ZAEA 2CP6A 8AT1B 2L8DA 1VQNQ 4C0DC 4J8OA 2P0KA 5J3BA 2JTEA 1M3AA 1TUDA 3EHQA 2DYIA 1LNXA 2NWMA 4FL6A 2HQEA 1V29B 3G4ST 1OULA 3VS1A 2DAQA 2NUPA 4EMKC 1G2BA 2DYBA 3SWNB 1G83A 1N8RR 1WGSA 2QQAA 3CCLQ 3LWHA 5ECAA 1SSHA 5CQYA 4FYYB 2COWA 2RHUA 3S3NA 1YCYA 5I11A 1SHGA 3OYHA 3V8LA 1QP2A 1OI1A 3CEYA 3ZJVA 3LH0A 4LDXA 3F70A 4BE0A 2LW6A 4ARCA 5EQJB 3FIFA 1QVFS 1D0ZA 3A8OB 1NLPC 1Y96B 3DLLA 4RV0A 5CKFA 2Y4XA 2LX9A 3VUZA 2KE9A 4AT1B 3QWZA 3PGGA 5FRNA 3M0SA 3GF5A 4JLIA 1UE9A 3JCMf 2DIQA 4QQ6A 1CSKA 3I56T 2RHYA 1ABOA 3JCMd 3CC2A 1UTIA 4E2FB 1T0HA 1M1KC 5FU7C 5KYUA 2IPOB 2E3HA 2LRQA 1X75C 4OMQA 2K6DA 3M0QA 2YUQA 2D0QB 1MGQA 1VQ4Q 3CPWS 2XU8A 1R77A 1WJSA 2KDSA 4A54A 2ROTA 5GANe 2RNAA 3M0TA 1VQ8Q 1GL5A 4E7HA 1M8VA 2HCKA 2D8JA 2A3LA 2CP0A 2LC4A 1U8RA 3RERA 2MM2A 2HZYA 3MO8A 3OW2S 5B6CA 2DJQA 5KCHA 4XTVA 1K76A 2NUTA 5LJ3d 1EIFA 4FYWB 3JB9F 1VQ6A 4OMOA 3EGXA 1VQ5T 2PUOB 5AT1B 2JW4A 1PSEA 4N0AA 3EG2A 4Y91A 3VS0A 1UGQB 2F5TX 3JV3A 1TWBA 4JUVA 4FU6A 5I21A 3M9QA 3CCRA 4PFZA 4BI8B 1OPKA 3OYAA 2QASA 4RMOA 1VQ7A 1GCPA 2QA4T 2AKKA 4DOWA 3G71A 5LJ5j 4BE2A 3TREA 3BW1A 2ZCFB 2KSSA 2X4JA 5DYIA 5I22A 3BY7A 3MB5A 4PJOC 2GBQA 2RB6A 1H3HA 3VS4A 4BI3A 3OYGA 2JV2A 2DERA 4ATOA 5GMKm 2OAWA 4NS5A 2JS0A 4O5VA 3V8JA 1AWXA 3VJPA 1K8AC 2ED0A 2E5QA 2JMAA 1DJ7B 3X25B 4ESRA 3CC4T 4ZTFA 1YI2T 1M1KU 2O4XA 4QQGA 3OYIA 4M78B 2F69A 2HBWA 4ZN1A 5CCXA 4IUVA 4Q5WA 3RMQA 1GCQC 2BZXA 5GAMe 3A1PA 4UC4A 3OYEA 1VIEA 1VQPT 2ZGWA 4Y28E 1K9MR 5CQXA 4PJMA 5GAN7 5KH6A 3JCMJ 2ZPFB 4M7DA 2FL7A 2HSEB 3M54A 2GCXA 1WZOA 4BY6B 5CD1A 4BY6C 3VYHB 1UECA 2CP2A 4E7SA 1WLPB 5GANh 1YJ9T 3H0IA 4ZGEB 5CCBA 1OOTA 2XIDA 1QP3A 3ULRB 5GAN8 3MKDA 1CZ4A 3JB9H 4M78E 4ZTJA 4DBRA 3HU3A 4OMNA 3CD6Q 4RTTA 4OMMA 3A8GB 4M77C 5D6WA 4C0GA 1C0MA 3CMAA 2NUPB 3EGDB 4E7IA 2CREA 2DXUA 1JJ2P 2DL7A 2CZ0B 4PJOF 4JS4A 1M3BA 2RA2A 4RTYA 2KK4A 4FIBA 1GRIA 3CC2T 1H3ZA 3E9FA 3NTIA 3KFVA 4BACA 1K8AU 1UHCA 3RBBB 1UB4A 1U3OA 2EQKA 5GJVB 3G1JA 2DK3A 2HL3A 5D6YA 1D1AA 1A0NB 2EW3A 1S3SA 3RNJA 5GAOl 1ZC1A 2OTJQ 1KQSS 1ABQA 2CP5A 3GNFB 3S6WA 1M9SA 4XQ3A 2EGCA 4EPCA 5DLOA 1WHHA 2QTXA 1AHJB 5GAMh 2JXBA 5L23A 3JSCA 1U06A 3HSBA 2XI9A 3HFNA 2EFIA 4XTZA 2CP3A 4C92C 1VQ6T 3OMCA 3OBWA 2RQTA 3QZ5B 4EMHA 1K73C 3RUXA 3HFOA 3L2UA 2RQVA 1SKUB 1WNLA 4ZGDB 5GMKe 1CR5A 1NYGA 1VQKQ 2VXFA 2NYSA 4MZPA 1ZBXA 3V7SA 2YT6A 1VQ7T 3CBPA 1YN8A 4HVWA 4JRKA 3CCJQ 3G71T 1WQ7A 1UGVA 2VB6A 4E6RA 3L1AA 1OZ3A 2JOYA 3A98A 1VQMQ 1VUBA 1UHFA 1IGQA 2KROA 2DX1A 4M77F 4J83A 4X9DA 2BTTA 3L2ZA 2DE0X 1SSFA 2NUTB 4OMPA 4Z89A 2KNBB 3EG9A 4LD9K 4JRQA 1VQ9Q 4OVAA 3THKA 3NFCA 1YBYA 3VS6A 2D6FA 2YRCA 4IUQA 4A4FA 2OTLT 3ZFJA 1PM3A 1OEBA 1BIAA 1ZQ1A 2L3SA 3H9NA 1UJYA 3CXCP 4M75F 1OV3A 3JB9J 1YJNQ 4AG1C 2YUNA 2V26A 2BKDN 3M4GA 2YLCA 4MMKA 1EFNA 3EG0A 3FPUA 3INZA 3CCEA 1PWTA 1QDNA 2YLBA 3OBYA 1YITQ 4J7IA 5LJ3j 2O9SA 3KBGA 4AS1A 3REBB 2AZSA 2HSPA 2JMCA 2QGGA 4F7UF 2E3IA 4HA8A 2MIOA 5GAN5 3CCQT 2P0PA 2RQUA 4C92F 1U1SA 1IGUA 1QKWA 3SWNA 1NJIR 4JLGA 4B9XA 2AIRB 2XDDA 1H92A 2D1XA 5KYNA 3JCMV 3UF4A 1KG1A 5EC7A 4J9DA 3T9NA 1YIJQ 1VQNT 4KDLA 1SEMA 2ENMA 6AT1B 5GLFA 3BQBA 1JO8A 1TU0B 4JRIA 1QMCA 5GMKh 1OU9A 3JCMb 2JZ2A 3M53A 3G4SA 4LDWA 3EFOB 4LXCA 3PVLA 3R6OA 3NHNA 2V8KA 1X43A 2Y90A 2QQ9A 1HK9A 4RG2A 1WXTA 5GANg 3CCLT 4FW2A 4C8QG 2RI5A 1EX4A 3UWNA 2DIGA 4M7AG 1ARKA 4ARIA 4O6JA 2HEQA 3J81E 1N9SA 3FB9A 3LGAA 2FZKB 2RQRA 3RKYA 1SRMA 1KQ2A 3GLXA 5IT9E 4RTZA 2EGAA 5LJ5f 4LE9A 2XK0A 5FU6B 2BE7D 1UEBA 5LJ5d 2J6OA 1B34A 9ATCB 1E6HA 4HT8A 1T3SA 4M78D 2A28A 2K3XA 3X20B 2C0IA 4LN2A 1M27C 2P0QA 3I56A 2RN8A 3DB3A 1I81A 3SFMA 1WA7A 1JXMA 2EVRA 4FYXB 1C6VX 5GAOr 3CCMQ 3HU2A 3TU4K 4K11A 1RI0A 3PMTA 4RTUA 4E7LA 1CZ5A 4IIOA 5KYWA 2LTOA 2GF7A 1WHGA 2EYZA 2KMTA 4X9CA 2ZPBB 2PUKB 1ZSGA 4KO8A 3GNGA 1VQ8T 2EKOA 2YUOA 4CC2A 5IXFA 2EPDA 1LPLA 3JCMg 2G3RA 5HK3A 1Y71A 1BYMA 2FPEA 2PZ1A 5GAMg 2J06A 2VGNA 4EDUA 2DKGA 1Q81R 2EKHA 2Q1CX 1I07A 1PD0A 2EWNA 2KXCA 2CUBA 1M30A 2M9UA 2JJ9A 2DEUA 3HKSA 4J9IA 4OGEA 1NE8A 4RKUE 2DM1A 1V1CA 4M78A 1AD5A 2ESWA 3TVTA 3JCMc 4JPBW 2QA4A 3NPFA 2OX7A 1QKXA 4N4GA 2XHCA 1FX7A 3VUBA 1UFFA 4BB7A 1X01A 5CVIA 4RG8A 2E70A 2E6ZA 3WVEB 1WLFA 1OU8A 3G6EQ 4KODA 5ERGB 1D3BA 3I5RA 1G3YA 4OB1B 1RAEB 4V2SA 4CQNA 2MK5A 3CCUA 3CC4A 1X2QA 5GMKl 4KULA 1YI2A 4FYVB 3VS5A 1AWWA 2DPPB 4AFUC 3AHUA 2CSIA 2XDBA 4C0DB 1Y0MA 2LJ3A 1SHFA 1RAAB 3VYGA 1VQPA 3OYBA 3RIRA 3X24B 3X28B 4D6WA 2HBPA 2K5IA 2X3XD 2WSFE 1KHCA 1YWOA 4J7FA 1KHIA 1LVKA 3QQ7A 3PVQA 4HCCA 4EMKB 3EGDA 1X27A 3AT1B 1MMNA 2R5AA 1MNEA 3OYJA 1YJ9A 5KE3A 4PNOA 3HTRA 1XOVA 1XJWB 1KC8C 4RCCA 5CKBA 1PG5B 3E1SA 2PVGB 2DA9A 2DVJA 3CBMA 2DBKA 3VRYA 1YIJA 2LCCA 3MEUA 4M7DG 5GAN6 4BD3A 2MF2A 4II1A 3CXCS 1MMAA 3LH5A 1HJDA 1CKAA 1KJWA 1CKBA 2HAXA 1QQJA 4Y92A 5A0LA 2PJHB 2CGHA 2VXEA 1KQ1A 1K8AR 1AWJA 2L89A 5FU7B 2B86A 1QCSA 4PKCC 2LNHB 2RHXA 2M51A 3L42A 2VYTA 1WHKA 3JB9I 1JRIA 4OB2B 1H8KA 4KH0B 4XK8E 4QVDA 3PIPA 2M0OA 2F1LA 5KYXA 1B34B 3E2UA 3TSWA 4KUIA 4A4EA 2LDMA 3E9GA 1IHVA 2O31A 3O5ZA 1OX9A 4QW2A 4AFQC 1O9SA 1YNZA 3VKIA 1UGRB 2COZA 5LJ3f 1S72Q 4C0FA 1IRXA 1QWFA 4RTVA 1VIFA 3OS2A 2MWPA 2HD0A 1VQLQ 5GJWB 3SDZA 4B9WA 5HK0A 1X2KA 3M0PA 5KYWB 3BDUA 1GBQA 1KC8U 2I0NA 1VQKT 2K2MA 3NMZC 1N8RC 1GXIE 3CCMA 1TOVA 4LNPA 2LNVA 3CCJT 2RI2A 1LOJA 3H6ZA 4E7ZA 1PRLC 2RHZA 1YJWQ 2JTMA 4PJOB 3QWYA 4N4HA 1VQMT 2RJEA 2X4YA 3GP8A 4J9GA 3M4YA 3VS2A 2COYA 1K9AA 3A5ZB 4HKEA 4PJJA 1NEGA 4WCIA 4WF2A 3HPWA 1ZSZC 2E10A 2EQJA 2ZPHB 1WQWA 2B8AA 1VQ9T 3CCUT 4KRTA 5FTMA 3JCMe 1K0XA 2PVDB 3X26B 4KGXB 1WJRA 2MPXC 2OTLA 1MV3A 2K57A 2L3PA 3EH2A 3QDRB 4RTWA 1YJNT 3O8VA 3EAEA 3OYYA 1GBRA 1TS9A 4F04B 2YHTA 2W0ZA 4PJOE 4QQDA 3LGLA 4DBHA 1YITT 2X4XA 5GMKi 1D3BB 1M3CA 4DA4A 1YHQQ 1M1GA 2RM4A 1M90R 8ATCB 1I8FA 3NTHA 2EYWA 3EFOA 3M0UA 3J7AF 1AZGB 3OYNA 3OYCA 2DMOA 2GFAA 3QC8A 3CBOA 1BBZA 3CCQA 3EG1A 1QWEA 4A53A 2F5KA 2QEXA 2QQRA 5GAOn 3U23A 1YIJT 3JCMX 1N8RU 3SD4A 2K79A 2JVVA 2HMAA 1VQNA 4M77B 2XG8D 3FC3A 2AKLA 2FPDA 1HSQA 2YDLA 3QIIA 3MCAB 2LT1A 4C8QC 1G3SA 3CQTA 1KSWA 1NPPA 4C0ZA 1MUZA 4M7AC 5DY9A 4LDYA 4JJDA 3OB9A 1G5VA 1ZBJA 1QVGA 1NBEB 2F2VA 4J6XA 4FSXA 3QDFA 3CCVQ 4L6V5 5HY6A 4AQ7A 3L2WA 1R0BG 2ROLA 1HYOA 3V7RA 3CCLA 2KRSA 1Q82C 4EIKA 5IXBA 2FB7A 1WHMA 4M75B 4M75C 2M1HA 1FWZA 1IB8A 2P4TA 3C4SA 4IIMA 3L2VA 4BDZA 3FRNA 1BKBA 2PU9B 2YUJA 2L5QA 4Z88A 2CZ6B 2D8HA 1SF9A 2RF0A 4M77E 1QCNA 