2GFAA

Double tudor domain complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
107
Chain Sequence
ALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
total genus 20
structure length 107
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfaA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gfaA02
2RO0A 3LYIA 3MEAA 2L89A 4BD3A 3E9FA 4E7HA 3DB3A 3OYMA 3LLRA 2BUDA 3UWNA 3OYBA 1MHNA 2WACA 2G3RA 2RHZA 5D6YA 4E7JA 2JTFA 3PMTA 3H8ZA 2R5AA 2LTOA 2XK0A 3EAEA 3L42A 4IUPA 2RHIA 5IN1A 4BE0A 3OYEA 3UT1A 3QBYA 2RJDA 2DAQA 2E6NA 2EQMA 5IAYA 4OVAA 4LD6A 3FLGA 5FROA 2R57A 4GY5A 3MO8A 2RJEA 4E7KA 3QIIA 3OYCA 5CIUA 2M1HA 4BDYA 3MEVA 3OYJA 4QVZA 1SSFA 5M9OA 5FRNA 2MWOA 1WJRA 5C6SA 5KCHA 1OZ2A 4HCZA 3MP8A 3P8HA 4C5EA 4Q5WA 3F70A 5KH6A 2CKKA 2GFAA 3OA6A 1WJSA 3L2VA 3FC3A 2BIVA 2X4YA 4FL6A 2RHYA 3MEUA 4IURA 4PLLA 4C5IA 5KE3A 2M16A 3S6WA 2PQWA 3L2RA 3LGFA 3LX7A 2EQKA 2RHXA 3OS1A 2R5MA 4X34A 3BDLA 4PLIA 1G5VA 3CEYA 3OS0A 2NLUA 3OYNA 3OYFA 5D6XA 3SD4A 3MP1A 1H3ZA 1XNIA 3H6ZA 3L2QA 3MP6A 3QKJA 3PMIA 3L2UA 3LGLA 3S3OA 3E9GA 3OYGA 3META 2IG0A 4FU6A 4UC4A 4EDUA 3NTKA 3DB4A 3PFSA 2M0OA 4L59A 4PL6A 3P8DA 3PNWC 2GFUA 4BE2A 3S3MA 3OMGA 2X4WA 2L8DA 2LDMA 2RHUA 2EFIA 4A4EA 2E5QA 4QQGA 2EQJA 4QQDA 2HQEA 2L3RA 2LRQA 4BE1A 4IUTA 2XDPA 4BACA 2RJFA 3OB9A 3OMCA 3OS2A 2DIGA 1OI1A 2QQSA 3MEWA 3ME9A 2D9TA 1WJQA 2RI5A 4QW2A 5D6WA 2X4XA 3OYIA 3M9QA 3L2WA 1KHCA 2JZ2A 4E7LA 4II1A 2EKOA 3OYDA 4ZTFA 3LH0A 1N27A 2RI3A 3S3NA 3NTHA 3QJ6A 3DLMA 3C4SA 2HQXA 4A4GA 4IUQA 2QQRA 4C5GA 3OYLA 2LVMA 5J26A 4CRIA 2GF7A 4E7IA 4N4GA 4IKFA 4N4HA 4B9WA 2P0KA 5C0MA 4IUVA 3OYKA 2BKDN 3NTIA 2RJCA 4N4IA 4BDZA 2R58A 4NS5A 5J39A 3O8VA 2DIQA 3ASKA 2YRVA 4IUUA 3ZEHA 3OYHA 2F5KA 4A4HA 2X35A 1RI0A 3Q1JA 4QQ6A 2MWPA 2K3XA 4Z02A 5KCOA 3GOXA 4RG2A 4B9XA 4ZTJA 3FDRA 2RI2A 2K3YA 1OYXA 2B8AA 4C5HA 2EQUA 1WGSA 2LCCA 5KE2A 3OY9A 3OQ5A 1OZ3A 3KUFA 4A4FA 5FRMA 2O4XA 3FEOA 2FHDA 2VYTA 3OYAA 2O4XB
chains in the Genus database with same CATH superfamily
3J7AF 3LYIA 3X24B 4R55A 2PU9B 2RMOA 2DRMA 2JTFA 4M7AC 2EVRA 1YITA 3OW2S 2DL3A 3EAEA 4ARIA 1WI7A 3A8MB 2J6OA 5IAYA 2KRSA 4LD6A 4DBHA 5CIUA 1X6OA 2JMCA 3ZJUA 3GLXA 3JCMX 3RMSA 4Y91A 1M27C 3CXCS 2CT4A 5ECAA 4KH0B 1EIFA 2E6ZA 4IURA 3I9QA 1IREB 5AYFA 2FRWA 1M2VB 1YJWT 1KSWA 3LGLA 1AWOA 3CC4T 2DZCA 2MMPA 3I56Q 4J6YA 1IHWA 2NYSA 1K8AR 3EFSA 4LDVA 4EMKB 5GANh 3OMCA 2MCNA 3SWNB 4TVRA 1VQ4A 5GANj 1OEBA 2EYWA 2X4XA 3M9QA 2GGRA 1MNEA 4LUDA 3C0CA 4FYVB 1GCQA 2CSIA 4OGEA 1R7RA 2YUOA 3CD6A 4M7DC 4IUVA 1SRMA 1ZBXA 3RMQA 2DA9A 4IUUA 1VQ5Q 1U1SA 3HFNA 4C0DC 1FWZA 1PC0A 8ATCB 2HNIA 1AWXA 4KUIA 1K76A 2HZYA 1WFWA 4EMHA 1WGSA 2G6FX 4A63B 4LDXA 1IGUA 5CCBA 3KUFA 2QTVA 2YRDA 4JS4A 2VYTA 2DJZA 4RTWA 2M02A 1VQ9T 2Q1CX 3HRUA 5LJ5h 2FZKB 2C0OA 4BB7A 1PSFA 4AS1A 3M0RA 4JS5A 2JTMA 1W4SA 5FTNA 1PD1A 3QBYA 4M75G 4OVAA 3OS5A 3GIBA 4GLKA 2JS2A 1CR5A 2E5KA 2Q1DX 3VJPA 5LJ3e 1OULA 2LZ6B 3QYHB 4AFUC 1UGQB 4DEYA 3OS1A 3GF5A 3OS0A 3A1PA 4C8QE 1VQOT 4X9CA 5GMKj 1B34A 3QKJA 4B6MA 3CD6T 5IT9E 3VS4A 4WF2A 2CDTA 2PVOB 5DM7R 4PJOC 1CZ4A 4J9BA 1VYTA 1RL2A 1WJQA 3L1AA 4J6WA 4QW2A 2AZSA 4N0AA 2VXEA 4C0GA 5A0LA 1BI1A 3VRZA 3CCET 3REBB 4PK4A 2DJQA 1E6GA 4B9WA 4OMPA 4D6WA 5FU7B 2V26A 3ASKA 2YUPA 3EG9A 3ZEHA 4KDLA 1G3SA 4GBQA 2PVGB 4NOYA 1K73C 2BTTA 1SKUB 1CKAA 2JT4A 4FSXA 2C06A 1Y96B 4LUEA 2VWFA 1UHCA 2JNGA 4HCCA 1I5LA 1G3YA 2YRCA 2DTIA 4C8QD 2ATCB 1M5Q1 4HCBA 3VS0A 1CZ5A 3H8ZA 3CBOA 2FPEA 5IN1A 3QO3A 4XTWA 1AEYA 4RMOA 3G71T 5FU7C 3EHQA 1VQPT 2H8HA 3OYJA 1UB4A 2RB6A 3DLLA 5C6SA 1RAEB 5CQYA 2AK5A 4C8QG 1WYXA 5GANe 3FC3A 1BKBA 1PG5B 4FL6A 3M5AA 1MMDA 5CKBA 2EQKA 4M75B 4XU3A 3BDLA 1AD5A 1H8KA 1LNXA 2HQHA 2OAWA 3JCMh 1J3TA 3U23A 1V29B 1AZEA 5FWBA 1QCFA 2P0QA 4L59A 3PFSA 1K8AU 5CO7A 1AT1B 2E4HA 3CPFA 4ORZA 3M4YA 2QA4A 2EFIA 4XTUA 1RAHB 1PD0A 4ELYC 1K4US 4RTVA 1X43A 4BE1A 1KC8R 1AHJB 3RBBB 6AT1B 3SHWA 2DVEA 1ZA1B 3H0IA 2E70A 2EGAA 4AQ7A 1K0SA 2F1LA 1Z9ZA 5CAIA 4ELZC 3HTRA 2VVKA 3QZ5B 1K73R 3CC7T 1NE8A 1YJ9T 1Y71A 2GF7A 5CCXA 3V8JA 2ECZA 4BDZA 1P92A 1NBEB 1PWTA 2AKKA 5KYYA 2YRVA 2KROA 4Z02A 5KCOA 1OPLA 4RG2A 2JMAA 1B3QA 3I56T 2KT8A 4PJOD 5IXBA 4R56A 4BI8B 4M75D 3OYAA 5LJ3h 2RM4A 3JAME 2RO0A 3OW2A 1VQPA 2E1HA 4C92C 3QPHA 1QWEA 3MKDA 2WACA 1VQOA 2KI7A 4M77E 2EJFA 1S3SA 2LTOA 2YUJA 3RERA 3I5SA 3UPUA 2OTLA 1SPKA 2XDBA 2E3HA 4MZMA 5LJ5f 2YXYA 2KAFA 1B7TA 5M9OA 4Z89A 3P8HA 2QQ9A 1NYGA 1K9MU 2NUTB 1VQMQ 1M8VA 2RHXA 2DTOA 4IIOA 4X34A 1RAGB 2DL7A 2QA4Q 2ZGWA 2KYMA 3M55A 5GAOm 1YJ9Q 3H6ZA 2HL3A 4CC2A 1X2QA 3CC2Q 4AFSC 3META 1VQ4Q 1YNZA 2RH2A 3P8DA 1RUWA 1T0JA 1N8RU 1X6BA 1T3LA 2KXDA 1VQ8Q 1VQNT 4OMOA 2ABLA 2J6KA 3SFMA 4PJOB 5KYUB 1FMVA 5GMKl 1LCKA 3I56A 3UA6A 1GBQA 2C0IA 1KHCA 4A53A 3OYDA 2JW4A 2YUNA 2MOXA 2NUPA 3QG1A 4IUQA 1Y0MA 3UF4A 3I5RA 3JCMd 5GAOq 2BKDN 3NTIA 2RJCA 3X20B 5J39A 5IHNA 3GOXA 5EQJB 5GAMe 1PKSA 1X01A 2DFUA 2B8AA 2HD0A 2P4TA 3OBYA 2QGGA 3ZGZA 4C92G 2EPDA 1AVZC 1KJWA 4JRIA 3FEOA 4OMFB 4PJOF 2AZVA 4QVCA 1VQ5T 1VQOQ 2X3XD 3LLRA 3OYBA 3JCMc 1KQ1A 4KDIA 3JRZA 3EGXB 2R5AA 2FPFA 2WSEE 4RCBA 1D1CA 3JCMe 2GQVA 2XI9A 1Q81U 1QCNA 2RQVA 3VYHB 4GY5A 1KK7A 2DF6A 1KC8U 1UJ0A 1D3BB 3OSVA 4KODA 2H3EB 5GANf 3L2VA 4DBQA 2A28A 2CYZB 3EG3A 2QI2A 3INZA 2RK2A 1ZA2B 1QVPA 3RESA 2DEUA 2JS0A 2L3QA 2MF2A 4O5VA 4QKUA 5KYXB 1QCOA 2A0FB 2ZPBB 1Q86R 1M3AA 2KE9A 4PFPA 1MV0B 2KRMA 1NPPA 1TSFA 2J06A 1TH7A 4ANJA 3CXCP 4JRPA 3OW2P 1FX7A 4MZPA 1WX6A 2F2WA 4IUTA 1RI9A 3SB2A 1M90R 1OU8A 5GAMj 4L6V5 4EIKA 3OB9A 4DOWA 1PNJA 4AG1C 2QQSA 4M78F 1KFZA 2LQWA 3I55T 2L0AA 2EKOA 2QQAA 4XU1A 1VUBA 1KQSS 3RUXA 2MK5A 2KSSA 5LJ5j 2GNCA 5GJWB 2HCKA 4M7DA 1JRIA 3O8VA 1PSEA 1WZOA 4JPBW 4OB2B 1WLFA 4FIBA 1D09B 3BW1A 2VC8A 1ZQ1A 3N5BB 4XK8E 3EH2A 1K9MR 2CP0A 4JUVA 2FHDA 4CC7A 2HKNA 3KBGA 4E7HA 3FPTA 2G3RA 1WPYA 2K79A 1FMKA 4DA4A 2QA4T 3G4SQ 3VS2A 2VXFA 2EYXA 3VUBA 1EX4A 4NL3A 2COZA 3VRYA 2PNIA 3MCAB 1E6HA 2DAQA 1JQQA 4KT0E 1WHLA 5CKEA 1K8AC 4GLMA 3R6NA 2MWOA 4M7AD 1F1BB 1YHQA 2P4RA 4BE2A 3CPWS 4A54A 2BIVA 2M16A 2PQWA 1ACMB 1UGSB 1ZUUA 1BCOA 2QEXA 1JXOA 1GFDA 2QAZA 1VQKQ 1G8XA 4JJCA 3EGUA 3E9GA 2LW6A 2FO0A 5GAN4 3CPWP 2HL5C 2RA2A 4R0KA 4N0AC 3JB9F 3CCRQ 5HY6A 1FMWA 3CMAQ 1KG1A 3O5ZA 2OTJT 1DJ7B 5I22A 1MV3A 4OB0B 1IGQA 4J83A 5IH2A 2J6FA 3CCMT 3SEMA 2MAMA 1AOJA 4HVVA 1RACB 2E3IA 1VQ9Q 1WHJA 2DXBA 1D0XA 2CUDA 1D0ZA 1G3WA 2XKOC 4N4HA 4N4IA 3G4SA 5LL6S 4M75C 2JV2A 2VGMA 5KYYB 2D0NA 4A4HA 3Q1JA 1M1GA 1WIEA 1ZX6A 4C0FA 2XDDA 1QVGS 1VQ7Q 3M0UA 2BZXA 5EC7A 1U06A 4XU0A 3CC7A 1TU0B 2WSCE 2CZ7B 3H0HA 1TTHB 4ZNXA 3MEAA 4C92A 3CCVT 3M0SA 1LVKA 1RAIB 2LJ3A 2LQKA 2Y4YA 4HCKA 2NUZA 3CCJQ 2D6FA 2RHZA 4E7JA 4KH1B 3A8HB 2CGHA 3HP9A 1C0MA 4XU2A 2F2VA 3EHRA 1TXQA 4OB3B 3MB5A 2R57A 4FW2A 1KC8C 2DZ9A 2QG9B 4BDYA 1HXDA 1I5OB 1SRLA 2RF0A 1NJIU 1M90U 2HBWA 1VQPQ 2CKKA 2X4YA 4FW1A 2RHYA 3QWZA 1T0HA 5GAMf 4PKCC 3X28B 2R5MA 2QDYB 1I1JA 2FB7A 4O6JA 4LDWA 1HYOA 1H3ZA 2E10A 3M0PA 4J9FA 2A3LA 1Y96A 4PJNA 3L2UA 2Z0WA 2LNHB 3GNFB 2VV5A 9ATCB 3HPWA 3DB4A 2MIOA 2M0OA 3CC4Q 4RTZA 2Q19X 5GAMd 1H3HA 3LGAA 2CSQA 4ZN1A 3VKIA 3TQ7P 2HSPA 1ZUYA 3VUZA 3RKYA 2CT3A 4HT8A 3OS2A 2DL4A 1RAAB 5D6WA 4EPCA 1YITT 3NTHA 5FU6C 2DX1A 4A4GA 1NLOC 5J26A 4J9DA 4MDXA 2EWNA 4ZGEB 2P0KA 5C0MA 5CR2A 4KGZB 2PTKA 4MDWA 3MPUB 5GMKi 4OMNA 1UGVA 5J3BA 1HK9A 3G1JA 4D8KA 3OYHA 3A8GB 1VQ6Q 1UE9A 1YBYA 1RADB 3EG9B 1QP2A 1WA7A 1R8OB 1I0CA 2ZZDA 3G6EA 3KFVA 4E2FB 2O4XA 1PRMC 3J80E 1TUCA 1YITQ 4MZTA 5GMKe 2JN0A 4PJOE 1ZC1A 2EKHA 2RPNA 1M2VA 2KT1A 2QXFA 3MJXA 2QEXT 5D6YA 2EYYA 3PMTA 5FU6B 3X25B 3CCEA 1Q81R 1MMAA 5EPPA 2CP3A 3TVTA 1NM7A 4DBRA 3UT1A 1G83A 2RJDA 2EQMA 2K4YA 2KBTA 2P84A 2DERA 4DEXA 4C8QC 4ESRA 4JRKA 4M7AF 1TS9A 1QCSA 3VS3A 2J05A 3FPRA 3OA6A 5KH6A 3HFOA 1KQSA 4KGXB 4M75F 1VQ8A 3CCLQ 1Q86U 2ENMA 1BIBA 4RUGA 2K5FA 5GAOl 1BI2A 4OMQA 4F17A 1G2BA 5GAN7 3HSBA 3JB9D 3FPUA 1EZZB 1FYNA 3OYGA 1T3SA 4EDUA 2MM2A 5CKFA 3OMGA 2X4WA 2LDMA 2V1QA 2OX7A 5FWCA 4QQDA 3QC8A 2CP7A 2E12A 2DMOA 1M4ZA 1GL5A 3CCSQ 3A8OB 4C8QB 2BZ8A 4HVUA 2JUFA 4E7LA 5HK3A 4IIMA 1N27A 3S3NA 1W70A 3CCVQ 3EG2A 4OGCA 3LH5A 5A0GA 3M59A 2FRYA 3V7CA 2FZCB 2XG8D 4M78C 4OMLA 3RKXA 2KYBA 2F5KA 5KYXA 2V8IA 5LJ3g 2LX7A 2L3SA 4OMMA 2K7AA 3FDRA 1CKBA 2PWYA 2PZ1A 4AMCA 2CZ0B 5EG2A 3MHXA 1OZ3A 3JCMf 4E7ZA 1YJNT 1X69A 1NEGA 3JCMP 3TIWA 5A0DA 3TREA 5LJ3f 4AFZC 3DB3A 1O75A 2DL8A 2I0NA 1JBMA 3JV3A 1VQ8T 3PVLA 2LMJA 1HJDA 4JZ4A 3FLGA 1QQJA 4F04B 2LJ1A 2M1HA 1U3OA 1HSQA 5FTLA 4FYYB 4M78D 1OZ2A 4HCZA 2HSEB 1H641 5GAN2 1N5ZA 2COWA 1VQNA 3RKWA 2DRKA 2FVUA 1Y57A 2KNBB 3C12A 3PIOA 2EIFA 4M75A 2PVDB 2ZPIB 3X26B 2RN8A 3OYYA 2Y90A 4C92D 3OSSC 2ZPFB 3CCQA 3QDRB 2FL7A 3AHUA 3S3OA 2M9UA 4UC4A 4LXCA 1YI2T 3G71Q 3V7RA 4AT1B 3M53A 3JB9H 3CCQT 1SG5A 4Y92A 2EGEA 2LRQA 8AT1B 2XDPA 4ZGJB 5DLOA 5FTKA 4M75E 1OX8A 2RJFA 2HMAA 2CH4W 1VQ6A 5KYUA 2SRCA 2I2LA 3L2WA 4M77G 2DXUA 3EG1A 3OYLA 1YJWQ 4CRIA 3CCRA 3VV0A 1GFCA 4CC4B 2F69A 4ZN3A 3E1SA 2MYSA 4QT7A 2GCXA 2HDAA 3CCUA 3H0FA 1RI0A 3CCMA 1AWJA 1D1BA 2RI2A 2QASA 1UJYA 3JCMV 1VQMT 1YJNQ 1YI2Q 3PT9A 2KQWA 1QVFA 4A4FA 2OTLQ 5FRMA 3VYGA 4AG2C 2YLCA 3M57A 3REAB 1W1FA 3HU1A 3QUIA 3AT1B 5CKDA 1IO6A 1RAFB 1IXDA 3LHDA 2XK0A 