3I5SA 3JCMh 3M56A 4IKFA 4PJNA 1M5Q1 4ELZC 2EAYA 4F7UB 2XDPA 2PVOB 2MOXA 4C92B 1K9MC 2LJ0A 2E12A 3CCSQ 3A8MB 1I5LA 2VV5A 2A7YA 5LL6S 1M2OA 3CCMT 2E41A 5KYXB 1YFNA 2R5MA 5LJ5g 3JB9D 3H41A 3ER0A 4ZNXA 1VQ4A 1IREB 1VQ5Q 5D6XA 4KGVB 3FLGA 2GGRA 2ED1A 1JQQA 1VQ8A 1OQKA 2VUBA 1VQOQ 4C8QF 1I1JA 2J6KA 4N4IA 3GPLA 4F7UE 4M7AF 4RCBA 3H0FA 4C92E 2F2WA 4PFOA 3I55Q 1K1ZA 5A0DA 3RKWA 1N5ZA 1PD1A 4JZ4A 1Q82U 1P92A 2Z0WA 5DYGA 1U1TA 2RQWA 2O88A 3BDLA 4R56A 2DILA 4P5NA 4R0KA 4GLMA 3RDVA 5GAMj 4DEXA 3M59A 1BB9A 4N0AC 1XNIA 4ME7A 2DBMA 3ZBDA 3EG3A 2DL4A 3RESA 1R8OB 1UUEA 4AG2C 2EYYA 3D7SB 2X3WD 4HCBA 2IG0A 2CDTA 1D09B 3G6ET 4EMKA 2LQKA 1WX6A 2QTVA 3ZJUA 1D0XA 1K9MU 2DRMA 4XTUA 2FRYA 4JDSA 4QKUA 1K73U 4PLIA 2MYSA 1RADB 2QEXT 4M78G 3LGFA 4A4GA 2X35A 1KK7A 2JNGA 3E19A 1ZA1B 2VC8A 1AT1B 1B7TA 4HVVA 4JJNK 2LQ8A 5D7UA 4X1VA 2KAFA 1W4SA 1RUWA 2XMFA 1M2VB 2RPNA 4JJBA 3MEWA 3KXTA 1XTDA 3OY9A 2M02A 2FG0A 4J9FA 2VVKA 4NL3A 1BI1A 2EYQA 1T0JA 3LX7A 3RKXA 2R57A 5GAN4 3HL8A 2HKQB 4X34A 3V8KA 1B07A 1YHQA 1W2BA 2QDYB 4CC7A 4A63B 1OZ2A 3ME9A 4M7DC 4VUBA 2KYBA 2NUZA 2H8HA 4PJOD 1BIBA 2ABLA 2CH4A 3HP9A 4RTXA 1G8XA 2CSQA 4ORZA 2EJFA 1S1NA 2VGMA 3QJYA 5FLXE 4J6YA 4LD6A 5GAOq 4OMFB 2QQBA 3CD6A 2A08A 4PFPA 2E6NA 4PJLA 3CC7Q 3PNWC 2J7IA 2FRWA 4C5GA 1E32A 5IH2A 4PK4A 3DKMA 1KFZA 3R6NA 4J9BA 1WXBA 2B25A 1RABB 2EBPA 4DBFA 3CCVA 2E65A 3CMEQ 1E6GA 3M0RA 1W1FA 2QQSA 1WIEA 5GMKj 4DEYA 3TCJA 2L3RA 2LZ6B 1VQ4T 3OQ5A 2HNIA 1NJIC 2FZCB 2AK5A 3HRSA 2CZ7B 1WXUA 2DD4A 4LUDA 2OTJA 2DF6A 1QVFA 2ZPGB 2SEMA 3CCRQ 1XQHA 2Q1DX 1SRLA 1UGPB 2YXYA 1VQ7Q 3WXMB 1Y7XA 4XTWA 4PJOA 3C0CA 5CKEA 3G71Q 2JTFA 3I35A 4QVCA 4BUGA 2ECZA 1JJ2S 1WPYA 1S72T 1ZLMA 2DNUA 3J80E 2LX7A 4M77D 4CI0C 3FEOA 1JB0E 2L3QA 1JXOA 4FSSA 1O75A 3VV0A 4M7DF 4C8QD 1TUGB 1KIKA 3TQ7P 3TEEA 1KC8R 4J6WA 2KY9A 1VQKA 1RAFB 4MMLA 5IAYA 3PIOA 1MNDA 2HKNA 4M7AD 5KE2A 1O54A 3OS1A 4D8KA 1GCQA 2YSQA 1VYTA 2CZ1B 3CPFA 3CPWA 3CCJA 3LYIA 3QYGB 5M9OA 2K3YA 3C95A 2KGTA 1YJWT 1TSFA 4CRIA 1VQMA 5LJ3g 4M75D 1VA7A 2DVEA 3ASKA 3EFSA 1RLPC 2KXDA 2MWOA 4NL2A 3OW2A 1IO6A 5LJ5e 1I0CA 3VU3C 2Q18X 3URGA 2GTJA 3BFMA 3UT1A 1Z9QA 4XU3A 2FO0A 2HQHA 2RI3A 2CS7A 1D1BA 1VQ9A 1ZUKA 2MMPA 3I55A 1M1KR 5FW9A 1F1BB 4WTOB 3NTKA 4D8DA 1AOJA 2JUFA 2JM9A 2Q19X 4C92D 2RH2A 1YJNA 2DEQA 1NJIU 2V1RA 5FTLA 1Q86C 2QAZA 1V76A 5FTJA 2EQUA 3EGUA 2RK1A 2X9HA 4M77A 5GANf 5GAN3 5CCAA 1KQSP 3M55A 5GANd 4C8QA 2DFUA 1YITA 2QK0A 2H3EB 1BCMA 3S3OA 4RUGA 1YP5A 1YHQT 3GIBA 1RL2A 3OMGA 4M7AA 3CMAQ 4XTYA 1QCFA 3HRUA 5CR2A 2GNCA 3G7ZA 4HCKA 2C0TA 2BZYA 3PE0A 2FYKA 4GBQA 4EMGA 1Q81C 4HCZA 4M75A 4JS5A 3SWNC 2A36A 3CD6T 2RO0A 5IHKA 3OYKA 3H8ZA 3ZGZA 2H3JA 3DB4A 4C5IA 3QBYA 3ZEHA 1PRMC 3HU1A 5C0MA 4OP0A 2RK2A 4FT2A 2XKOC 3UA6A 1KD1C 1IXDA 4F7UA 2DL3A 3JAME 3CCVT 4C92A 3L2RA 2E4HA 4BE1A 1IZ6A 2CP7A 2RJFA 3UDCA 1BU1A 2EQIA 1Q7YC 3HRTA 3EHRA 2MM0A 5LJ5h 4Z02A 4ZN3A 2EYXA 1FMVA 5EPPA 5C18A 2OTJT 5CAIA 2GFUA 5GAMf 2GTOA 4GY5A 2Y4YA 3JCMP 5GAMd 3C12A 3TSZA 2O01E 5CIUA 1Q86U 4J5YA 2DD5A 3OYFA 3CC7A 1I9GA 2J05A 1ZUUA 3OYLA 3MEVA 3DLMA 1WDXA 1N6AA 3QUIA 3IQLA 2ZZDA 3CCST 1QVGP 3CF2A 1AZEA 3FDRA 4GLKA 2RMOA 2D0NA 3MPUB 2JT4A 3CMEA 2LP5A 2JS2A 1NYFA 1Q81U 4J9HA 2KYMA 1KQSA 3N5BB 5KYYB 3M58A 5CKDA 4M7DD 1QVPA 2V8IA 3QG1A 2LQNA 5FTNA 2FPFA 3RR6A 1VQOT 1ZSZB 2LQWA 3OSSC 1UDLA 2BE9B 4IUPA 3CCEQ 2DJZA 2K9GA 2PQWA 3M57A 1KD1U 2DXTA 3QPHA 3I55T 1RI9A 2KBTA 4AFZC 1WYXA 2LT4A 4PLLA 1ACMB 5FRMA 3GOXA 5DLQE 2XD0A 4OB3B 1Q82R 5FWCA 1Q7YU 2CKKA 2DXCA 1VOMA 1AVZC 2KT1A 3P8DA 4ZGJB 4E47A 4CC4B 1C1AA 1WHLA 3PFSA 1M4ZA 3OYDA 3I9QA 1X6OA 2L2PA 1M2VA 2LMJA 4YTLA 4M78C 4FW1A 2ATCB 3QZ9B 4JZ3A 3FJ5A 2KRMA 2E64A 2LCLA 2YRDA 3JCMW 1J3TA 3G6EA 2RJCA 4Z8AA 3G4SQ 1G3TA 3OYMA 2FHDA 1K73R 1PCXA 1MV0B 2KI7A 3QXEB 5LJ3e 2KVQG 1QCOA 2NLUA 2K4YA 1Z9ZA 2R58A 4KBMB 4DBQA 1JBMA 5IHIA 4TVRA 1WI7A 4R55A 3ZL7C 4BDYA 4XU1A 4C8QB 2X51A 2PNIA 4L5GA
chains in the Genus database with same CATH topology
3P8HA 4M7AB 2BIVA 2LRQA 1X75C 2Q1CX 3JB9G 3G6ET 2EWNA 4EMKA 2LQKA 4A4KA 4KDIA 5DM7R 4LDUA 2M9UA 4IUUA 3ZJUA 1K9MU 2D0QB 4XTUA 3HKSA 4OGEA 1MGQA 1ZHIA 4JDSA 4ELYC 1K73U 4PLIA 2QEXT 4M78G 3LGFA 3CPWS 2XU8A 1NE8A 4A4GA 2X35A 4RKUE 2JNGA 3E19A 1WJSA 2KDSA 2VC8A 4A54A 4M78A 3ZJTA 4JJNK 5GANe 3JCMc 2QA4A 4E7HA 2YVLA 2LQ8A 1M8VA 4N4GA 2XHCA 2CYZB 2KAFA 1W4SA 5GAOp 2A3LA 2LC4A 1FX7A 1U8RA 3VUBA 4BB7A 1X01A 5CVIA 3RERA 4RG8A 2MM2A 3MEWA 2E70A 3MO8A 3OW2S 3MEAA 3KXTA 1XTDA 3OY9A 5B6CA 1I4K1 5KCHA 4XTVA 2E6ZA 3WVEB 3OSVA 4XU0A 1WLFA 5FTKA 5LJ3d 1EIFA 4XTXA 5GANj 3JB9F 4NL3A 1VQ6A 4BI4A 5AYFA 1BI1A 3QJ6A 4C8QE 2EYQA 3LX7A 1VQ5T 3RKXA 2PUOB 3CC7T 1PSEA 4KODA 4N0AA 2R57A 4Y91A 5I21A 1UGQB 2F5TX 1D3BA 3HL8A 4JUVA 1G3YA 4FU6A 4OB1B 5GAN4 3M9QA 4A4HA 4M7AE 4X34A 4V2SA 3V8KA 3CCRA 3CCUA 4M78F 3CC4A 1YHQA 1W2BA 2QDYB 4BI8B 5GMKl 1VQ6T 4KULA 2KQWA 2MAMA 1TH7A 1OZ2A 3OYAA 4RMOA 1YI2A 1VQ7A 3ME9A 4M7DC 2DPPB 2QA4T 4VUBA 3AHUA 2Q1AX 3MP6A 2XDBA 4PJOD 4C0DB 1BIBA 4XAXB 4DOWA 3G71A 5LJ5j 4BE2A 3HP9A 4NOYA 3TREA 4MDWA 3BW1A 2ZCFB 3LW5E 2KSSA 2X4JA 3VYGA 3CMET 5DYIA 4M75E 1M90C 3BY7A 2EJFA 3MB5A 4PJOC 1VQPA 3OYBA 3RIRA 3X24B 3X28B 3QJYA 2VGMA 4D6WA 2HBPA 2RB6A 2K5IA 5FLXE 3Q1JA 4J6YA 4LD6A 4OMFB 5GAOq 2WSFE 1KHCA 2QQBA 4J7FA 3QSUA 3CD6A 4BI3A 1KHIA 3OYGA 2JV2A 3FPTA 3QQ7A 2E6NA 4ATOA 4HCCA 5GMKm 4O5VA 4NS5A 2D9TA 3V8JA 3VJPA 4EMKB 1K8AC 3PNWC 2WACA 3X25B 2E5QA 1DJ7B 5LJ3h 3CCRT 3CC4T 4C5GA 3SB2A 1E32A 5C1BA 2DO3A 4ZTFA 2DXBA 2R5AA 1YI2T 1M1KU 2DZ9A 2O4XA 3DKMA 3MP1A 4QQGA 5L8RE 3OYIA 4M78B 3OYJA 1YJ9A 5KE3A 4PNOA 2F69A 3P8BB 1XOVA 4IUVA 4ZN1A 4Q5WA 1KC8C 2B25A 3RMQA 5CCXA 4RCCA 5CKBA 5GAMe 3CCVA 3E1SA 2E65A 4UC4A 3OYEA 3M5AA 2PVGB 1VIEA 1S72A 2QQSA 4FM4B 1VQPT 2ZGWA 1VQLA 5GMKj 4Y28E 2DTIA 3CBMA 2JN0A 3TCJA 2L3RA 1YIJA 5CQXA 4DQ2A 2LCCA 3MEUA 2K5LA 3QYHB 4M7DG 5GAN6 5GAN7 4BD3A 1VQ4T 2MF2A 5KH6A 3JCMJ 3OQ5A 4II1A 5KCOA 2HNIA 2ZPEB 2ZPFB 3OS5A 4OGCA 3CXCS 1NJIC 3LHDA 5J26A 4M7DA 2FL7A 4C5EA 2EJGA 3HRSA 2CZ7B 3M54A 2DD4A 2GCXA 2OTJA 4KLNA 1QVFA 2ZPGB 4BY6B 1NPRA 1XQHA 5CD1A 2Q1DX 4BY6C 3VYHB 3QKJA 1UGPB 4PJOG 2EQMA 2HAXA 2RHIA 5GANh 5I2SA 3WXMB 3LWIA 1Y7XA 2QXFA 4XTWA 1YJ9T 4PJOA 4ZGEB 5CCBA 3FJPA 1YJWA 2K2VA 2XIDA 5CKEA 1QP3A 5A0LA 2JTFA 4QVCA 2V8JA 2PJHB 4BUGA 5GAN8 2CGHA 2VXEA 1KQ1A 1WPYA 2L89A 1JJ2S 5FU7B 1QCSA 1S72T 4PKCC 1CZ4A 3JB9H 2MI6A 2RHXA 