1VQLQ 2D0QB 1XTDA 2K2MA 2EGCA 4XAXB 1M3BA 1TG0A 5GAOp 2RQWA 1ZHIA 1KD1R 4WCIA 2W0ZA 1BYMA 2O01E 4C5EA 1JU5C 4LDYA 4Q5WA 2CZ6B 2GQIA 1WJSA 2ZCFB 2YUQA 1VQ7T 2X3WD 3GPLA 5GMKh 2RK1A 1SHGA 1QVGP 1G5VA 2NLUA 2GBQA 1D1AA 3EFOB 4FU6A 1B07A 3TSZA 3CCRT 3NTKA 3HU2A 3PTAA 4PNOA 1TUDA 4QQGA 2L3RA 1ZLMA 3EFRA 1YI2A 1A0NB 4A4KA 1OI1A 5GANd 3CCUT 4M7DG 2D8HA 3CCMQ 1PRLC 1YIJT 1FXXA 4E47A 3JSCA 1VIFA 3QJ6A 3ZFJA 3C4SA 1LOJA 2F5TX 4PFZA 2NUPB 1K1ZA 1VQLA 2CUBA 1WNLA 5CCAA 3CMAT 2X35A 4M7DB 2AIRB 3BQBA 1UGPB 2QYZA 2PJHB 1BIAA 3H41A 4Z88A 1O9SA 1GBRA 1MMGA 3CMAA 2K3BA 1I07A 3TCJA 2FG0A 1UHFA 3BE3A 4XTVA 2OAUA 1VQ6T 3VS6A 2DD5A 3ZBDA 3FIFA 1N8RR 3D7SB 1QKWA 3EGXA 5HCKA 2ZPHB 2RHIA 2IVWA 1M1FA 2E6NA 2ZAEA 2OI3A 3JB9J 3QIIA 1SSFA 4ZGDB 1ABQA 2KR3A 2E65A 3CC2T 1AWWA 1QP3A 3ZJVA 2GFAA 4C5IA 5KE3A 3TSWA 3S6WA 3L2RA 3DKMA 2IIMA 1Q7YU 2LCLA 2FEIA 1GCQC 2LX9A 2L2PA 5D6XA 3V8KA 2DXCA 1O54A 2QDLA 1XNIA 3JCMb 1Q82U 2A7YA 4ARCA 2DYIA 1W6XA 2LNVA 3M56A 3PVQA 4JLIA 3CMEA 2Q1AX 3CCQQ 2LQNA 3J81E 1QMCA 2DXTA 1PKTA 4A4EA 4LNPA 2QQBA 1R0BG 1IHVA 2QTXA 2MPXC 1RABB 5GAN6 2ESWA 2D1XA 1PHTA 1K0XA 2JZ2A 3LWHA 3T9NA 3JCMJ 4FT4A 3I55Q 1IZ6A 2LVMA 3CC4A 4JDSA 3LW5E 3OYKA 1YN8A 3CCVA 2MM0A 4BY6C 3G7ZA 1X75C 2R58A 4J5YA 2EQIA 1VQLT 4RTUA 1TWBA 3TU4K 4QQ6A 2VKNA 1HD3A 4FCYA 4KLNA 2EJ9A 2EQUA 2X4JA 3WVEB 1K9AA 1M9SA 2LC4A 5GMKm 1UG1A 2BUDA 3BY7A 1M1KR 2XU8A 2DEQA 4C8QA 1QW1A 4EMKC 1LPLA 1W2BA 4CQNA 2DKGA 1ZSZB 3CBPA 4F7UA 5I2MA 5I2SA 4HXJA 4IUPA 1QVFS 1TUGB 1KD1C 1OPKA 3M58A 3ER0A 2JXBA 2RJEA 4MMKA 1MMNA 3MEVA 2X9HA 3CMET 4J9GA 2OTJA 2OJ2A 1S72T 4KULA 3SWNA 4RKUE 1WLPB 1UGRB 1UEBA 3UATA 1BCMA 5DLQE 4KRTA 3LX7A 3THKA 2E64A 1I81A 3CEYA 2EYQA 1Q95G 1SEMA 4J7IA 3CCJT 1AZGB 1M90C 3RR6A 5LJ3d 3M0TA 2JM9A 1N6AA 1JJ2A 2A36A 4F7UF 1X27A 2V8KA 4DBFA 3PNWC 4F16A 2J7IA 4E7SA 5GAMg 4J9CA 2V8JA 2XICA 1QKXA 4E6RA 4BACA 1IB8A 2DYBA 3ULRB 3G71A 3M4GA 1VQ9A 2D9TA 3CCLT 3OYIA 3CC2A 2NUTA 5LJ3j 2YT6A 4J9IA 5GANg 1BK2A 2BZYA 2HQXA 1JB0E 3G6ET 2VB6A 2VGNA 2JM8A 4M7AG 4NS5A 4HA8A 4RTYA 1MUZA 1SHFA 2Y4XA 4PJJA 2LCSA 2OTJQ 2QEXQ 2CREA 1OYXA 4C5HA 1VQ4T 2DBKA 2H3JA 2OTLT 4PJOA 4DQ2A 2ZPEB 3UA7A 4BI4A 1M8MA 5IHKA 2C0TA 1QLYA 1W2BS 3C94A 1E7OA 1R0CB 1YHQQ 1VQKT 3E9FA 3OBWA 1B34B 1MHNA 2KXCA 3HU3A 1Y7XA 4EMKA 2FPDA 4PFOA 1K73U 1XQHA 2IPOB 4VUBA 1KD1U 1VQMA 2E41A 2XMFA 3BFMA 5LJ5g 4E7KA 1OU9A 5HKCA 4MMLA 1Z9QA 4M7AA 2KK4A 3FJ5A 1WHHA 1M3CA 1QDNA 2BE9B 2HBPA 3MEUA 1XJWB 1CSKA 3PE0A 1JJ2S 3C95A 2PUKB 4J7FA 1Q82R 3MP1A 4D8DA 4YTLA 5I11A 2ED1A 5GAOn 3G4ST 3L2QA 4M7DF 2EBPA 2DTHA 2KVQG 4KBMB 3H9NA 2EYZA 1Q7YC 2L8DA 1WQ7A 1N9SA 4LE9A 1PCXA 1KHIA 1W2BP 2CZ1B 1VQ7A 2QK0A 1BI0A 2K5IA 4BI3A 3SWNC 3HL8A 3QQ8A 2F2XA 5GAMh 3CMEQ 5A2QE 1MGQA 5L8RE 1BI3A 4M7AE 5FTJA 4C5GA 2O88A 3QYGB 4RG8A 4E7IA 1U1TA 3PGGA 4BY6B 3I55A 2L5QA 4M78E 1NJIR 3CCJA 1KQ2A 2DIQA 1TOVA 1ZSZA 4FYXB 2O9VA 4M77B 5D7UA 4F7UB 4M77F 1I9GA 3QHSA 4B9XA 1Q81C 4C0ZA 2ROTA 2DVJA 5KE2A 4C92E 3OQ5A 3FRNA 3GBQA 3L2ZA 1S72A 4Y28E 1R77A 3QZ9B 4JJNK 3CPWA 2O4XB 3CXCA 4RV0A 4OB1B 2HAXA 4J9HA 4F7UG 2L3PA 1NZ9A 3CCUQ 3NFCA 1YIJQ 2DILA 2ED0A 3ZL7C 3A98A 5KYWA 5LJ5d 5C18A 3OYEA 1YJWA 1E32A 3URGA 5CKHA 2EAYA 2DPPB 3HRSA 2DK3A 4V2SA 5FRNA 2BE7D 5KCHA 5CVIA 1Q7YR 4QVDA 5KYWB 3KXTA 1ABOA 2X51A 3LWIA 1D0YA 1YP5A 3LGFA 1C6VX 2GTJA 2RQRA 2JJ9A 5GLFA 4XQ3A 1VOMA 2YSQA 4EMGA 1WQWA 3MP6A 1VYUA 4FYWB 5GAN3 1VQKA 1QVFP 2RQTA 1OOTA 5LJ5e 4M77D 1G3TA 3GNGA 1PM3A 4PL6A 2YHTA 2GFUA 2MI6A 3S3MA 2KDSA 4XTZA 3CD6Q 3JCMg 4HKEA 2DLPA 2HQEA 1YCSB 5B6CA 3SDZA 4X9DA 3JB9I 2DM1A 4P5NA 2COYA 2KMTA 4J8OA 4C8QF 2DIGA 1C1AA 1UUEA 2CH4A 3WXMB 4M78A 4M7DE 3CQTA 4LDUA 2RI3A 4M78G 3DLMA 2O31A 2LJ0A 4KO8A 5FW9A 2V1RA 3M54A 2WSFE 1I8FA 3HKSA 1WHKA 4OP0A 5I21A 4M78B 1KIKA 5C1BA 2LP5A 3ZJTA 2KGTA 3VS1A 2XHCA 5GAN5 1I4K1 1OQKA 1QVGA 1YFNA 3CBMA 5GAN8 4ZTJA 3NGPA 1ZSGA 2LCCA 2CS7A 3OY9A 1S72Q 4C92B 3FB9A 1VQNQ 2LT1A 2P0PA 5DYGA 1V1CA 1QWFA 2RD1A 3NPFA 1EFNA 4HVWA 1M1KU 1NEBA 4BD3A 1SF9A 1JO8A 4FM4B 2KY9A 2DETA 2LQ8A 1M30A 3UWNA 2K57A 3NHNA 2EW3A 3BDUA 3VS7A 2Q18X 2W10A 4ATOA 3CC7Q 3QJYA 3QDFA 2FYKA 3A8LB 1GRIA 3MO8A 4KUDK 1OV3A 3EH1A 2K6DA 1VIEA 3MP8A 1LJOA 1X6GA 3F70A 3CCSA 4Z8AA 4RTTA 3V8LA 4LD9K 1N9RA 1M1KC 4PJOG 4M77C 2DO3A 2ZPGB 4C0DB 2M51A 3VS5A 2KRNA 2NWMA 4CI0C 4RTXA 3OYNA 4C92F 3R6OA 4JRQA 3SD4A 1RLPC 3CCST 4X1VA 2VASA 3E2UA 3VU3C 1WHGA 2K2VA 3RDVA 1ZUKA 4K11A 1U8RA 4JLGA 1UDLA 1U5SA 2RHUA 3WVDB 2EQJA 2XD0A 3CF2A 2SEMA 3M0QA 4PJMA 4AFQC 1YWOA 5IHIA 5L23A 1YJNA 2YDLA 3ME9A 3HRTA 1ARKA 2RI5A 1V76A 1VQ5A 2O2OA 2PUOB 4II1A 3TEEA 3HHTB 2YVLA 1NPRA 1YHQT 4ZTFA 2M0YA 3LH0A 5GAOr 4F14A 2VUBA 2FZGB 1RLQC 4N4GA 4IKFA 3QXEB 5DYIA 3CCEQ 1S1NA 1H92A 2DE0X 2XIDA 4ME7A 3JCMQ 5FLXE 1NYFA 1JEGA 1UFFA 2JTEA 3QSUA 3QQ7A 2MWPA 3RIRA 3EGDA 3I35A 4WTOB 2GTOA 4M4ZA 2LT4A 1XOVA 1D3BA 1MNDA 3CCLA 3RNJA 2AHJB 4J6XA 4JJDA 3PIPA 2AT1B 3G6EQ 2DBMA 5ERGB 1M2OA 2JVVA 2L89A 5GJVB 1VYVA 1YIJA 3OYMA 2AKLA 4LN2A 2YLBA 1BB9A 1WXUA 1Y07A 1X2KA 2DL5A 3GP8A 5DY9A 5CK9A 3L42A 1SSHA 3FJPA 4BE0A 4FSSA 5FROA 2DD4A 2KEAA 1GXIE 2RNAA 2D8JA 3OYCA 7AT1B 1Q86C 4XTYA 4QVZA 4JJBA 1Q82C 1WJRA 2DNUA 1ZBJA 2CP6A 4HT9A 5IXFA 3EG0A 4DOVA 1N8RC 2CP5A 4JZ3A 3IQLA 4PLLA 3A5ZB 3EGDB 2B86A 4PLIA 3OYFA 1WXTA 2HEQA 1BBZA 2YWWA 4M7DD 1IRXA 5AT1B 4KGVB 3PMIA 5KYNA 1GCPA 2ROLA 3P8BB 3JCMW 2IG0A 3QWXX 1YJ9A 5CQXA 1ZSZC 5CD1A 3V7SA 2E5QA 1WXBA 1YCYA 1JXMA 1NJIC 2CP2A 4CC3A 4XTXA 1VA7A 2K5LA 2QGFB 4L5GA 3MEWA 4NL2A 3UDCA 2EJGA 1K9MC 5FTMA 2K9GA 4M7AB 1WDXA 2QQRA 3QWYA 2JOYA 2RQUA 3EFOA 3NMZC 2HKQB 1BU1A 1NLPC 4BUGA 1KQSP 4F7UE 1UECA 3E19A 2K3XA 4M77A 2A37A 2A08A 1WHMA 1NG2A 2K3YA 1OX9A 4RCCA 5HK0A 4PJLA 2O9SA 2B25A 4FT2A 1UTIA 1YWPA 4OF1A 1JJ2P 4J9EA 3JB9G
chains in the Genus database with same CATH topology
3J7AF 3CPWS 3LYIA 4QVCA 1VQKT 5LJ3f 3E9FA 1VQ5T 3X24B 3DB3A 3OBWA 3LLRA 1B34B 3OYBA 1MHNA 4R55A 1O75A 2PU9B 3JCMc 1KQ1A 4KDIA 3JRZA 4M7AC 2JTFA 3HU3A 1JBMA 1YITA 2R5AA 3OW2S 4RCBA 2WSEE 1Y7XA 3EAEA 4EMKA 1VQ8T 3JCMe 4ARIA 1K73U 1XQHA 3A8MB 2GQVA 2XI9A 4VUBA 5IAYA 1VQMA 1Q81U 1KD1U 2E41A 3FLGA 4LD6A 3BFMA 3VYHB 5LJ5g 4GY5A 4E7KA 5CIUA 2M1HA 1X6OA 5HKCA 1KC8U 4MMLA 4M7AA 3ZJUA 2KK4A 3GLXA 3JCMX 3RMSA 4Y91A 5FTLA 4M78D 1OZ2A 3CXCS 1D3BB 4HCZA 3OSVA 1QDNA 4KODA 1H641 2HBPA 1EIFA 5GANf 5GAN2 3L2VA 2E6ZA 4IURA 1VQNA 2CYZB 3MEUA 3RKWA 1IREB 2QI2A 5AYFA 2FVUA 3INZA 2RK2A 1QVPA 3C12A 3RESA 3PIOA 2EIFA 1JJ2S 3C95A 2PUKB 4M75A 4J7FA 2MF2A 2PVDB 2ZPIB 3X26B 4O5VA 3OYYA 2Y90A 4C92D 2ZPBB 3MP1A 3OSSC 2ZPFB 3CCQA 3QDRB 1YJWT 4YTLA 5GAOn 3G4ST 4M7DF 3L2QA 2FL7A 3AHUA 3LGLA 2DTHA 3S3OA 2KVQG 1NPPA 3CC4T 4KBMB 2DZCA 2MMPA 2M9UA 1Q7YC 4UC4A 1TH7A 4JRPA 4J6YA 1YI2T 3V7RA 2L8DA 3M53A 1FX7A 3JB9H 4MZPA 1WQ7A 3CCQT 1N9SA 3EFSA 4LDVA 2LRQA 4IUTA 2XDPA 4EMKB 1KHIA 3SB2A 4ZGJB 5DLOA 5FTKA 4M75E 5GANh 5GAMj 2CZ1B 1VQ7A 2RJFA 4L6V5 1BI0A 2K5IA 3OB9A 3OMCA 4BI3A 4DOWA 5B6CA 3SWNC 2QQSA 3HL8A 4M78F 3SWNB 4TVRA 1VQ4A 5GANj 1VQ6A 5GAMh 3QQ8A 2X4XA 2I2LA 3M9QA 4M77G 5A2QE 3I55T 3L2WA 2EKOA 1MGQA 2QQAA 2DXUA 5L8RE 4XU1A 1BI3A 4M7AE 1VUBA 4OGEA 5FTJA 4C5GA 1R7RA 3OYLA 3QYGB 4CRIA 3CCRA 3VV0A 1KQSS 3CD6A 4RG8A 3RUXA 4E7IA 2F69A 4M7DC 1U1TA 2KSSA 3PGGA 5LJ5j 4IUVA 4BY6B 4ZN3A 2L5QA 3I55A 4M7DA 3E1SA 4M78E 1ZBXA 2GCXA 3RMQA 1JRIA 3O8VA 3CCJA 1PSEA 1KQ2A 2DIQA 3CCUA 4IUUA 4OB2B 4M77B 1U1SA 4F7UB 1RI0A 3HFNA 4FIBA 4M77F 1FWZA 4C0DC 3CCMA 3BW1A 1I9GA 3QHSA 2VC8A 4B9XA 2HNIA 1ZQ1A 3N5BB 2RI2A 3L2RA 1Q81C 4KUIA 4XK8E 3JCMV 4C0ZA 1VQMT 4EMHA 1WGSA 5KE2A 3PT9A 4C92E 3OQ5A 4LDXA 2KQWA 1QVFA 5CCBA 3FRNA 3KUFA 3L2ZA 4A4FA 1S72A 5FRMA 4Y28E 3VYGA 3QZ9B 4JJNK 2YLCA 4JUVA 3M57A 2FHDA 4JS4A 2VYTA 3CPWA 2O4XB 3CXCA 2DJZA 4RV0A 4OB1B 2HAXA 3KBGA 3HU1A 4E7HA 4F7UG 1NZ9A 3FPTA 1VQ9T 2Q1CX 3HRUA 2G3RA 3NFCA 1WPYA 3QUIA 5LJ5h 4DA4A 2QA4T 5CKDA 2VXFA 3LHDA 3VUBA 2XK0A 4BB7A 1PSFA 4NL3A 4AS1A 5LJ5d 5C18A 2D0QB 1XTDA 4JS5A 2JTMA 1W4SA 3OYEA 5FTNA 1YJWA 3MCAB 3QBYA 1E32A 2DAQA 4M75G 3URGA 4KT0E 4OVAA 4XAXB 5GAOp 5CKHA 2EAYA 3OS5A 1ZHIA 3GIBA 2DPPB 5CKEA 4GLKA 3HRSA 1K8AC 2DK3A 4V2SA 5FRNA 4M7AD 2MWOA 1BYMA 1CR5A 1YHQA 5KCHA 2O01E 5CVIA 2Q1DX 4BE2A 3VJPA 4C5EA 4Q5WA 4LDYA 4QVDA 2CZ6B 3QYHB 5LJ3e 1WJSA 4A54A 3KXTA 2BIVA 3LWIA 1UGQB 2ZCFB 2M16A 2PQWA 1VQ7T 3LGFA 3GPLA 5GMKh 3OS1A 2RK1A 1UGSB 1KG1A 3GF5A 4XQ3A 3OS0A 1G5VA 2NLUA 4C8QE 5GLFA 1VQOT 2QEXA 4X9CA 4EMGA 5GMKj 1B34A 1WQWA 3MP6A 3QKJA 1VQKA 5GAN3 3E9GA 5LJ5e 4FU6A 3CCRT 4M77D 5GAN4 3NTKA 1G3TA 3GNGA 3CD6T 2LW6A 4PL6A 3HU2A 2YHTA 2GFUA 2MI6A 3PTAA 2KDSA 2RA2A 4PNOA 5IT9E 3S3MA 4N0AC 4XTZA 3JB9F 4QQGA 3JCMg 4HKEA 2HQEA 2L3RA 4WF2A 5HY6A 3SDZA 4X9DA 3JB9I 2OTJT 2PVOB 3EFRA 4P5NA 1DJ7B 2KMTA 5DM7R 4PJOC 4OB0B 4J83A 1YI2A 1CZ4A 3CCMT 4J8OA 2MAMA 4C8QF 4A4KA 2DIGA 1OI1A 1RL2A 5GANd 3WXMB 1WJQA 3L1AA 2DXBA 4M78A 4J6WA 4QW2A 3CCUT 4M7DG 4M7DE 1YIJT 4LDUA 4N0AA 1FXXA 4E47A 2VXEA 3JSCA 4C0GA 2RI3A 1G3WA 4M78G 1BI1A 1VIFA 3DLMA 2XKOC 3QJ6A 3C4SA 1LOJA 3ZFJA 5A0LA 2F5TX 3CCET 4KO8A 4N4HA 4B9WA 3M54A 1VQLA 2WSFE 1I8FA 3HKSA 4D6WA 4N4IA 5FU7B 4OP0A 5I21A 3G4SA 4M78B 5LL6S 5C1BA 4M75C 1WNLA 3ASKA 5CCAA 2VGMA 3ZEHA 3CMAT 2JV2A 