4M78E 3J80E 4ZTJA 3HU3A 4M77D 3L42A 4CI0C 2VYTA 2K5FA 4XU2A 3FEOA 1JJ2A 3TIWA 1BI2A 1JB0E 4E7JA 1BI0A 1G3WA 1O75A 2BUDA 3VV0A 4M7DF 4C8QD 1JRIA 1MHNA 4OB2B 3JB9I 5ERGB 4XK8E 3QO3A 3OS0A 4QVDA 3PIPA 3A8GB 4M77C 5D6WA 3TEEA 4J6WA 2KY9A 4C0GA 3PIOA 4MMLA 5IAYA 2M0OA 1VQKA 4M7AD 3CMAA 1B34B 5KE2A 1NZ9A 1O54A 2XICA 2EIFA 3OS1A 4KUIA 2DXUA 4E7IA 1QVGS 1M90U 2CZ0B 2CZ1B 2DTHA 2LDMA 3CPFA 3E9GA 4PJOF 4A4EA 3LYIA 3CPWA 4JS4A 4MDXA 3QYGB 5M9OA 2RA2A 2K3YA 3C95A 2O4XB 2KK4A 4FIBA 4QW2A 1YJWT 3CC2T 1O9SA 1H3ZA 4CRIA 3E9FA 3NTIA 1VQMA 2GQVA 3VKIA 1UGRB 5LJ3f 1Y07A 5LJ3g 4BACA 1K8AU 4M75D 4HT9A 3RMSA 4C0FA 2DVEA 1UB4A 3ASKA 1VIFA 2EQKA 3EFSA 3OS2A 2MWPA 2HD0A 3META 2MWOA 4NL2A 3OW2A 5LJ5e 5FTJA 2Q18X 3VU3C 2DK3A 1BI3A 1UGSB 3SDZA 5D6YA 3URGA 3BFMA 3UT1A 4B9WA 1FXXA 1PSFA 4XU3A 5HK0A 3S3MA 2RI3A 2CS7A 1VQ9A 4OF1A 3BDUA 1S3SA 5GAOl 1KC8U 3CCJA 1VQKT 1ZC1A 3CMAT 2MMPA 3I55A 1N8RC 4M7DB 1GXIE 3CCMA 1KQSS 2LVMA 2X4WA 2EJ9A 2LNVA 3CCJT 3GNFB 3NTKA 3S6WA 2RI2A 3A8HB 4IUTA 1LOJA 5A0GA 2JUFA 3H6ZA 1M9SA 4XQ3A 5CK9A 4EPCA 2Q19X 1Y96A 5DLOA 2RHZA 2JTMA 2QTXA 2RH2A 4C92D 1YJNA 5I2MA 4PJOB 1AHJB 2DEQA 4N4HA 2RJEA 2X4YA 5GAMh 1VQMT 3GP8A 4M77G 1NJIU 3JSCA 3M4YA 3HSBA 3JRZA 2E1HA 2XI9A 5IN1A 1Q86C 5FTLA 3HFNA 2EFIA 3A5ZB 2EQUA 4HKEA 2RK1A 4M77A 3EFRA 4MZTA 4XTZA 4C92C 3OMCA 5GANf 3OBWA 3HHTB 5CCAA 3QZ5B 4WF2A 3HPWA 4EMHA 5GAOm 2E10A 1K73C 3RUXA 2EQJA 3M55A 3HFOA 4C8QA 5GANd 3L2UA 1YITA 2ZPHB 1WQWA 1LJOA 1M1FA 2B8AA 3PTAA 3S3OA 1VQ9T 3CCUT 1WNLA 4ZGDB 1YHQT 5GMKe 1RL2A 3OMGA 3GIBA 4M7AA 1CR5A 2VXFA 3MP8A 4MZPA 1ZBXA 4XTYA 3V7SA 1VQ7T 3CBPA 1H641 3C94A 3HRUA 5CR2A 5FTMA 3JCMe 2RJDA 5FU7C 4JRKA 2PVDB 4LDVA 3G7ZA 3X26B 1WJRA 3G71T 2OTLA 5C6SA 1WQ7A 2K57A 5GAN2 4M7DE 2FYKA 3QDRB 4M75G 3L1AA 5FU6C 1YJNT 1OZ3A 4EMGA 2JOYA 3O8VA 1Q81C 3EAEA 1VUBA 4HCZA 3OYYA 4M75A 4M77F 4JS5A 4J83A 4X9DA 5EG2A 4JRPA 3L2ZA 3SWNC 3CD6T 2RO0A 2YHTA 4PJOE 1N9RA 4QQDA 1SSFA 3H8ZA 1WJQA 3LGLA 3OYKA 2WSEE 4FT4A 3ZGZA 2H3JA 1YITT 3DB4A 4QVZA 4C5IA 2X4XA 5GMKi 4JRQA 4LD9K 3QBYA 3L2QA 3KUFA 1D3BB 4DA4A 3ZEHA 1M1GA 2RM4A 3CXCA 1I8FA 3NTHA 4OVAA 4DOVA 1OYXA 3NFCA 4OP0A 5C0MA 3HU1A 2RK2A 4KUDK 1YBYA 2D6FA 2DZCA 4FT2A 2XKOC 3J7AF 4IUQA 4F7UG 4A4FA 2I2LA 3OYNA 3OYCA 2GFAA 5CO7A 3QC8A 2IVWA 3CBOA 4C92G 3ZFJA 3CCQA 1KD1C 2OTLT 4F7UA 1BIAA 1ZQ1A 3A8LB 2QI2A 3JAME 4IURA 3CCVT 2PWYA 2RD1A 4A53A 4C92A 2F5KA 4M75F 3L2RA 2QEXA 3JB9J 4BE1A 1IZ6A 2QQRA 5CKHA 5GAOn 1VQLT 2FVUA 2RJFA 3UDCA 4KT0E 2BKDN 1Q7YC 3HRTA 3M4GA 2YLCA 2ZPIB 3JCMX 3CCSA 1YIJT 1N8RU 3SD4A 2MM0A 3OA6A 2JVVA 4MMKA 3PMIA 5LJ5h 1VQNA 3FPUA 3INZA 3CCEA 1QDNA 2YRVA 2XG8D 4M77B 4Z02A 2YLBA 4ZN3A 3OBYA 3FC3A 3QIIA 5EPPA 5C18A 2OTJT 3MCAB 4J7IA 5CAIA 4E7KA 2GFUA 5GAMf 4L59A 2LT1A 4C8QC 5LJ3j 1G3SA 4GY5A 2Y4YA 1NPPA 5GAN3 3JCMP 4AS1A 3KBGA 3QHSA 4C0ZA 5A2QE 5GAMd 3C12A 4M7AC 5DY9A 4LDYA 2O01E 5CIUA 4F7UF 3OB9A 4HA8A 1Q86U 1G5VA 4J5YA 2DD5A 5GAN5 1QVGA 1VQ5A 3CCQT 2P0PA 4C92F 3OYFA 4J6XA 3V7CA 3CC7A 1U1SA 1I9GA 1QW1A 4PL6A 3SWNA 4FSXA 2C06A 4JLGA 4B9XA 4L6V5 5HY6A 5HKCA 4AQ7A 2XDDA 3L2WA 3V7RA 3OYLA 3CCLA 1Q82C 3MEVA 3DLMA 1VQOA 2FB7A 3QUIA 1N6AA 3JCMV 2ZZDA 4M75B 3CCST 1KG1A 1HXDA 3T9NA 1N27A 4M75C 3CF2A 2HQXA 2M1HA 1FWZA 1VQNT 4KDLA 3CCET 3FDRA 4GLKA 5GLFA 3BQBA 2OAUA 3QQ8A 2P4TA 3C4SA 3WVDB 4JRIA 3L2VA 3CMEA 3FRNA 4C5HA 4BDZA 1BKBA 5GMKh 2PU9B 2YUJA 4MZMA 2L5QA 2CZ6B 3JCMb 4M77E 2JZ2A 3MHXA 1Q81U 3M53A 3JCMh 3G4SA 3PT9A 4OB0B 4LDWA 1KQSA 3M56A 5J39A 3N5BB 4IKFA 1W2BS 2WSCE 3UPUA 3M58A 1M5Q1 4ELZC 1R7RA 3R6OA 2DTOA 5CKDA 4M7DD 2V8KA 1QVPA 2EAYA 2V8IA 3LLRA 4F7UB 3QG1A 3FPRA 2XDPA 2PVOB 5FTNA 2Y90A 5FROA 4C92B 2QQ9A 1HK9A 4RG2A 3CCLT 5GANg 1K9MC 1VQOT 4C8QG 2M16A 2RI5A 3OSSC 2AHJB 2E12A 3JCMQ 3UWNA 3A8MB 2DIGA 2L8DA 1I5LA 4M7AG 4ARIA 4IUPA 4C0DC 4O6JA 4J8OA 2P0KA 5J3BA 2DJZA 3M57A 1N9SA 2PQWA 2VV5A 3FB9A 3J81E 1KD1U 2A7YA 2DXTA 3QPHA 5LL6S 3I55T 3LGAA 3CCMT 2LT4A 3RKYA 2E41A 1LNXA 4PLLA 1KQ2A 4FL6A 5FRMA 3GOXA 2HQEA 5DLQE 2XD0A 3GLXA 4OB3B 5IT9E 1V29B 3G4ST 2R5MA 5LJ5g 5LJ5f 2CKKA 3JB9D 1Q7YU 2DXCA 2XK0A 3ER0A 1VQ4A 1IREB 5FU6B 3P8DA 4ZGJB 2DAQA 1UEBA 4CQNA 4E47A 5LJ5d 1B34A 4EMKC 5D6XA 4HT8A 3PFSA 3FLGA 4M78D 3SWNB 1M4ZA 1WGSA 2K3XA 2QQAA 1VQ8A 3X20B 3OYDA 2VUBA 3LWHA 2P0QA 4C8QF 1X6OA 4N4IA 3GPLA 4YTLA 4F7UE 3I56A 4M78C 3DB3A 5CQYA 4M7AF 1I81A 3QZ9B 4RCBA 3SFMA 4C92E 2RHUA 3S3NA 1YCYA 3OYHA 3V8LA 1QP2A 2E64A 2LCLA 1OI1A 3CEYA 5GAOr 3ZJVA 3JCMW 5A0DA 3RKWA 3HU2A 3LH0A 3G6EA 4LDXA 3F70A 4BE0A 3TU4K 2LW6A 4ARCA 2RJCA 1RI0A 3PMTA 5EQJB 4E7LA 3FIFA 1CZ5A 1Q82U 1G3TA 2LTOA 2GF7A 3OYMA 1QVFS 2FHDA 3A8OB 1P92A 5DYGA 2KMTA 4X9CA 3QXEB 5LJ3e 1U1TA 2KVQG 1Y96B 2ZPBB 2PUKB 3DLLA 4RV0A 3BDLA 5CKFA 2Y4XA 4R56A 4P5NA 2NLUA 2LX9A 5GAMj 3VUZA 3M59A 4KO8A 3GNGA 4N0AC 2K4YA 1VQ8T 2EKOA 3PGGA 5FRNA 3QWZA 1XNIA 4ME7A 3GF5A 4JLIA 2R58A 3ZBDA 4KBMB 1JBMA 3JCMf 3JCMg 2G3RA 3RESA 2DIQA 4QQ6A 5HK3A 1Y71A 1R8OB 4TVRA 4R55A 3I56T 2RHYA 3JCMd 1BYMA 3CC2A 4BDYA 4XU1A 4C8QB 5GAMg 1M1KC 2VGNA 4EDUA 4HCBA 4L5GA 2IG0A 2DKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4S A;  2L3R A;  3P8H A;  3L2V A;  3L2U A;  4BDZ A;  2BIV A;  2LCC A;  2LRQ A;  3MEU A;  4C5H A;  2B8A A;  4BD3 A;  3S3O A;  5KH6 A;  3OQ5 A;  4II1 A;  5KCO A;  3OMG A;  4IUU A;  5J26 A;  2JZ2 A;  4C5E A;  3MP8 A;  5J39 A;  4PLI A;  4IKF A;  2RJD A;  3LGF A;  3QKJ A;  4A4G A;  2X35 A;  2EQM A;  1WJR A;  2RHI A;  1WJS A;  5C6S A;  3LLR A;  2XDP A;  4E7H A;  5FRO A;  1OZ3 A;  4RG2 A;  2JTF A;  3O8V A;  3EAE A;  4N4G A;  4HCZ A;  2M16 A;  2L89 A;  2RI5 A;  3UWN A;  2DIG A;  2RHX A;  2L8D A;  2RO0 A;  4IUP A;  4ZTJ A;  3MEW A;  4QQD A;  3MO8 A;  1SSF A;  3H8Z A;  1WJQ A;  3L42 A;  2VYT A;  3LGL A;  3MEA A;  2P0K A;  3OY9 A;  3FEO A;  5KCH A;  2PQW A;  4E7J A;  3DB4 A;  4QVZ A;  4C5I A;  2X4X A;  2BUD A;  1MHN A;  3QBY A;  3L2Q A;  3KUF A;  3OS0 A;  4PLL A;  3QJ6 A;  3ZEH A;  3LX7 A;  4FL6 A;  3NTH A;  4OVA A;  2HQE A;  5D6W A;  1OYX A;  5C0M A;  3GOX A;  5FRM A;  5IAY A;  2M0O A;  2R57 A;  2R5M A;  2CKK A;  5KE2 A;  4FU6 A;  2XK0 A;  3M9Q A;  4A4H A;  4IUQ A;  4X34 A;  4A4F A;  3OS1 A;  3OYN A;  3OYK A;  4E7I A;  3P8D A;  3OYC A;  2DAQ A;  2GFA A;  4A4E A;  2LDM A;  3E9G A;  3LYI A;  5D6X A;  1OZ2 A;  3OYA A;  5M9O A;  3ME9 A;  4IUR A;  2K3Y A;  3FLG A;  3PFS A;  2O4X B;  2F5K A;  