3ZJTA 4A4HA 2X35A 2XHCA 3Q1JA 5GAN5 1I4K1 1M1GA 4KDLA 4M7DB 1G3SA 1QVGA 4C0FA 3CBMA 5GAN8 4ZTJA 3BQBA 2XDDA 1UGPB 1QVGS 2PVGB 4NOYA 2PJHB 1BIAA 1K73C 2LCCA 2CS7A 3OY9A 1O9SA 4C92B 3FB9A 3CMAA 4XU0A 3CC7A 4FSXA 2WSCE 2CZ7B 2LT1A 1Y96B 2P0PA 3TCJA 2C06A 5DYGA 2RD1A 4XTVA 2JNGA 1M1KU 3MEAA 4C92A 4BD3A 3CCVT 1I5LA 4HCCA 2OAUA 4FM4B 1G3YA 2KY9A 2LQKA 2Y4YA 2LQ8A 3UWNA 2DTIA 2K57A 4C8QD 1VQ6T 2D6FA 2DD5A 3BDUA 1M5Q1 2RHZA 3ZBDA 3FIFA 4E7JA 4HCBA 3A8HB 1CZ5A 3H8ZA 2CGHA 3HP9A 3CBOA 2Q18X 2ZPHB 2RHIA 4XU2A 5IN1A 3QO3A 2IVWA 4ATOA 1M1FA 4XTWA 3QJYA 2E6NA 4OB3B 3MB5A 2R57A 2FYKA 3A8LB 4RMOA 3G71T 5FU7C 1KC8C 3MO8A 3JB9J 4KUDK 1VQPT 2DZ9A 3QIIA 4BDYA 1HXDA 3OYJA 1SSFA 1UB4A 2RB6A 4ZGDB 3DLLA 2E65A 5C6SA 1NJIU 1M90U 3CC2T 1QP3A 3ZJVA 4CQNA 1VIEA 5CQYA 4C8QG 3MP8A 5GANe 1LJOA 3F70A 2CKKA 2GFAA 3FC3A 1BKBA 3CCSA 2X4YA 4FL6A 2RHYA 3QWZA 3V8LA 3M5AA 5CKBA 4C5IA 1N9RA 3S6WA 5KE3A 4PJOG 3DKMA 2DO3A 4M77C 4PKCC 5GAMf 2ZPGB 2LCLA 2EQKA 4M75B 4C0DB 2LX9A 1Q7YU 1WLFA 3X28B 2R5MA 2QDYB 4XU3A 2FB7A 3BDLA 4CI0C 4O6JA 4LDWA 3OYNA 5D6XA 1LNXA 3V8KA 4C92F 3R6OA 4JRQA 2DXCA 3SD4A 1O54A 3CCST 1H3ZA 1XNIA 2E10A 2A3LA 3VU3C 3JCMh 3JCMb 1Y96A 1Q82U 2A7YA 1V29B 4ARCA 3L2UA 2LNVA 3GNFB 3M56A 2K2VA 2VV5A 4JLIA 3CMEA 2Q1AX 2P0QA 3HPWA 3DB4A 3PFSA 2M0OA 4JLGA 4L59A 5CO7A 1U8RA 1K8AU 3CPFA 3J81E 3M4YA 2QA4A 2RHUA 2DXTA 2EFIA 2Q19X 4XTUA 3WVDB 4A4EA 5GAMd 2EQJA 4ELYC 2XD0A 3CF2A 4ZN1A 3LGAA 3VKIA 4BE1A 2QQBA 1YJNA 1AHJB 2QTXA 3VUZA 3RKYA 4HT8A 2DVEA 5GAN6 3OS2A 2E70A 3ME9A 3HRTA 2RI5A 5D6WA 4AQ7A 1VQ5A 2JZ2A 4EPCA 2PUOB 4II1A 3TEEA 3HHTB 3LWHA 1NPRA 5CAIA 1YHQT 4ZTFA 1YITT 2YVLA 3LH0A 3T9NA 3NTHA 4ELZC 3JCMJ 5FU6C 5GAOr 4FT4A 3QZ5B 4A4GA 2VUBA 3CC7T 1IZ6A 2LVMA 5J26A 1NE8A 1YJ9T 4MDXA 1Y71A 2GF7A 4N4GA 4IKFA 2EWNA 3QXEB 2P0KA 3V8JA 4ZGEB 5C0MA 4JDSA 3LW5E 5CR2A 3CC4A 2MM0A 5DYIA 4MDWA 3OYKA 2XIDA 5GMKi 3CCVA 4BY6C 1P92A 1X75C 3G7ZA 4ME7A 5FLXE 2R58A 3JCMQ 4BDZA 4J5YA 5J3BA 1HK9A 2YRVA 3OYHA 1VQLT 3QSUA 3A8GB 3QQ7A 3TU4K 4Z02A 4QQ6A 2MWPA 5KCOA 4RG2A 3RIRA 1YBYA 2LT4A 3I56T 1XOVA 4KLNA 1D3BA 2EJ9A 2EQUA 3CCLA 1QP2A 2X4JA 4PJOD 2AHJB 4J6XA 1R8OB 2ZZDA 3PIPA 4R56A 4BI8B 3G6EA 3WVEB 2O4XA 5ERGB 4M75D 1M9SA 3OYAA 5LJ3h 3J80E 2RM4A 3JAME 2LC4A 4MZTA 5GMKm 2JVVA 2RO0A 5GMKe 2JN0A 2L89A 3OW2A 1VQPA 2E1HA 4PJOE 1ZC1A 1YIJA 3OYMA 4C92C 2BUDA 3QPHA 3BY7A 2QXFA 2XU8A 2DEQA 2WACA 2YLBA 4C8QA 1VQOA 1QW1A 1Y07A 2EJFA 4M77E 5D6YA 4EMKC 2DKGA 3PMTA 2QEXT 5FU6B 3X25B 1W2BA 3GP8A 3CBPA 5DY9A 4F7UA 2LTOA 5I2MA 5CK9A 5I2SA 3CCEA 1S3SA 2YUJA 3L42A 4IUPA 5EPPA 1QVFS 3RERA 3FJPA 4BE0A 3UT1A 3UPUA 2OTLA 2RJDA 1KD1C 2EQMA 3M58A 3ER0A 2DD4A 2K4YA 5FROA 2XDBA 1GXIE 4MZMA 2RJEA 4MMKA 3OYCA 5LJ5f 1Q86C 4C8QC 2KAFA 3MEVA 4QVZA 4XTYA 5M9OA 3CMET 2OTJA 1Q82C 1WJRA 4JRKA 4M7AF 4HT9A 1S72T 1QCSA 4KULA 3SWNA 4RKUE 3FPRA 3P8HA 2QQ9A 4DOVA 5KH6A 3OA6A 1N8RC 3HFOA 1UGRB 1K9MU 4PLLA 1UEBA 5DLQE 1KQSA 1M8VA 3LX7A 2RHXA 2E64A 3A5ZB 4M75F 1VQ8A 2DTOA 1I81A 4X34A 1Q86U 4PLIA 1BIBA 3CEYA 3OYFA 2EYQA 2K5FA 2ZGWA 5GAOl 4J7IA 5GAOm 3M55A 1BI2A 3CCJT 3H6ZA 4M7DD 5GAN7 1M90C 3HSBA 3PMIA 3JB9D 5LJ3d 3FPUA 1N6AA 1JJ2A 3P8BB 3OYGA 3META 3JCMW 2IG0A 1YJ9A 4F7UF 5CQXA 2RH2A 4EDUA 2V8KA 3P8DA 3PNWC 2MM2A 5CKFA 3OMGA 2X4WA 5CD1A 2LDMA 1N8RU 3V7SA 2E5QA 5GAMg 2V8JA 4QQDA 1VQNT 3QC8A 1YCYA 4PJOB 3SFMA 2XICA 1NJIC 2E12A 4BACA 1M4ZA 4XTXA 2K5LA 3G71A 3A8OB 4C8QB 5GMKl 3M4GA 4L5GA 3MEWA 4NL2A 1VQ9A 2D9TA 3UDCA 2EJGA 3I56A 3CCLT 2JUFA 3OYIA 1K9MC 1KHCA 4E7LA 5HK3A 3CC2A 5FTMA 4A53A 5LJ3j 3OYDA 1N27A 5GANg 4M7AB 3S3NA 2HQXA 3QG1A 4IUQA 2QQRA 2JOYA 1JB0E 3G6ET 4OGCA 5A0GA 3JCMd 2VGNA 5GAOq 3M59A 3V7CA 2BKDN 2XG8D 2RJCA 3NTIA 4M78C 3X20B 4M7AG 4NS5A 5J39A 4HA8A 3RKXA 4BUGA 4F7UE 2F5KA 2Y4XA 3E19A 3GOXA 2K3XA 4M77A 2V8IA 5CCXA 5LJ3g 5EQJB 5GAMe 3FDRA 2K3YA 1OYXA 1X01A 2B8AA 4C5HA 1VQ4T 4RCCA 5HK0A 2PWYA 2B25A 2HD0A 2H3JA 2OTLT 4PJOA 2P4TA 3OBYA 2CZ0B 4FT2A 5EG2A 4DQ2A 3MHXA 4C92G 3ZGZA 1OZ3A 3JCMf 2ZPEB 4OF1A 4BI4A 1YJNT 3JCMP 4JRIA 3FEOA 3TIWA 5A0DA 3JB9G 1W2BS 3TREA 4LD9K 4OMFB 3C94A 1M1KC 4PJOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RO0 A;  3LYI A;  3MEA A;  2L89 A;  4BD3 A;  3E9F A;  4E7H A;  3DB3 A;  3OYM A;  3LLR A;  2BUD A;  3UWN A;  3OYB A;  1MHN A;  2WAC A;  2G3R A;  2RHZ A;  5D6Y A;  4E7J A;  2JTF A;  3PMT A;  3H8Z A;  2R5A A;  2LTO A;  2XK0 A;  3EAE A;  3L42 A;  4IUP A;  2RHI A;  5IN1 A;  4BE0 A;  3OYE A;  3UT1 A;  3QBY A;  2RJD A;  2DAQ A;  2E6N A;  2EQM A;  5IAY A;  4OVA A;  4LD6 A;  3FLG A;  5FRO A;  2R57 A;  4GY5 A;  3MO8 