3L2R A;  4QW2 A;  2K3X A;  1WGS A;  3MP6 A;  4BE1 A;  1H3Z A;  4CRI A;  3OYD A;  2QQR A;  3E9F A;  3NTI A;  4BE2 A;  2RJF A;  4BAC A;  2BKD N;  4N4I A;  3DB3 A;  3ASK A;  2EQK A;  3SD4 A;  3OS2 A;  3OA6 A;  2MWP A;  3PMI A;  3MET A;  3OYB A;  2MWO A;  2RHU A;  2YRV A;  3S3N A;  4Z02 A;  3Q1J A;  4LD6 A;  3OYH A;  3FC3 A;  5D6Y A;  4B9W A;  3UT1 A;  1KHC A;  3QII A;  1OI1 A;  3CEY A;  3OYG A;  3S3M A;  4E7K A;  2GFU A;  2E6N A;  2RI3 A;  4L59 A;  3LH0 A;  3F70 A;  4GY5 A;  4BE0 A;  2RJC A;  1RI0 A;  3PMT A;  4NS5 A;  2D9T A;  4E7L A;  3PNW C;  2LTO A;  2WAC A;  2GF7 A;  3OYM A;  2E5Q A;  2FHD A;  2LVM A;  2X4W A;  5CIU A;  3OB9 A;  4C5G A;  1G5V A;  4ZTF A;  3NTK A;  3S6W A;  2R5A A;  2RI2 A;  4IUT A;  3OYF A;  3BDL A;  3H6Z A;  4PL6 A;  2NLU A;  2O4X A;  3MP1 A;  4QQG A;  3OYI A;  4B9X A;  3OYJ A;  5KE3 A;  2EKO A;  2RHZ A;  5FRN A;  4IUV A;  1XNI A;  4Q5W A;  3L2W A;  2R58 A;  4N4H A;  3OYL A;  2RJE A;  2X4Y A;  3MEV A;  2G3R A;  3DLM A;  2DIQ A;  4QQ6 A;  2RHY A;  5IN1 A;  4UC4 A;  3OYE A;  1N27 A;  2HQX A;  2EFI A;  2M1H A;  2EQU A;  2QQS A;  4BDY A;  3FDR A;  3OMC A;  4EDU A;  2IG0 A;  2EQJ A; 
#chains in the Genus database with same CATH topology
 3P8H A;  4M7A B;  2BIV A;  2FZG B;  1D0Y A;  3JB9 G;  1PNJ A;  4A4K A;  4KDI A;  5DM7 R;  4LDU A;  4IUU A;  5HCK A;  4QT7 A;  1ZHI A;  4ELY C;  2BZ8 A;  1Y57 A;  1IHW A;  3ZJT A;  1PKS A;  2F2X A;  2YVL A;  2KRN A;  1AEY A;  2J6F A;  2CYZ B;  5GAO p;  3I56 Q;  2IIM A;  2QYZ A;  1RAH B;  3MEA A;  3VRZ A;  2HL5 C;  3EH1 A;  2VWF A;  3VS7 A;  1I4K 1;  3QWX X;  3OSV A;  4XU0 A;  5FTK A;  5GAN j;  4XTX A;  4AMC A;  4BI4 A;  5AYF A;  3QJ6 A;  4C8Q E;  3CC7 T;  1EZZ B;  4HT9 A;  2L0A A;  4M7A E;  4A4H A;  4M78 F;  4B6M A;  3SEM A;  2KQW A;  2MAM A;  1TH7 A;  2Q1A X;  2AZV A;  3MP6 A;  1SG5 A;  4J9C A;  4XAX B;  1TXQ A;  4NOY A;  4MDW A;  4KH1 B;  2DL8 A;  3LW5 E;  1W2B P;  3CME T;  4M75 E;  1M90 C;  1WHJ A;  1E7O A;  3Q1J A;  3QSU A;  5KYU B;  3FPT A;  2CT4 A;  1FMK A;  1M8M A;  2D9T A;  1ZA2 B;  1JEG A;  2JM8 A;  2WAC A;  2K3B A;  5LJ3 h;  3CCR T;  3SB2 A;  5C1B A;  2DO3 A;  1YWP A;  2DXB A;  2DZ9 A;  3MP1 A;  5L8R E;  1FMW A;  2DET A;  2QA4 Q;  2K7A A;  3P8B B;  2KEA A;  2VKN A;  1S72 A;  3M5A A;  2O2O A;  4FM4 B;  3MJX A;  1VQL A;  7AT1 B;  2DTI A;  2JN0 A;  4DQ2 A;  3QYH B;  2K5L A;  5KCO A;  4F17 A;  2DL5 A;  2ZPE B;  3LHD A;  3OS5 A;  4OGC A;  5J26 A;  4C5E A;  2EJG A;  3EGX B;  4OML A;  2LCS A;  4KLN A;  3CCU Q;  1NPR A;  2VAS A;  3CC4 Q;  1BCO A;  3QKJ A;  4PJO G;  2A37 A;  2EQM A;  2RHI A;  1YI2 Q;  5I2S A;  2A0F B;  3LWI A;  2QXF A;  3FJP A;  1BK2 A;  1YJW A;  2K2V A;  2V8J A;  1QVF P;  1YCS B;  2AT1 B;  4AFS C;  2MI6 A;  4HVU A;  1VQP Q;  3H0H A;  2K5F A;  4XU2 A;  2E5K A;  1JJ2 A;  3TIW A;  1TTH B;  1BI2 A;  4E7J A;  1BI0 A;  1G3W A;  2BUD A;  1WFW A;  1MHN A;  1PHT A;  3QO3 A;  3OS0 A;  2PTK A;  2LJ1 A;  1HD3 A;  1NZ9 A;  1RLQ C;  1VYU A;  2XIC A;  2EIF A;  1QVG S;  1M90 U;  2DTH A;  1K4U S;  4LUE A;  5IHN A;  4MDX A;  1YJ9 Q;  2O4X B;  4CC3 A;  2SRC A;  2GQV A;  1FYN A;  1Y07 A;  4JJC A;  2QG9 B;  1TG0 A;  3RMS A;  3CPW P;  3MET A;  1BI3 A;  1UGS B;  1Q95 G;  2CH4 W;  1FXX A;  1PSF A;  3S3M A;  1X6G A;  2YUP A;  4OF1 A;  2CUD A;  2HDA A;  3CMA T;  4M7D B;  3UAT A;  2LVM A;  2X4W A;  3OW2 P;  2EJ9 A;  3GBQ A;  3A8H B;  4IUT A;  1T3L A;  5A0G A;  5CK9 A;  1NEB A;  1NLO C;  1Y96 A;  2CT3 A;  3CC2 Q;  1X6B A;  5I2M A;  4M77 G;  1RAC B;  3JRZ A;  2E1H A;  1B3Q A;  1I5O B;  5IN1 A;  4MZT A;  3EFR A;  2FEI A;  3HHT B;  5GAO m;  2OI3 A;  1LJO A;  1M1F A;  3PTA A;  1PKT A;  5FWB A;  3MP8 A;  2MCN A;  3UA7 A;  1H64 1;  3C94 A;  2YWW A;  1GFC A;  2RJD A;  1K0S A;  4LDV A;  5C6S A;  5GAN 2;  4M7D E;  4M75 G;  5FU6 C;  3REA B;  1RAG B;  3NGP A;  1MMG A;  1MMD A;  2QGF B;  5EG2 A;  4JRP A;  2EGE A;  1QLY A;  2GQI A;  1VQ6 Q;  1N9R A;  2V1Q A;  1WJQ A;  2WSE E;  4FT4 A;  4QVZ A;  1U5S A;  3L2Q A;  3KUF A;  3CXC A;  4DOV A;  1NM7 A;  1ZUY A;  1OYX A;  4KUD K;  5KYY A;  2DZC A;  4F7U G;  1Q86 R;  2I2L A;  1AWO A;  5CO7 A;  1LCK A;  2IVW A;  4C92 G;  4J9E A;  3A8L B;  2QI2 A;  1R0C B;  4IUR A;  2PWY A;  2RD1 A;  1ZSZ A;  1RAI B;  1OX8 A;  5CKH A;  1VQL T;  2FVU A;  4KT0 E;  1TUC A;  2ZPI B;  3CCS A;  4KGZ B;  1VYV A;  3OA6 A;  3PMI A;  1W6X A;  2YRV A;  4F14 A;  4ANJ A;  2G6F X;  4E7K A;  2KR3 A;  4L59 A;  1PC0 A;  3QHS A;  5A2Q E;  1UJ0 A;  1UG1 A;  2OJ2 A;  3BE3 A;  1VQ5 A;  2OTL Q;  3V7C A;  2P84 A;  1QW1 A;  4PL6 A;  2C06 A;  2W10 A;  5HKC A;  2DRK A;  2QDL A;  1ZX6 A;  4FCY A;  1VQO A;  3VS3 A;  2P4R A;  1HXD A;  1N27 A;  2HQX A;  3CCE T;  2OAU A;  3QQ8 A;  1KD1 R;  3EG9 B;  3WVD B;  3SHW A;  4C5H A;  2O9V A;  1NG2 A;  4MZM A;  1SPK A;  3MHX A;  1Q7Y R;  3PT9 A;  2M0Y A;  4F16 A;  4OB0 B;  4HXJ A;  5J39 A;  1W2B S;  2WSC E;  3UPU A;  1W70 A;  3CCQ Q;  1R7R A;  1D1C A;  2DTO A;  2C0O A;  4M4Z A;  1GFD A;  3LLR A;  1OPL A;  3FPR A;  2QEX Q;  2KT8 A;  5FRO A;  2DLP A;  1X69 A;  1JU5 C;  2M16 A;  2AHJ B;  3JCM Q;  2ZAE A;  2CP6 A;  8AT1 B;  2L8D A;  1VQN Q;  4C0D C;  4J8O A;  2P0K A;  5J3B A;  2JTE A;  1M3A A;  1TUD A;  3EHQ A;  2DYI A;  1LNX A;  2NWM A;  4FL6 A;  2HQE A;  1V29 B;  3G4S T;  1OUL A;  3VS1 A;  2DAQ A;  2NUP A;  4EMK C;  1G2B A;  2DYB A;  3SWN B;  1G83 A;  1N8R R;  1WGS A;  2QQA A;  3CCL Q;  3LWH A;  5ECA A;  1SSH A;  5CQY A;  4FYY B;  2COW A;  2RHU A;  3S3N A;  1YCY A;  5I11 A;  1SHG A;  3OYH A;  3V8L A;  1QP2 A;  1OI1 A;  3CEY A;  3ZJV A;  3LH0 A;  4LDX A;  3F70 A;  4BE0 A;  2LW6 A;  4ARC A;  5EQJ B;  3FIF A;  1QVF S;  1D0Z A;  3A8O B;  1NLP C;  1Y96 B;  3DLL A;  4RV0 A;  5CKF A;  2Y4X A;  2LX9 A;  3VUZ A;  2KE9 A;  4AT1 B;  3QWZ A;  3PGG A;  5FRN A;  3M0S A;  3GF5 A;  4JLI A;  1UE9 A;  3JCM f;  2DIQ A;  4QQ6 A;  1CSK A;  3I56 T;  2RHY A;  1ABO A;  3JCM d;  3CC2 A;  1UTI A;  4E2F B;  1T0H A;  1M1K C;  5FU7 C;  5KYU A;  2IPO B;  2E3H A;  2LRQ A;  1X75 C;  4OMQ A;  2K6D A;  3M0Q A;  2YUQ A;  2D0Q B;  1MGQ A;  1VQ4 Q;  3CPW S;  2XU8 A;  1R77 A;  1WJS A;  2KDS A;  4A54 A;  2ROT A;  5GAN e;  2RNA A;  3M0T A;  1VQ8 Q;  1GL5 A;  4E7H A;  1M8V A;  2HCK A;  2D8J A;  2A3L A;  2CP0 A;  2LC4 A;  1U8R A;  3RER A;  2MM2 A;  2HZY A;  3MO8 A;  3OW2 S;  5B6C A;  2DJQ A;  5KCH A;  4XTV A;  1K76 A;  2NUT A;  5LJ3 d;  1EIF A;  4FYW B;  3JB9 F;  1VQ6 A;  4OMO A;  3EGX A;  1VQ5 T;  2PUO B;  5AT1 B;  2JW4 A;  1PSE A;  4N0A A;  3EG2 A;  4Y91 A;  3VS0 A;  1UGQ B;  2F5T X;  3JV3 A;  1TWB A;  4JUV A;  4FU6 A;  5I21 A;  3M9Q A;  3CCR A;  4PFZ A;  4BI8 B;  1OPK A;  3OYA A;  2QAS A;  4RMO A;  1VQ7 A;  1GCP A;  2QA4 T;  2AKK A;  4DOW A;  3G71 A;  5LJ5 j;  4BE2 A;  3TRE A;  3BW1 A;  2ZCF B;  2KSS A;  2X4J A;  5DYI A;  5I22 A;  3BY7 A;  3MB5 A;  4PJO C;  2GBQ A;  2RB6 A;  1H3H A;  3VS4 A;  4BI3 A;  3OYG A;  2JV2 A;  2DER A;  4ATO A;  5GMK m;  2OAW A;  4NS5 A;  2JS0 A;  4O5V A;  3V8J A;  1AWX A;  3VJP A;  1K8A C;  2ED0 A;  2E5Q A;  2JMA A;  1DJ7 B;  3X25 B;  4ESR A;  3CC4 T;  4ZTF A;  1YI2 T;  1M1K U;  2O4X A;  4QQG A;  3OYI A;  4M78 B;  2F69 A;  2HBW A;  4ZN1 A;  5CCX A;  4IUV A;  4Q5W A;  3RMQ A;  1GCQ C;  2BZX A;  5GAM e;  3A1P A;  4UC4 A;  3OYE A;  1VIE A;  1VQP T;  2ZGW A;  4Y28 E;  1K9M R;  5CQX A;  4PJM A;  5GAN 7;  5KH6 A;  3JCM J;  2ZPF B;  4M7D A;  2FL7 A;  2HSE B;  3M54 A;  2GCX A;  1WZO A;  4BY6 B;  5CD1 A;  4BY6 C;  3VYH B;  1UEC A;  2CP2 A;  4E7S A;  1WLP B;  5GAN h;  1YJ9 T;  3H0I A;  4ZGE B;  5CCB A;  1OOT A;  2XID A;  1QP3 A;  3ULR B;  5GAN 8;  3MKD A;  1CZ4 A;  3JB9 H;  4M78 E;  4ZTJ A;  4DBR A;  3HU3 A;  4OMN A;  3CD6 Q;  4RTT A;  4OMM A;  3A8G B;  4M77 C;  5D6W A;  4C0G A;  1C0M A;  3CMA A;  2NUP B;  3EGD B;  4E7I A;  2CRE A;  2DXU A;  1JJ2 P;  2DL7 A;  2CZ0 B;  4PJO F;  4JS4 A;  1M3B A;  2RA2 A;  4RTY A;  2KK4 A;  4FIB A;  1GRI A;  3CC2 T;  1H3Z A;  3E9F A;  3NTI A;  3KFV A;  4BAC A;  1K8A U;  1UHC A;  3RBB B;  1UB4 A;  1U3O A;  2EQK A;  5GJV B;  3G1J A;  2DK3 A;  2HL3 A;  5D6Y A;  1D1A A;  1A0N B;  2EW3 A;  1S3S A;  3RNJ A;  5GAO l;  1ZC1 A;  2OTJ Q;  1KQS S;  1ABQ A;  2CP5 A;  3GNF B;  3S6W A;  1M9S A;  4XQ3 A;  2EGC A;  4EPC A;  5DLO A;  1WHH A;  2QTX A;  1AHJ B;  5GAM h;  2JXB A;  5L23 A;  3JSC A;  1U06 A;  3HSB A;  2XI9 A;  3HFN A;  2EFI A;  4XTZ A;  2CP3 A;  4C92 C;  1VQ6 T;  3OMC A;  3OBW A;  2RQT A;  3QZ5 B;  4EMH A;  1K73 C;  3RUX A;  3HFO A;  3L2U A;  2RQV A;  1SKU B;  1WNL A;  4ZGD B;  5GMK e;  1CR5 A;  1NYG A;  1VQK Q;  2VXF A;  2NYS A;  4MZP A;  1ZBX A;  3V7S A;  2YT6 A;  1VQ7 T;  3CBP A;  1YN8 A;  4HVW A;  4JRK A;  3CCJ Q;  3G71 T;  1WQ7 A;  1UGV A;  2VB6 A;  4E6R A;  3L1A A;  1OZ3 A;  2JOY A;  3A98 A;  1VQM Q;  1VUB A;  1UHF A;  1IGQ A;  2KRO A;  2DX1 A;  4M77 F;  4J83 A;  4X9D A;  2BTT A;  3L2Z A;  2DE0 X;  1SSF A;  2NUT B;  4OMP A;  4Z89 A;  2KNB B;  3EG9 A;  4LD9 K;  4JRQ A;  1VQ9 Q;  4OVA A;  3THK A;  3NFC A;  1YBY A;  3VS6 A;  2D6F A;  2YRC A;  4IUQ A;  4A4F A;  2OTL T;  3ZFJ A;  1PM3 A;  1OEB A;  1BIA A;  1ZQ1 A;  2L3S A;  3H9N A;  1UJY A;  3CXC P;  4M75 F;  1OV3 A;  3JB9 J;  1YJN Q;  4AG1 C;  2YUN A;  2V26 A;  2BKD N;  3M4G A;  2YLC A;  4MMK A;  1EFN A;  3EG0 A;  3FPU A;  3INZ A;  3CCE A;  1PWT A;  1QDN A;  2YLB A;  3OBY A;  1YIT Q;  4J7I A;  5LJ3 j;  2O9S A;  3KBG A;  4AS1 A;  3REB B;  2AZS A;  2HSP A;  2JMC A;  2QGG A;  4F7U F;  2E3I A;  4HA8 A;  2MIO A;  5GAN 5;  3CCQ T;  2P0P A;  2RQU A;  4C92 F;  1U1S A;  1IGU A;  1QKW A;  3SWN A;  1NJI R;  4JLG A;  4B9X A;  2AIR B;  2XDD A;  1H92 A;  2D1X A;  5KYN A;  3JCM V;  3UF4 A;  1KG1 A;  5EC7 A;  4J9D A;  3T9N A;  1YIJ Q;  1VQN T;  4KDL A;  1SEM A;  2ENM A;  6AT1 B;  5GLF A;  3BQB A;  1JO8 A;  1TU0 B;  4JRI A;  1QMC A;  5GMK h;  1OU9 A;  3JCM b;  2JZ2 A;  3M53 A;  3G4S A;  4LDW A;  3EFO B;  4LXC A;  3PVL A;  3R6O A;  3NHN A;  2V8K A;  1X43 A;  2Y90 A;  2QQ9 A;  1HK9 A;  4RG2 A;  1WXT A;  5GAN g;  3CCL T;  4FW2 A;  4C8Q G;  2RI5 A;  1EX4 A;  3UWN A;  2DIG A;  4M7A G;  1ARK A;  4ARI A;  4O6J A;  2HEQ A;  3J81 E;  1N9S A;  3FB9 A;  3LGA A;  2FZK B;  2RQR A;  3RKY A;  1SRM A;  1KQ2 A;  3GLX A;  5IT9 E;  4RTZ A;  2EGA A;  5LJ5 f;  4LE9 A;  2XK0 A;  5FU6 B;  2BE7 D;  1UEB A;  5LJ5 d;  2J6O A;  1B34 A;  9ATC B;  1E6H A;  4HT8 A;  1T3S A;  4M78 D;  2A28 A;  2K3X A;  3X20 B;  2C0I A;  4LN2 A;  1M27 C;  2P0Q A;  3I56 A;  2RN8 A;  3DB3 A;  1I81 A;  3SFM A;  1WA7 A;  1JXM A;  2EVR A;  4FYX B;  1C6V X;  5GAO r;  3CCM Q;  3HU2 A;  3TU4 K;  4K11 A;  1RI0 A;  3PMT A;  4RTU A;  4E7L A;  1CZ5 A;  4IIO A;  5KYW A;  2LTO A;  2GF7 A;  1WHG A;  2EYZ A;  2KMT A;  4X9C A;  2ZPB B;  2PUK B;  1ZSG A;  4KO8 A;  3GNG A;  1VQ8 T;  2EKO A;  2YUO A;  4CC2 A;  5IXF A;  2EPD A;  1LPL A;  3JCM g;  2G3R A;  5HK3 A;  1Y71 A;  1BYM A;  2FPE A;  2PZ1 A;  5GAM g;  2J06 A;  2VGN A;  4EDU A;  2DKG A;  1Q81 R;  2EKH A;  2Q1C X;  1I07 A;  1PD0 A;  2EWN A;  2KXC A;  2CUB A;  1M30 A;  2M9U A;  2JJ9 A;  2DEU A;  3HKS A;  4J9I A;  4OGE A;  1NE8 A;  4RKU E;  2DM1 A;  1V1C A;  4M78 A;  1AD5 A;  2ESW A;  3TVT A;  3JCM c;  4JPB W;  2QA4 A;  3NPF A;  2OX7 A;  1QKX A;  4N4G A;  2XHC A;  1FX7 A;  3VUB A;  1UFF A;  4BB7 A;  1X01 A;  5CVI A;  4RG8 A;  2E70 A;  2E6Z A;  3WVE B;  1WLF A;  1OU8 A;  3G6E Q;  4KOD A;  5ERG B;  1D3B A;  3I5R A;  1G3Y A;  4OB1 B;  1RAE B;  4V2S A;  4CQN A;  2MK5 A;  3CCU A;  3CC4 A;  1X2Q A;  5GMK l;  4KUL A;  1YI2 A;  4FYV B;  3VS5 A;  1AWW A;  2DPP B;  4AFU C;  3AHU A;  2CSI A;  2XDB A;  4C0D B;  1Y0M A;  2LJ3 A;  1SHF A;  1RAA B;  3VYG A;  1VQP A;  3OYB A;  3RIR A;  3X24 B;  3X28 B;  4D6W A;  2HBP A;  2K5I A;  2X3X D;  2WSF E;  1KHC A;  1YWO A;  4J7F A;  1KHI A;  1LVK A;  3QQ7 A;  3PVQ A;  4HCC A;  4EMK B;  3EGD A;  1X27 A;  3AT1 B;  1MMN A;  2R5A A;  1MNE A;  3OYJ A;  1YJ9 A;  5KE3 A;  4PNO A;  3HTR A;  1XOV A;  1XJW B;  1KC8 C;  4RCC A;  5CKB A;  1PG5 B;  3E1S A;  2PVG B;  2DA9 A;  2DVJ A;  3CBM A;  2DBK A;  3VRY A;  1YIJ A;  2LCC A;  3MEU A;  4M7D G;  5GAN 6;  4BD3 A;  2MF2 A;  4II1 A;  3CXC S;  1MMA A;  3LH5 A;  1HJD A;  1CKA A;  1KJW A;  1CKB A;  2HAX A;  1QQJ A;  4Y92 A;  5A0L A;  2PJH B;  2CGH A;  2VXE A;  1KQ1 A;  1K8A R;  1AWJ A;  2L89 A;  5FU7 B;  2B86 A;  1QCS A;  4PKC C;  2LNH B;  2RHX A;  2M51 A;  3L42 A;  2VYT A;  1WHK A;  3JB9 I;  1JRI A;  4OB2 B;  1H8K A;  4KH0 B;  4XK8 E;  4QVD A;  3PIP A;  2M0O A;  2F1L A;  5KYX A;  1B34 B;  3E2U A;  3TSW A;  4KUI A;  4A4E A;  2LDM A;  3E9G A;  1IHV A;  2O31 A;  3O5Z A;  1OX9 A;  4QW2 A;  4AFQ C;  1O9S A;  1YNZ A;  3VKI A;  1UGR B;  2COZ A;  5LJ3 f;  1S72 