A;  2RJE A;  4E7K A;  3QII A;  3OYC A;  5CIU A;  2M1H A;  4BDY A;  3MEV A;  3OYJ A;  4QVZ A;  1SSF A;  5M9O A;  5FRN A;  2MWO A;  1WJR A;  5C6S A;  5KCH A;  1OZ2 A;  4HCZ A;  3MP8 A;  3P8H A;  4C5E A;  4Q5W A;  3F70 A;  5KH6 A;  2CKK A;  2GFA A;  3OA6 A;  1WJS A;  3L2V A;  3FC3 A;  2BIV A;  2X4Y A;  4FL6 A;  2RHY A;  3MEU A;  4IUR A;  4PLL A;  4C5I A;  5KE3 A;  2M16 A;  3S6W A;  2PQW A;  3L2R A;  3LGF A;  3LX7 A;  2EQK A;  2RHX A;  3OS1 A;  2R5M A;  4X34 A;  3BDL A;  4PLI A;  1G5V A;  3CEY A;  3OS0 A;  2NLU A;  3OYN A;  3OYF A;  5D6X A;  3SD4 A;  3MP1 A;  1H3Z A;  1XNI A;  3H6Z A;  3L2Q A;  3MP6 A;  3QKJ A;  3PMI A;  3L2U A;  3LGL A;  3S3O A;  3E9G A;  3OYG A;  3MET A;  2IG0 A;  4FU6 A;  4UC4 A;  4EDU A;  3NTK A;  3DB4 A;  3PFS A;  2M0O A;  4L59 A;  4PL6 A;  3P8D A;  3PNW C;  2GFU A;  4BE2 A;  3S3M A;  3OMG A;  2X4W A;  2L8D A;  2LDM A;  2RHU A;  2EFI A;  4A4E A;  2E5Q A;  4QQG A;  2EQJ A;  4QQD A;  2HQE A;  2L3R A;  2LRQ A;  4BE1 A;  4IUT A;  2XDP A;  4BAC A;  2RJF A;  3OB9 A;  3OMC A;  3OS2 A;  2DIG A;  1OI1 A;  2QQS A;  3MEW A;  3ME9 A;  2D9T A;  1WJQ A;  2RI5 A;  4QW2 A;  5D6W A;  2X4X A;  3OYI A;  3M9Q A;  3L2W A;  1KHC A;  2JZ2 A;  4E7L A;  4II1 A;  2EKO A;  3OYD A;  4ZTF A;  3LH0 A;  1N27 A;  2RI3 A;  3S3N A;  3NTH A;  3QJ6 A;  3DLM A;  3C4S A;  2HQX A;  4A4G A;  4IUQ A;  2QQR A;  4C5G A;  3OYL A;  2LVM A;  5J26 A;  4CRI A;  2GF7 A;  4E7I A;  4N4G A;  4IKF A;  4N4H A;  4B9W A;  2P0K A;  5C0M A;  4IUV A;  3OYK A;  2BKD N;  3NTI A;  2RJC A;  4N4I A;  4BDZ A;  2R58 A;  4NS5 A;  5J39 A;  3O8V A;  2DIQ A;  3ASK A;  2YRV A;  4IUU A;  3ZEH A;  3OYH A;  2F5K A;  4A4H A;  2X35 A;  1RI0 A;  3Q1J A;  4QQ6 A;  2MWP A;  2K3X A;  4Z02 A;  5KCO A;  3GOX A;  4RG2 A;  4B9X A;  4ZTJ A;  3FDR A;  2RI2 A;  2K3Y A;  1OYX A;  2B8A A;  4C5H A;  2EQU A;  1WGS A;  2LCC A;  5KE2 A;  3OY9 A;  3OQ5 A;  1OZ3 A;  3KUF A;  4A4F A;  5FRM A;  2O4X A;  3FEO A;  2FHD A;  2VYT A;  3OYA A;  2O4X B; 
#chains in the Genus database with same CATH topology
 3J7A F;  3LYI A;  3X24 B;  4R55 A;  2PU9 B;  2RMO A;  2DRM A;  2JTF A;  4M7A C;  2EVR A;  1YIT A;  3OW2 S;  2DL3 A;  3EAE A;  4ARI A;  1WI7 A;  3A8M B;  2J6O A;  5IAY A;  2KRS A;  4LD6 A;  4DBH A;  5CIU A;  1X6O A;  2JMC A;  3ZJU A;  3GLX A;  3JCM X;  3RMS A;  4Y91 A;  1M27 C;  3CXC S;  2CT4 A;  5ECA A;  4KH0 B;  1EIF A;  2E6Z A;  4IUR A;  3I9Q A;  1IRE B;  5AYF A;  2FRW A;  1M2V B;  1YJW T;  1KSW A;  3LGL A;  1AWO A;  3CC4 T;  2DZC A;  2MMP A;  3I56 Q;  4J6Y A;  1IHW A;  2NYS A;  1K8A R;  3EFS A;  4LDV A;  4EMK B;  5GAN h;  3OMC A;  2MCN A;  3SWN B;  4TVR A;  1VQ4 A;  5GAN j;  1OEB A;  2EYW A;  2X4X A;  3M9Q A;  2GGR A;  1MNE A;  4LUD A;  3C0C A;  4FYV B;  1GCQ A;  2CSI A;  4OGE A;  1R7R A;  2YUO A;  3CD6 A;  4M7D C;  4IUV A;  1SRM A;  1ZBX A;  3RMQ A;  2DA9 A;  4IUU A;  1VQ5 Q;  1U1S A;  3HFN A;  4C0D C;  1FWZ A;  1PC0 A;  8ATC B;  2HNI A;  1AWX A;  4KUI A;  1K76 A;  2HZY A;  1WFW A;  4EMH A;  1WGS A;  2G6F X;  4A63 B;  4LDX A;  1IGU A;  5CCB A;  3KUF A;  2QTV A;  2YRD A;  4JS4 A;  2VYT A;  2DJZ A;  4RTW A;  2M02 A;  1VQ9 T;  2Q1C X;  3HRU A;  5LJ5 h;  2FZK B;  2C0O A;  4BB7 A;  1PSF A;  4AS1 A;  3M0R A;  4JS5 A;  2JTM A;  1W4S A;  5FTN A;  1PD1 A;  3QBY A;  4M75 G;  4OVA A;  3OS5 A;  3GIB A;  4GLK A;  2JS2 A;  1CR5 A;  2E5K A;  2Q1D X;  3VJP A;  5LJ3 e;  1OUL A;  2LZ6 B;  3QYH B;  4AFU C;  1UGQ B;  4DEY A;  3OS1 A;  3GF5 A;  3OS0 A;  3A1P A;  4C8Q E;  1VQO T;  4X9C A;  5GMK j;  1B34 A;  3QKJ A;  4B6M A;  3CD6 T;  5IT9 E;  3VS4 A;  4WF2 A;  2CDT A;  2PVO B;  5DM7 R;  4PJO C;  1CZ4 A;  4J9B A;  1VYT A;  1RL2 A;  1WJQ A;  3L1A A;  4J6W A;  4QW2 A;  2AZS A;  4N0A A;  2VXE A;  4C0G A;  5A0L A;  1BI1 A;  3VRZ A;  3CCE T;  3REB B;  4PK4 A;  2DJQ A;  1E6G A;  4B9W A;  4OMP A;  4D6W A;  5FU7 B;  2V26 A;  3ASK A;  2YUP A;  3EG9 A;  3ZEH A;  4KDL A;  1G3S A;  4GBQ A;  2PVG B;  4NOY A;  1K73 C;  2BTT A;  1SKU B;  1CKA A;  2JT4 A;  4FSX A;  2C06 A;  1Y96 B;  4LUE A;  2VWF A;  1UHC A;  2JNG A;  4HCC A;  1I5L A;  1G3Y A;  2YRC A;  2DTI A;  4C8Q D;  2ATC B;  1M5Q 1;  4HCB A;  3VS0 A;  1CZ5 A;  3H8Z A;  3CBO A;  2FPE A;  5IN1 A;  3QO3 A;  4XTW A;  1AEY A;  4RMO A;  3G71 T;  5FU7 C;  3EHQ A;  1VQP T;  2H8H A;  3OYJ A;  1UB4 A;  2RB6 A;  3DLL A;  5C6S A;  1RAE B;  5CQY A;  2AK5 A;  4C8Q G;  1WYX A;  5GAN e;  3FC3 A;  1BKB A;  1PG5 B;  4FL6 A;  3M5A A;  1MMD A;  5CKB A;  2EQK A;  4M75 B;  4XU3 A;  3BDL A;  1AD5 A;  1H8K A;  1LNX A;  2HQH A;  2OAW A;  3JCM h;  1J3T A;  3U23 A;  1V29 B;  1AZE A;  5FWB A;  1QCF A;  2P0Q A;  4L59 A;  3PFS A;  1K8A U;  5CO7 A;  1AT1 B;  2E4H A;  3CPF A;  4ORZ A;  3M4Y A;  2QA4 A;  2EFI A;  4XTU A;  1RAH B;  1PD0 A;  4ELY C;  1K4U S;  4RTV A;  1X43 A;  4BE1 A;  1KC8 R;  1AHJ B;  3RBB B;  6AT1 B;  3SHW A;  2DVE A;  1ZA1 B;  3H0I A;  2E70 A;  2EGA A;  4AQ7 A;  1K0S A;  2F1L A;  1Z9Z A;  5CAI A;  4ELZ C;  3HTR A;  2VVK A;  3QZ5 B;  1K73 R;  3CC7 T;  1NE8 A;  1YJ9 T;  1Y71 A;  2GF7 A;  5CCX A;  3V8J A;  2ECZ A;  4BDZ A;  1P92 A;  1NBE B;  1PWT A;  2AKK A;  5KYY A;  2YRV A;  2KRO A;  4Z02 A;  5KCO A;  1OPL A;  4RG2 A;  2JMA A;  1B3Q A;  3I56 T;  2KT8 A;  4PJO D;  5IXB A;  4R56 A;  4BI8 B;  4M75 D;  3OYA A;  5LJ3 h;  2RM4 A;  3JAM E;  2RO0 A;  3OW2 A;  1VQP A;  2E1H A;  4C92 C;  3QPH A;  1QWE A;  3MKD A;  2WAC A;  1VQO A;  2KI7 A;  4M77 E;  2EJF A;  1S3S A;  2LTO A;  2YUJ A;  3RER A;  3I5S A;  3UPU A;  2OTL A;  1SPK A;  2XDB A;  2E3H A;  4MZM A;  5LJ5 f;  2YXY A;  2KAF A;  1B7T A;  5M9O A;  4Z89 A;  3P8H A;  2QQ9 A;  1NYG A;  1K9M U;  2NUT B;  1VQM Q;  1M8V A;  2RHX A;  2DTO A;  4IIO A;  4X34 A;  1RAG B;  2DL7 A;  2QA4 Q;  2ZGW A;  2KYM A;  3M55 A;  5GAO m;  1YJ9 Q;  3H6Z A;  2HL3 A;  4CC2 A;  1X2Q A;  3CC2 Q;  4AFS C;  3MET A;  1VQ4 Q;  1YNZ A;  2RH2 A;  3P8D A;  1RUW A;  1T0J A;  1N8R U;  1X6B A;  1T3L A;  2KXD A;  1VQ8 Q;  1VQN T;  4OMO A;  2ABL A;  2J6K A;  3SFM A;  4PJO B;  5KYU B;  1FMV A;  5GMK l;  1LCK A;  3I56 A;  3UA6 A;  1GBQ A;  2C0I A;  1KHC A;  4A53 A;  3OYD A;  2JW4 A;  2YUN A;  2MOX A;  2NUP A;  3QG1 A;  4IUQ A;  1Y0M A;  3UF4 A;  3I5R A;  3JCM d;  5GAO q;  2BKD N;  3NTI A;  2RJC A;  3X20 B;  5J39 A;  5IHN A;  3GOX A;  5EQJ B;  5GAM e;  1PKS A;  1X01 A;  2DFU A;  2B8A A;  2HD0 A;  2P4T A;  3OBY A;  2QGG A;  3ZGZ A;  4C92 G;  2EPD A;  1AVZ C;  1KJW A;  4JRI A;  3FEO A;  4OMF B;  4PJO F;  2AZV A;  4QVC A;  1VQ5 T;  1VQO Q;  2X3X D;  3LLR A;  3OYB A;  3JCM c;  1KQ1 A;  4KDI A;  3JRZ A;  3EGX B;  2R5A A;  2FPF A;  2WSE E;  4RCB A;  1D1C A;  3JCM e;  2GQV A;  2XI9 A;  1Q81 U;  1QCN A;  2RQV A;  3VYH B;  4GY5 A;  1KK7 A;  2DF6 A;  1KC8 U;  1UJ0 A;  1D3B B;  3OSV A;  4KOD A;  2H3E B;  5GAN f;  3L2V A;  4DBQ A;  2A28 A;  2CYZ B;  3EG3 A;  2QI2 A;  3INZ A;  2RK2 A;  1ZA2 B;  1QVP A;  3RES A;  2DEU A;  2JS0 A;  2L3Q A;  2MF2 A;  4O5V A;  4QKU A;  5KYX B;  1QCO A;  2A0F B;  2ZPB B;  1Q86 R;  1M3A A;  2KE9 A;  4PFP A;  1MV0 B;  2KRM A;  1NPP A;  1TSF A;  2J06 A;  1TH7 A;  4ANJ A;  3CXC P;  4JRP A;  3OW2 P;  1FX7 A;  4MZP A;  1WX6 A;  2F2W A;  4IUT A;  1RI9 A;  3SB2 A;  1M90 R;  1OU8 A;  5GAM j;  4L6V 5;  4EIK A;  3OB9 A;  4DOW A;  1PNJ A;  4AG1 C;  2QQS A;  4M78 F;  1KFZ A;  2LQW A;  3I55 T;  2L0A A;  2EKO A;  2QQA A;  4XU1 A;  1VUB A;  1KQS S;  3RUX A;  2MK5 A;  2KSS A;  5LJ5 j;  2GNC A;  5GJW B;  2HCK A;  4M7D A;  1JRI A;  3O8V A;  1PSE A;  1WZO A;  4JPB W;  4OB2 B;  1WLF A;  4FIB A;  1D09 B;  3BW1 A;  2VC8 A;  1ZQ1 A;  3N5B B;  4XK8 E;  3EH2 A;  1K9M R;  2CP0 A;  4JUV A;  2FHD A;  4CC7 A;  2HKN A;  3KBG A;  4E7H A;  3FPT A;  2G3R A;  1WPY A;  2K79 A;  1FMK A;  4DA4 A;  2QA4 T;  3G4S Q;  3VS2 A;  2VXF A;  2EYX A;  3VUB A;  1EX4 A;  4NL3 A;  2COZ A;  3VRY A;  2PNI A;  3MCA B;  1E6H A;  2DAQ A;  1JQQ A;  4KT0 E;  1WHL A;  5CKE A;  1K8A C;  4GLM A;  3R6N A;  2MWO A;  4M7A D;  1F1B B;  1YHQ A;  2P4R A;  4BE2 A;  3CPW S;  4A54 A;  2BIV A;  2M16 A;  2PQW A;  1ACM B;  1UGS B;  1ZUU A;  1BCO A;  2QEX A;  1JXO A;  1GFD A;  2QAZ A;  1VQK Q;  1G8X A;  4JJC A;  3EGU A;  3E9G A;  2LW6 A;  2FO0 A;  5GAN 4;  3CPW P;  2HL5 C;  2RA2 A;  4R0K A;  4N0A C;  3JB9 F;  3CCR Q;  5HY6 A;  1FMW A;  3CMA Q;  1KG1 A;  3O5Z A;  2OTJ T;  1DJ7 B;  5I22 A;  1MV3 A;  4OB0 B;  1IGQ A;  4J83 A;  5IH2 A;  2J6F A;  3CCM T;  3SEM A;  2MAM A;  1AOJ A;  4HVV A;  1RAC B;  2E3I A;  1VQ9 Q;  1WHJ A;  2DXB A;  1D0X A;  2CUD A;  1D0Z A;  1G3W A;  2XKO C;  4N4H A;  4N4I A;  3G4S A;  5LL6 S;  4M75 C;  2JV2 A;  2VGM A;  5KYY B;  2D0N A;  4A4H A;  3Q1J A;  1M1G A;  1WIE A;  1ZX6 A;  4C0F A;  2XDD A;  1QVG S;  1VQ7 Q;  3M0U A;  2BZX A;  5EC7 A;  1U06 A;  4XU0 A;  3CC7 A;  1TU0 B;  2WSC E;  2CZ7 B;  3H0H A;  1TTH B;  4ZNX A;  3MEA A;  4C92 A;  3CCV T;  3M0S A;  1LVK A;  1RAI B;  2LJ3 A;  2LQK A;  2Y4Y A;  4HCK A;  2NUZ A;  3CCJ Q;  2D6F A;  2RHZ A;  4E7J A;  4KH1 B;  3A8H B;  2CGH A;  3HP9 A;  1C0M A;  4XU2 A;  2F2V A;  3EHR A;  1TXQ A;  4OB3 B;  3MB5 A;  2R57 A;  4FW2 A;  1KC8 C;  2DZ9 A;  2QG9 