Q;  4C0F A;  1IRX A;  1QWF A;  4RTV A;  1VIF A;  3OS2 A;  2MWP A;  2HD0 A;  1VQL Q;  5GJW B;  3SDZ A;  4B9W A;  5HK0 A;  1X2K A;  3M0P A;  5KYW B;  3BDU A;  1GBQ A;  1KC8 U;  2I0N A;  1VQK T;  2K2M A;  3NMZ C;  1N8R C;  1GXI E;  3CCM A;  1TOV A;  4LNP A;  2LNV A;  3CCJ T;  2RI2 A;  1LOJ A;  3H6Z A;  4E7Z A;  1PRL C;  2RHZ A;  1YJW Q;  2JTM A;  4PJO B;  3QWY A;  4N4H A;  1VQM T;  2RJE A;  2X4Y A;  3GP8 A;  4J9G A;  3M4Y A;  3VS2 A;  2COY A;  1K9A A;  3A5Z B;  4HKE A;  4PJJ A;  1NEG A;  4WCI A;  4WF2 A;  3HPW A;  1ZSZ C;  2E10 A;  2EQJ A;  2ZPH B;  1WQW A;  2B8A A;  1VQ9 T;  3CCU T;  4KRT A;  5FTM A;  3JCM e;  1K0X A;  2PVD B;  3X26 B;  4KGX B;  1WJR A;  2MPX C;  2OTL A;  1MV3 A;  2K57 A;  2L3P A;  3EH2 A;  3QDR B;  4RTW A;  1YJN T;  3O8V A;  3EAE A;  3OYY A;  1GBR A;  1TS9 A;  4F04 B;  2YHT A;  2W0Z A;  4PJO E;  4QQD A;  3LGL A;  4DBH A;  1YIT T;  2X4X A;  5GMK i;  1D3B B;  1M3C A;  4DA4 A;  1YHQ Q;  1M1G A;  2RM4 A;  1M90 R;  8ATC B;  1I8F A;  3NTH A;  2EYW A;  3EFO A;  3M0U A;  3J7A F;  1AZG B;  3OYN A;  3OYC A;  2DMO A;  2GFA A;  3QC8 A;  3CBO A;  1BBZ A;  3CCQ A;  3EG1 A;  1QWE A;  4A53 A;  2F5K A;  2QEX A;  2QQR A;  5GAO n;  3U23 A;  1YIJ T;  3JCM X;  1N8R U;  3SD4 A;  2K79 A;  2JVV A;  2HMA A;  1VQN A;  4M77 B;  2XG8 D;  3FC3 A;  2AKL A;  2FPD A;  1HSQ A;  2YDL A;  3QII A;  3MCA B;  2LT1 A;  4C8Q C;  1G3S A;  3CQT A;  1KSW A;  1NPP A;  4C0Z A;  1MUZ A;  4M7A C;  5DY9 A;  4LDY A;  4JJD A;  3OB9 A;  1G5V A;  1ZBJ A;  1QVG A;  1NBE B;  2F2V A;  4J6X A;  4FSX A;  3QDF A;  3CCV Q;  4L6V 5;  5HY6 A;  4AQ7 A;  3L2W A;  1R0B G;  2ROL A;  1HYO A;  3V7R A;  3CCL A;  2KRS A;  1Q82 C;  4EIK A;  5IXB A;  2FB7 A;  1WHM A;  4M75 B;  4M75 C;  2M1H A;  1FWZ A;  1IB8 A;  2P4T A;  3C4S A;  4IIM A;  3L2V A;  4BDZ A;  3FRN A;  1BKB A;  2PU9 B;  2YUJ A;  2L5Q A;  4Z88 A;  2CZ6 B;  2D8H A;  1SF9 A;  2RF0 A;  4M77 E;  1QCN A;  3I5S A;  3JCM h;  3M56 A;  4IKF A;  4PJN A;  1M5Q 1;  4ELZ C;  2EAY A;  4F7U B;  2XDP A;  2PVO B;  2MOX A;  4C92 B;  1K9M C;  2LJ0 A;  2E12 A;  3CCS Q;  3A8M B;  1I5L A;  2VV5 A;  2A7Y A;  5LL6 S;  1M2O A;  3CCM T;  2E41 A;  5KYX B;  1YFN A;  2R5M A;  5LJ5 g;  3JB9 D;  3H41 A;  3ER0 A;  4ZNX A;  1VQ4 A;  1IRE B;  1VQ5 Q;  5D6X A;  4KGV B;  3FLG A;  2GGR A;  2ED1 A;  1JQQ A;  1VQ8 A;  1OQK A;  2VUB A;  1VQO Q;  4C8Q F;  1I1J A;  2J6K A;  4N4I A;  3GPL A;  4F7U E;  4M7A F;  4RCB A;  3H0F A;  4C92 E;  2F2W A;  4PFO A;  3I55 Q;  1K1Z A;  5A0D A;  3RKW A;  1N5Z A;  1PD1 A;  4JZ4 A;  1Q82 U;  1P92 A;  2Z0W A;  5DYG A;  1U1T A;  2RQW A;  2O88 A;  3BDL A;  4R56 A;  2DIL A;  4P5N A;  4R0K A;  4GLM A;  3RDV A;  5GAM j;  4DEX A;  3M59 A;  1BB9 A;  4N0A C;  1XNI A;  4ME7 A;  2DBM A;  3ZBD A;  3EG3 A;  2DL4 A;  3RES A;  1R8O B;  1UUE A;  4AG2 C;  2EYY A;  3D7S B;  2X3W D;  4HCB A;  2IG0 A;  2CDT A;  1D09 B;  3G6E T;  4EMK A;  2LQK A;  1WX6 A;  2QTV A;  3ZJU A;  1D0X A;  1K9M U;  2DRM A;  4XTU A;  2FRY A;  4JDS A;  4QKU A;  1K73 U;  4PLI A;  2MYS A;  1RAD B;  2QEX T;  4M78 G;  3LGF A;  4A4G A;  2X35 A;  1KK7 A;  2JNG A;  3E19 A;  1ZA1 B;  2VC8 A;  1AT1 B;  1B7T A;  4HVV A;  4JJN K;  2LQ8 A;  5D7U A;  4X1V A;  2KAF A;  1W4S A;  1RUW A;  2XMF A;  1M2V B;  2RPN A;  4JJB A;  3MEW A;  3KXT A;  1XTD A;  3OY9 A;  2M02 A;  2FG0 A;  4J9F A;  2VVK A;  4NL3 A;  1BI1 A;  2EYQ A;  1T0J A;  3LX7 A;  3RKX A;  2R57 A;  5GAN 4;  3HL8 A;  2HKQ B;  4X34 A;  3V8K A;  1B07 A;  1YHQ A;  1W2B A;  2QDY B;  4CC7 A;  4A63 B;  1OZ2 A;  3ME9 A;  4M7D C;  4VUB A;  2KYB A;  2NUZ A;  2H8H A;  4PJO D;  1BIB A;  2ABL A;  2CH4 A;  3HP9 A;  4RTX A;  1G8X A;  2CSQ A;  4ORZ A;  2EJF A;  1S1N A;  2VGM A;  3QJY A;  5FLX E;  4J6Y A;  4LD6 A;  5GAO q;  4OMF B;  2QQB A;  3CD6 A;  2A08 A;  4PFP A;  2E6N A;  4PJL A;  3CC7 Q;  3PNW C;  2J7I A;  2FRW A;  4C5G A;  1E32 A;  5IH2 A;  4PK4 A;  3DKM A;  1KFZ A;  3R6N A;  4J9B A;  1WXB A;  2B25 A;  1RAB B;  2EBP A;  4DBF A;  3CCV A;  2E65 A;  3CME Q;  1E6G A;  3M0R A;  1W1F A;  2QQS A;  1WIE A;  5GMK j;  4DEY A;  3TCJ A;  2L3R A;  2LZ6 B;  1VQ4 T;  3OQ5 A;  2HNI A;  1NJI C;  2FZC B;  2AK5 A;  3HRS A;  2CZ7 B;  1WXU A;  2DD4 A;  4LUD A;  2OTJ A;  2DF6 A;  1QVF A;  2ZPG B;  2SEM A;  3CCR Q;  1XQH A;  2Q1D X;  1SRL A;  1UGP B;  2YXY A;  1VQ7 Q;  3WXM B;  1Y7X A;  4XTW A;  4PJO A;  3C0C A;  5CKE A;  3G71 Q;  2JTF A;  3I35 A;  4QVC A;  4BUG A;  2ECZ A;  1JJ2 S;  1WPY A;  1S72 T;  1ZLM A;  2DNU A;  3J80 E;  2LX7 A;  4M77 D;  4CI0 C;  3FEO A;  1JB0 E;  2L3Q A;  1JXO A;  4FSS A;  1O75 A;  3VV0 A;  4M7D F;  4C8Q D;  1TUG B;  1KIK A;  3TQ7 P;  3TEE A;  1KC8 R;  4J6W A;  2KY9 A;  1VQK A;  1RAF B;  4MML A;  5IAY A;  3PIO A;  1MND A;  2HKN A;  4M7A D;  5KE2 A;  1O54 A;  3OS1 A;  4D8K A;  1GCQ A;  2YSQ A;  1VYT A;  2CZ1 B;  3CPF A;  3CPW A;  3CCJ A;  3LYI A;  3QYG B;  5M9O A;  2K3Y A;  3C95 A;  2KGT A;  1YJW T;  1TSF A;  4CRI A;  1VQM A;  5LJ3 g;  4M75 D;  1VA7 A;  2DVE A;  3ASK A;  3EFS A;  1RLP C;  2KXD A;  2MWO A;  4NL2 A;  3OW2 A;  1IO6 A;  5LJ5 e;  1I0C A;  3VU3 C;  2Q18 X;  3URG A;  2GTJ A;  3BFM A;  3UT1 A;  1Z9Q A;  4XU3 A;  2FO0 A;  2HQH A;  2RI3 A;  2CS7 A;  1D1B A;  1VQ9 A;  1ZUK A;  2MMP A;  3I55 A;  1M1K R;  5FW9 A;  1F1B B;  4WTO B;  3NTK A;  4D8D A;  1AOJ A;  2JUF A;  2JM9 A;  2Q19 X;  4C92 D;  2RH2 A;  1YJN A;  2DEQ A;  1NJI U;  2V1R A;  5FTL A;  1Q86 C;  2QAZ A;  1V76 A;  5FTJ A;  2EQU A;  3EGU A;  2RK1 A;  2X9H A;  4M77 A;  5GAN f;  5GAN 3;  5CCA A;  1KQS P;  3M55 A;  5GAN d;  4C8Q A;  2DFU A;  1YIT A;  2QK0 A;  2H3E B;  1BCM A;  3S3O A;  4RUG A;  1YP5 A;  1YHQ T;  3GIB A;  1RL2 A;  3OMG A;  4M7A A;  3CMA Q;  4XTY A;  1QCF A;  3HRU A;  5CR2 A;  2GNC A;  3G7Z A;  4HCK A;  2C0T A;  2BZY A;  3PE0 A;  2FYK A;  4GBQ A;  4EMG A;  1Q81 C;  4HCZ A;  4M75 A;  4JS5 A;  3SWN C;  2A36 A;  3CD6 T;  2RO0 A;  5IHK A;  3OYK A;  3H8Z A;  3ZGZ A;  2H3J A;  3DB4 A;  4C5I A;  3QBY A;  3ZEH A;  1PRM C;  3HU1 A;  5C0M A;  4OP0 A;  2RK2 A;  4FT2 A;  2XKO C;  3UA6 A;  1KD1 C;  1IXD A;  4F7U A;  2DL3 A;  3JAM E;  3CCV T;  4C92 A;  3L2R A;  2E4H A;  4BE1 A;  1IZ6 A;  2CP7 A;  2RJF A;  3UDC A;  1BU1 A;  2EQI A;  1Q7Y C;  3HRT A;  3EHR A;  2MM0 A;  5LJ5 h;  4Z02 A;  4ZN3 A;  2EYX A;  1FMV A;  5EPP A;  5C18 A;  2OTJ T;  5CAI A;  2GFU A;  5GAM f;  2GTO A;  4GY5 A;  2Y4Y A;  3JCM P;  5GAM d;  3C12 A;  3TSZ A;  2O01 E;  5CIU A;  1Q86 U;  4J5Y A;  2DD5 A;  3OYF A;  3CC7 A;  1I9G A;  2J05 A;  1ZUU A;  3OYL A;  3MEV A;  3DLM A;  1WDX A;  1N6A A;  3QUI A;  3IQL A;  2ZZD A;  3CCS T;  1QVG P;  3CF2 A;  1AZE A;  3FDR A;  4GLK A;  2RMO A;  2D0N A;  3MPU B;  2JT4 A;  3CME A;  2LP5 A;  2JS2 A;  1NYF A;  1Q81 U;  4J9H A;  2KYM A;  1KQS A;  3N5B B;  5KYY B;  3M58 A;  5CKD A;  4M7D D;  1QVP A;  2V8I A;  3QG1 A;  2LQN A;  5FTN A;  2FPF A;  3RR6 A;  1VQO T;  1ZSZ B;  2LQW A;  3OSS C;  1UDL A;  2BE9 B;  4IUP A;  3CCE Q;  2DJZ A;  2K9G A;  2PQW A;  3M57 A;  1KD1 U;  2DXT A;  3QPH A;  3I55 T;  1RI9 A;  2KBT A;  4AFZ C;  1WYX A;  2LT4 A;  4PLL A;  1ACM B;  5FRM A;  3GOX A;  5DLQ E;  2XD0 A;  4OB3 B;  1Q82 R;  5FWC A;  1Q7Y U;  2CKK A;  2DXC A;  1VOM A;  1AVZ C;  2KT1 A;  3P8D A;  4ZGJ B;  4E47 A;  4CC4 B;  1C1A A;  1WHL A;  3PFS A;  1M4Z A;  3OYD A;  3I9Q A;  1X6O A;  2L2P A;  1M2V A;  2LMJ A;  4YTL A;  4M78 C;  4FW1 A;  2ATC B;  3QZ9 B;  4JZ3 A;  3FJ5 A;  2KRM A;  2E64 A;  2LCL A;  2YRD A;  3JCM W;  1J3T A;  3G6E A;  2RJC A;  4Z8A A;  3G4S Q;  1G3T A;  3OYM A;  2FHD A;  1K73 R;  1PCX A;  1MV0 B;  2KI7 A;  3QXE B;  5LJ3 e;  2KVQ G;  1QCO A;  2NLU A;  2K4Y A;  1Z9Z A;  2R58 A;  4KBM B;  4DBQ A;  1JBM A;  5IHI A;  4TVR A;  1WI7 A;  4R55 A;  3ZL7 C;  4BDY A;  4XU1 A;  4C8Q B;  2X51 A;  2PNI A;  4L5G A; 
#chains in the Genus database with same CATH homology
 3P8H A;  4M7A B;  2BIV A;  2LRQ A;  1X75 C;  2Q1C X;  3JB9 G;  3G6E T;  2EWN A;  4EMK A;  2LQK A;  4A4K A;  4KDI A;  5DM7 R;  4LDU A;  2M9U A;  4IUU A;  3ZJU A;  1K9M U;  2D0Q B;  4XTU A;  3HKS A;  4OGE A;  1MGQ A;  1ZHI A;  4JDS A;  4ELY C;  1K73 U;  4PLI A;  2QEX T;  4M78 G;  3LGF A;  3CPW S;  2XU8 A;  1NE8 A;  4A4G A;  2X35 A;  4RKU E;  2JNG A;  3E19 A;  1WJS A;  2KDS A;  2VC8 A;  4A54 A;  4M78 A;  3ZJT A;  4JJN K;  5GAN e;  3JCM c;  2QA4 A;  4E7H A;  2YVL A;  2LQ8 A;  1M8V A;  4N4G A;  2XHC A;  2CYZ B;  2KAF A;  1W4S A;  5GAO p;  2A3L A;  2LC4 A;  1FX7 A;  1U8R A;  3VUB A;  4BB7 A;  1X01 A;  5CVI A;  3RER A;  4RG8 A;  2MM2 A;  3MEW A;  2E70 A;  3MO8 A;  3OW2 S;  3MEA A;  3KXT A;  1XTD A;  3OY9 A;  5B6C A;  1I4K 1;  5KCH A;  4XTV A;  2E6Z A;  3WVE B;  3OSV A;  4XU0 A;  1WLF A;  5FTK A;  5LJ3 d;  1EIF A;  4XTX A;  5GAN j;  3JB9 F;  4NL3 A;  1VQ6 A;  4BI4 A;  5AYF A;  1BI1 A;  3QJ6 A;  4C8Q E;  2EYQ A;  3LX7 A;  1VQ5 T;  3RKX A;  2PUO B;  3CC7 T;  1PSE A;  4KOD A;  4N0A A;  2R57 A;  4Y91 A;  5I21 A;  1UGQ B;  2F5T X;  1D3B A;  3HL8 A;  4JUV A;  1G3Y A;  4FU6 A;  4OB1 B;  5GAN 4;  3M9Q A;  4A4H A;  4M7A E;  4X34 A;  4V2S A;  3V8K A;  3CCR A;  3CCU A;  4M78 F;  3CC4 A;  1YHQ A;  1W2B A;  2QDY B;  4BI8 B;  5GMK l;  1VQ6 T;  4KUL A;  2KQW A;  2MAM A;  1TH7 A;  1OZ2 A;  3OYA A;  4RMO A;  1YI2 A;  1VQ7 A;  3ME9 A;  4M7D C;  2DPP B;  2QA4 T;  4VUB A;  3AHU A;  2Q1A X;  3MP6 A;  2XDB A;  4PJO D;  4C0D B;  1BIB A;  4XAX B;  4DOW A;  3G71 A;  5LJ5 j;  4BE2 A;  3HP9 A;  4NOY A;  3TRE A;  4MDW A;  3BW1 A;  2ZCF B;  3LW5 E;  2KSS A;  2X4J A;  3VYG A;  3CME T;  5DYI A;  4M75 E;  1M90 C;  3BY7 A;  2EJF A;  3MB5 A;  4PJO C;  1VQP A;  3OYB A;  3RIR A;  3X24 B;  3X28 B;  3QJY A;  2VGM A;  4D6W A;  2HBP A;  2RB6 A;  2K5I A;  5FLX E;  3Q1J A;  4J6Y A;  4LD6 A;  4OMF B;  5GAO q;  2WSF E;  1KHC A;  2QQB A;  4J7F A;  3QSU A;  3CD6 A;  4BI3 A;  1KHI A;  3OYG A;  2JV2 A;  3FPT A;  3QQ7 A;  2E6N A;  4ATO A;  4HCC A;  5GMK m;  4O5V A;  4NS5 A;  2D9T A;  3V8J A;  3VJP A;  4EMK B;  1K8A C;  3PNW C;  2WAC A;  3X25 B;  2E5Q A;  1DJ7 B;  5LJ3 h;  3CCR T;  3CC4 T;  4C5G A;  3SB2 A;  1E32 A;  5C1B A;  2DO3 A;  4ZTF A;  2DXB A;  2R5A A;  1YI2 T;  1M1K U;  2DZ9 A;  2O4X A;  3DKM A;  3MP1 A;  4QQG A;  5L8R E;  3OYI A;  4M78 B;  3OYJ A;  1YJ9 A;  5KE3 A;  4PNO A;  2F69 A;  3P8B B;  1XOV A;  4IUV A;  4ZN1 A;  4Q5W A;  1KC8 C;  2B25 A;  3RMQ A;  5CCX A;  4RCC A;  5CKB A;  5GAM e;  3CCV A;  3E1S A;  2E65 A;  4UC4 A;  3OYE A;  3M5A A;  2PVG B;  1VIE A;  1S72 A;  2QQS A;  4FM4 B;  1VQP T;  2ZGW A;  1VQL A;  5GMK j;  4Y28 E;  2DTI A;  3CBM A;  2JN0 A;  3TCJ A;  2L3R A;  1YIJ A;  5CQX A;  4DQ2 A;  2LCC A;  3MEU A;  2K5L A;  3QYH B;  4M7D G;  5GAN 6;  5GAN 7;  4BD3 A;  1VQ4 T;  2MF2 A;  5KH6 A;  3JCM J;  3OQ5 A;  4II1 A;  5KCO A;  2HNI A;  2ZPE B;  2ZPF B;  3OS5 A;  4OGC A;  3CXC S;  1NJI C;  3LHD A;  5J26 A;  4M7D A;  2FL7 A;  4C5E A;  2EJG A;  3HRS A;  2CZ7 B;  3M54 A;  2DD4 A;  2GCX A;  2OTJ A;  4KLN A;  1QVF A;  2ZPG B;  4BY6 B;  1NPR A;  1XQH A;  5CD1 A;  2Q1D X;  4BY6 C;  3VYH B;  3QKJ A;  1UGP B;  4PJO G;  2EQM A;  2HAX A;  2RHI A;  5GAN h;  5I2S A;  3WXM B;  3LWI A;  1Y7X A;  2QXF A;  4XTW A;  1YJ9 T;  4PJO A;  4ZGE B;  5CCB A;  3FJP A;  1YJW A;  2K2V A;  2XID A;  5CKE A;  1QP3 A;  5A0L A;  2JTF A;  4QVC A;  2V8J A;  2PJH B;  4BUG A;  5GAN 8;  2CGH A;  2VXE A;  1KQ1 A;  1WPY A;  2L89 A;  1JJ2 S;  5FU7 B;  1QCS A;  1S72 T;  4PKC C;  1CZ4 A;  3JB9 H;  2MI6 A;  2RHX A;  4M78 E;  3J80 E;  4ZTJ A;  3HU3 A;  4M77 D;  3L42 A;  4CI0 C;  2VYT A;  2K5F A;  4XU2 A;  3FEO A;  1JJ2 A;  3TIW A;  1BI2 A;  1JB0 E;  4E7J A;  1BI0 A;  1G3W A;  1O75 A;  2BUD A;  3VV0 A;  4M7D F;  4C8Q D;  1JRI A;  1MHN A;  4OB2 B;  3JB9 I;  5ERG B;  4XK8 E;  3QO3 A;  3OS0 A;  4QVD A;  3PIP A;  3A8G B;  4M77 C;  5D6W A;  3TEE A;  4J6W A;  2KY9 A;  4C0G A;  3PIO A;  4MML A;  5IAY A;  2M0O A;  1VQK A;  4M7A D;  3CMA A;  1B34 B;  5KE2 A;  1NZ9 A;  1O54 A;  2XIC A;  2EIF A;  3OS1 A;  4KUI A;  2DXU A;  4E7I A;  1QVG S;  1M90 U;  2CZ0 B;  2CZ1 B;  2DTH A;  2LDM A;  3CPF A;  3E9G A;  4PJO F;  4A4E A;  3LYI A;  3CPW A;  4JS4 A;  4MDX A;  3QYG B;  5M9O A;  2RA2 A;  2K3Y A;  3C95 A;  2O4X B;  2KK4 A;  4FIB A;  4QW2 A;  1YJW T;  3CC2 T;  1O9S A;  1H3Z A;  4CRI A;  3E9F A;  3NTI A;  1VQM A;  2GQV A;  3VKI A;  1UGR B;  5LJ3 f;  1Y07 A;  5LJ3 g;  4BAC A;  1K8A U;  4M75 D;  4HT9 A;  3RMS A;  4C0F A;  2DVE A;  1UB4 A;  3ASK A;  1VIF A;  2EQK A;  3EFS A;  3OS2 A;  2MWP A;  2HD0 A;  3MET A;  2MWO A;  4NL2 A;  3OW2 A;  5LJ5 e;  5FTJ A;  2Q18 X;  3VU3 C;  2DK3 A;  1BI3 A;  1UGS B;  3SDZ A;  5D6Y A;  3URG A;  3BFM A;  3UT1 A;  4B9W A;  1FXX A;  1PSF A;  4XU3 A;  5HK0 A;  3S3M A;  2RI3 A;  2CS7 A;  1VQ9 A;  4OF1 A;  3BDU A;  1S3S A;  5GAO l;  1KC8 U;  3CCJ A;  1VQK T;  1ZC1 A;  3CMA T;  2MMP A;  3I55 A;  1N8R C;  4M7D B;  1GXI E;  3CCM A;  1KQS S;  2LVM A;  2X4W A;  2EJ9 A;  2LNV A;  3CCJ T;  3GNF B;  3NTK A;  3S6W A;  2RI2 A;  3A8H B;  4IUT A;  1LOJ A;  5A0G A;  2JUF A;  3H6Z A;  1M9S A;  4XQ3 A;  5CK9 A;  4EPC A;  2Q19 X;  1Y96 A;  5DLO A;  2RHZ A;  2JTM A;  2QTX A;  2RH2 A;  4C92 D;  1YJN A;  5I2M A;  4PJO B;  1AHJ B;  2DEQ A;  4N4H A;  2RJE A;  2X4Y A;  5GAM h;  1VQM T;  3GP8 A;  4M77 G;  1NJI U;  3JSC A;  3M4Y A;  3HSB A;  3JRZ A;  2E1H A;  2XI9 A;  5IN1 A;  1Q86 C;  5FTL A;  3HFN A;  2EFI A;  3A5Z B;  2EQU A;  4HKE A;  2RK1 A;  4M77 A;  3EFR A;  4MZT A;  4XTZ A;  4C92 C;  3OMC A;  5GAN f;  3OBW A;  3HHT B;  5CCA A;  3QZ5 B;  4WF2 A;  3HPW A;  4EMH A;  5GAO m;  2E10 A;  1K73 C;  3RUX A;  2EQJ A;  3M55 A;  3HFO A;  4C8Q A;  5GAN d;  3L2U A;  1YIT A;  2ZPH B;  1WQW A;  1LJO A;  1M1F A;  2B8A A;  3PTA A;  3S3O A;  1VQ9 T;  3CCU T;  1WNL A;  4ZGD B;  1YHQ T;  5GMK e;  1RL2 A;  3OMG A;  3GIB A;  4M7A A;  1CR5 A;  2VXF A;  3MP8 A;  4MZP A;  1ZBX A;  4XTY A;  3V7S A;  1VQ7 T;  3CBP A;  1H64 1;  3C94 A;  3HRU A;  5CR2 A;  5FTM A;  3JCM e;  2RJD A;  5FU7 C;  4JRK A;  2PVD B;  4LDV A;  3G7Z A;  3X26 B;  1WJR A;  3G71 T;  2OTL A;  5C6S A;  1WQ7 A;  2K57 A;  5GAN 2;  4M7D E;  2FYK A;  3QDR B;  4M75 G;  3L1A A;  5FU6 C;  1YJN T;  1OZ3 A;  4EMG A;  2JOY A;  3O8V A;  1Q81 C;  3EAE A;  1VUB A;  4HCZ A;  3OYY A;  4M75 A;  4M77 F;  4JS5 A;  4J83 A;  4X9D A;  5EG2 A;  4JRP A;  3L2Z A;  3SWN C;  3CD6 T;  2RO0 A;  2YHT A;  4PJO E;  1N9R A;  4QQD A;  1SSF A;  3H8Z A;  1WJQ A;  3LGL A;  3OYK A;  2WSE E;  4FT4 A;  3ZGZ A;  2H3J A;  1YIT T;  3DB4 A;  4QVZ A;  4C5I A;  2X4X A;  5GMK i;  4JRQ A;  4LD9 K;  3QBY A;  3L2Q A;  3KUF A;  1D3B B;  4DA4 A;  3ZEH A;  1M1G A;  2RM4 A;  3CXC A;  1I8F A;  3NTH A;  4OVA A;  4DOV A;  1OYX A;  3NFC A;  4OP0 A;  5C0M A;  3HU1 A;  2RK2 A;  4KUD K;  1YBY A;  2D6F A;  2DZC A;  4FT2 A;  2XKO C;  3J7A F;  4IUQ A;  4F7U G;  4A4F A;  2I2L A;  3OYN A;  3OYC A;  2GFA A;  5CO7 A;  3QC8 A;  2IVW A;  3CBO A;  4C92 G;  3ZFJ A;  3CCQ A;  1KD1 C;  2OTL T;  4F7U A;  1BIA A;  1ZQ1 A;  3A8L B;  2QI2 A;  3JAM E;  4IUR A;  3CCV T;  2PWY A;  2RD1 A;  4A53 A;  4C92 A;  2F5K A;  4M75 F;  3L2R A;  2QEX A;  3JB9 J;  4BE1 A;  1IZ6 A;  2QQR A;  5CKH A;  5GAO n;  1VQL T;  2FVU A;  2RJF A;  3UDC A;  4KT0 E;  2BKD N;  1Q7Y C;  3HRT A;  3M4G A;  2YLC A;  2ZPI B;  3JCM X;  3CCS A;  1YIJ T;  1N8R U;  3SD4 A;  2MM0 A;  3OA6 A;  2JVV A;  4MMK A;  3PMI A;  5LJ5 h;  1VQN A;  3FPU A;  3INZ A;  3CCE A;  1QDN A;  2YRV A;  2XG8 D;  4M77 B;  4Z02 A;  2YLB A;  4ZN3 A;  3OBY A;  3FC3 A;  3QII A;  5EPP A;  5C18 A;  2OTJ T;  3MCA B;  4J7I A;  5CAI A;  4E7K A;  2GFU A;  5GAM f;  4L59 A;  2LT1 A;  4C8Q C;  5LJ3 j;  1G3S A;  4GY5 A;  2Y4Y A;  1NPP A;  5GAN 3;  3JCM P;  4AS1 A;  3KBG A;  3QHS A;  4C0Z A;  5A2Q E;  5GAM d;  3C12 A;  4M7A C;  5DY9 A;  4LDY A;  2O01 E;  5CIU A;  4F7U F;  3OB9 A;  4HA8 A;  1Q86 U;  1G5V A;  4J5Y A;  2DD5 A;  5GAN 5;  1QVG A;  1VQ5 A;  3CCQ T;  2P0P A;  4C92 F;  3OYF A;  4J6X A;  3V7C A;  3CC7 A;  1U1S A;  1I9G A;  1QW1 A;  4PL6 A;  3SWN A;  4FSX A;  2C06 A;  4JLG A;  4B9X A;  4L6V 5;  5HY6 A;  5HKC A;  4AQ7 A;  2XDD A;  3L2W A;  3V7R A;  3OYL A;  3CCL A;  1Q82 C;  3MEV A;  3DLM A;  1VQO A;  2FB7 A;  3QUI A;  1N6A A;  3JCM V;  2ZZD A;  4M75 B;  3CCS T;  1KG1 A;  1HXD A;  3T9N A;  1N27 A;  4M75 C;  3CF2 A;  2HQX A;  2M1H A;  1FWZ A;  1VQN T;  4KDL A;  3CCE T;  3FDR A;  4GLK A;  5GLF A;  3BQB A;  2OAU A;  3QQ8 A;  2P4T A;  3C4S A;  3WVD B;  4JRI A;  3L2V A;  3CME A;  3FRN A;  4C5H A;  4BDZ A;  1BKB A;  5GMK h;  2PU9 B;  2YUJ A;  4MZM A;  2L5Q A;  2CZ6 B;  3JCM b;  4M77 E;  2JZ2 A;  3MHX A;  1Q81 U;  3M53 A;  3JCM h;  3G4S A;  3PT9 A;  4OB0 B;  4LDW A;  1KQS A;  3M56 A;  5J39 A;  3N5B B;  4IKF A;  1W2B S;  2WSC E;  3UPU A;  3M58 A;  1M5Q 1;  4ELZ C;  1R7R A;  3R6O A;  2DTO A;  5CKD A;  4M7D D;  2V8K A;  1QVP A;  2EAY A;  2V8I A;  3LLR A;  4F7U B;  3QG1 A;  3FPR A;  2XDP A;  2PVO B;  5FTN A;  2Y90 A;  5FRO A;  4C92 B;  2QQ9 A;  1HK9 A;  4RG2 A;  3CCL T;  5GAN g;  1K9M C;  1VQO T;  4C8Q G;  2M16 A;  2RI5 A;  3OSS C;  2AHJ B;  2E12 A;  3JCM Q;  3UWN A;  3A8M B;  2DIG A;  2L8D A;  1I5L A;  4M7A G;  4ARI A;  4IUP A;  4C0D C;  4O6J A;  4J8O A;  2P0K A;  5J3B A;  2DJZ A;  3M57 A;  1N9S A;  2PQW A;  2VV5 A;  3FB9 A;  3J81 E;  1KD1 U;  2A7Y A;  2DXT A;  3QPH A;  5LL6 S;  3I55 T;  3LGA A;  3CCM T;  2LT4 A;  3RKY A;  2E41 A;  1LNX A;  4PLL A;  1KQ2 A;  4FL6 A;  5FRM A;  3GOX A;  2HQE A;  5DLQ E;  2XD0 A;  3GLX A;  4OB3 B;  5IT9 E;  1V29 B;  3G4S T;  2R5M A;  5LJ5 g;  5LJ5 f;  2CKK A;  3JB9 D;  1Q7Y U;  2DXC A;  2XK0 A;  3ER0 A;  1VQ4 A;  1IRE B;  5FU6 B;  3P8D A;  4ZGJ B;  2DAQ A;  1UEB A;  4CQN A;  4E47 A;  5LJ5 d;  1B34 A;  4EMK C;  5D6X A;  4HT8 A;  3PFS A;  3FLG A;  4M78 D;  3SWN B;  1M4Z A;  1WGS A;  2K3X A;  2QQA A;  1VQ8 A;  3X20 B;  3OYD A;  2VUB A;  3LWH A;  2P0Q A;  4C8Q F;  1X6O A;  4N4I A;  3GPL A;  4YTL A;  4F7U E;  3I56 A;  4M78 C;  3DB3 A;  5CQY A;  4M7A F;  1I81 A;  3QZ9 B;  4RCB A;  3SFM A;  4C92 E;  2RHU A;  3S3N A;  1YCY A;  3OYH A;  3V8L A;  1QP2 A;  2E64 A;  2LCL A;  1OI1 A;  3CEY A;  5GAO r;  3ZJV A;  3JCM W;  5A0D A;  3RKW A;  3HU2 A;  3LH0 A;  3G6E A;  4LDX A;  3F70 A;  4BE0 A;  3TU4 K;  2LW6 A;  4ARC A;  2RJC A;  1RI0 A;  3PMT A;  5EQJ B;  4E7L A;  3FIF A;  1CZ5 A;  1Q82 U;  1G3T A;  2LTO A;  2GF7 A;  3OYM A;  1QVF S;  2FHD A;  3A8O B;  1P92 A;  5DYG A;  2KMT A;  4X9C A;  3QXE B;  5LJ3 e;  1U1T A;  2KVQ G;  1Y96 B;  2ZPB B;  2PUK B;  3DLL A;  4RV0 A;  3BDL A;  5CKF A;  2Y4X A;  4R56 A;  4P5N A;  2NLU A;  2LX9 A;  5GAM j;  3VUZ A;  3M59 A;  4KO8 A;  3GNG A;  4N0A C;  2K4Y A;  1VQ8 T;  2EKO A;  3PGG A;  5FRN A;  3QWZ A;  1XNI A;  4ME7 A;  3GF5 A;  4JLI A;  2R58 A;  3ZBD A;  4KBM B;  1JBM A;  3JCM f;  3JCM g;  2G3R A;  3RES A;  2DIQ A;  4QQ6 A;  5HK3 A;  1Y71 A;  1R8O B;  4TVR A;  4R55 A;  3I56 T;  2RHY A;  3JCM d;  1BYM A;  3CC2 A;  4BDY A;  4XU1 A;  4C8Q B;  5GAM g;  1M1K C;  2VGN A;  4EDU A;  4HCB A;  4L5G A;  2IG0 A;  2DKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...