B;  4BDY A;  1HXD A;  1I5O B;  1SRL A;  2RF0 A;  1NJI U;  1M90 U;  2HBW A;  1VQP Q;  2CKK A;  2X4Y A;  4FW1 A;  2RHY A;  3QWZ A;  1T0H A;  5GAM f;  4PKC C;  3X28 B;  2R5M A;  2QDY B;  1I1J A;  2FB7 A;  4O6J A;  4LDW A;  1HYO A;  1H3Z A;  2E10 A;  3M0P A;  4J9F A;  2A3L A;  1Y96 A;  4PJN A;  3L2U A;  2Z0W A;  2LNH B;  3GNF B;  2VV5 A;  9ATC B;  3HPW A;  3DB4 A;  2MIO A;  2M0O A;  3CC4 Q;  4RTZ A;  2Q19 X;  5GAM d;  1H3H A;  3LGA A;  2CSQ A;  4ZN1 A;  3VKI A;  3TQ7 P;  2HSP A;  1ZUY A;  3VUZ A;  3RKY A;  2CT3 A;  4HT8 A;  3OS2 A;  2DL4 A;  1RAA B;  5D6W A;  4EPC A;  1YIT T;  3NTH A;  5FU6 C;  2DX1 A;  4A4G A;  1NLO C;  5J26 A;  4J9D A;  4MDX A;  2EWN A;  4ZGE B;  2P0K A;  5C0M A;  5CR2 A;  4KGZ B;  2PTK A;  4MDW A;  3MPU B;  5GMK i;  4OMN A;  1UGV A;  5J3B A;  1HK9 A;  3G1J A;  4D8K A;  3OYH A;  3A8G B;  1VQ6 Q;  1UE9 A;  1YBY A;  1RAD B;  3EG9 B;  1QP2 A;  1WA7 A;  1R8O B;  1I0C A;  2ZZD A;  3G6E A;  3KFV A;  4E2F B;  2O4X A;  1PRM C;  3J80 E;  1TUC A;  1YIT Q;  4MZT A;  5GMK e;  2JN0 A;  4PJO E;  1ZC1 A;  2EKH A;  2RPN A;  1M2V A;  2KT1 A;  2QXF A;  3MJX A;  2QEX T;  5D6Y A;  2EYY A;  3PMT A;  5FU6 B;  3X25 B;  3CCE A;  1Q81 R;  1MMA A;  5EPP A;  2CP3 A;  3TVT A;  1NM7 A;  4DBR A;  3UT1 A;  1G83 A;  2RJD A;  2EQM A;  2K4Y A;  2KBT A;  2P84 A;  2DER A;  4DEX A;  4C8Q C;  4ESR A;  4JRK A;  4M7A F;  1TS9 A;  1QCS A;  3VS3 A;  2J05 A;  3FPR A;  3OA6 A;  5KH6 A;  3HFO A;  1KQS A;  4KGX B;  4M75 F;  1VQ8 A;  3CCL Q;  1Q86 U;  2ENM A;  1BIB A;  4RUG A;  2K5F A;  5GAO l;  1BI2 A;  4OMQ A;  4F17 A;  1G2B A;  5GAN 7;  3HSB A;  3JB9 D;  3FPU A;  1EZZ B;  1FYN A;  3OYG A;  1T3S A;  4EDU A;  2MM2 A;  5CKF A;  3OMG A;  2X4W A;  2LDM A;  2V1Q A;  2OX7 A;  5FWC A;  4QQD A;  3QC8 A;  2CP7 A;  2E12 A;  2DMO A;  1M4Z A;  1GL5 A;  3CCS Q;  3A8O B;  4C8Q B;  2BZ8 A;  4HVU A;  2JUF A;  4E7L A;  5HK3 A;  4IIM A;  1N27 A;  3S3N A;  1W70 A;  3CCV Q;  3EG2 A;  4OGC A;  3LH5 A;  5A0G A;  3M59 A;  2FRY A;  3V7C A;  2FZC B;  2XG8 D;  4M78 C;  4OML A;  3RKX A;  2KYB A;  2F5K A;  5KYX A;  2V8I A;  5LJ3 g;  2LX7 A;  2L3S A;  4OMM A;  2K7A A;  3FDR A;  1CKB A;  2PWY A;  2PZ1 A;  4AMC A;  2CZ0 B;  5EG2 A;  3MHX A;  1OZ3 A;  3JCM f;  4E7Z A;  1YJN T;  1X69 A;  1NEG A;  3JCM P;  3TIW A;  5A0D A;  3TRE A;  5LJ3 f;  4AFZ C;  3DB3 A;  1O75 A;  2DL8 A;  2I0N A;  1JBM A;  3JV3 A;  1VQ8 T;  3PVL A;  2LMJ A;  1HJD A;  4JZ4 A;  3FLG A;  1QQJ A;  4F04 B;  2LJ1 A;  2M1H A;  1U3O A;  1HSQ A;  5FTL A;  4FYY B;  4M78 D;  1OZ2 A;  4HCZ A;  2HSE B;  1H64 1;  5GAN 2;  1N5Z A;  2COW A;  1VQN A;  3RKW A;  2DRK A;  2FVU A;  1Y57 A;  2KNB B;  3C12 A;  3PIO A;  2EIF A;  4M75 A;  2PVD B;  2ZPI B;  3X26 B;  2RN8 A;  3OYY A;  2Y90 A;  4C92 D;  3OSS C;  2ZPF B;  3CCQ A;  3QDR B;  2FL7 A;  3AHU A;  3S3O A;  2M9U A;  4UC4 A;  4LXC A;  1YI2 T;  3G71 Q;  3V7R A;  4AT1 B;  3M53 A;  3JB9 H;  3CCQ T;  1SG5 A;  4Y92 A;  2EGE A;  2LRQ A;  8AT1 B;  2XDP A;  4ZGJ B;  5DLO A;  5FTK A;  4M75 E;  1OX8 A;  2RJF A;  2HMA A;  2CH4 W;  1VQ6 A;  5KYU A;  2SRC A;  2I2L A;  3L2W A;  4M77 G;  2DXU A;  3EG1 A;  3OYL A;  1YJW Q;  4CRI A;  3CCR A;  3VV0 A;  1GFC A;  4CC4 B;  2F69 A;  4ZN3 A;  3E1S A;  2MYS A;  4QT7 A;  2GCX A;  2HDA A;  3CCU A;  3H0F A;  1RI0 A;  3CCM A;  1AWJ A;  1D1B A;  2RI2 A;  2QAS A;  1UJY A;  3JCM V;  1VQM T;  1YJN Q;  1YI2 Q;  3PT9 A;  2KQW A;  1QVF A;  4A4F A;  2OTL Q;  5FRM A;  3VYG A;  4AG2 C;  2YLC A;  3M57 A;  3REA B;  1W1F A;  3HU1 A;  3QUI A;  3AT1 B;  5CKD A;  1IO6 A;  1RAF B;  1IXD A;  3LHD A;  2XK0 A;  1VQL Q;  2D0Q B;  1XTD A;  2K2M A;  2EGC A;  4XAX B;  1M3B A;  1TG0 A;  5GAO p;  2RQW A;  1ZHI A;  1KD1 R;  4WCI A;  2W0Z A;  1BYM A;  2O01 E;  4C5E A;  1JU5 C;  4LDY A;  4Q5W A;  2CZ6 B;  2GQI A;  1WJS A;  2ZCF B;  2YUQ A;  1VQ7 T;  2X3W D;  3GPL A;  5GMK h;  2RK1 A;  1SHG A;  1QVG P;  1G5V A;  2NLU A;  2GBQ A;  1D1A A;  3EFO B;  4FU6 A;  1B07 A;  3TSZ A;  3CCR T;  3NTK A;  3HU2 A;  3PTA A;  4PNO A;  1TUD A;  4QQG A;  2L3R A;  1ZLM A;  3EFR A;  1YI2 A;  1A0N B;  4A4K A;  1OI1 A;  5GAN d;  3CCU T;  4M7D G;  2D8H A;  3CCM Q;  1PRL C;  1YIJ T;  1FXX A;  4E47 A;  3JSC A;  1VIF A;  3QJ6 A;  3ZFJ A;  3C4S A;  1LOJ A;  2F5T X;  4PFZ A;  2NUP B;  1K1Z A;  1VQL A;  2CUB A;  1WNL A;  5CCA A;  3CMA T;  2X35 A;  4M7D B;  2AIR B;  3BQB A;  1UGP B;  2QYZ A;  2PJH B;  1BIA A;  3H41 A;  4Z88 A;  1O9S A;  1GBR A;  1MMG A;  3CMA A;  2K3B A;  1I07 A;  3TCJ A;  2FG0 A;  1UHF A;  3BE3 A;  4XTV A;  2OAU A;  1VQ6 T;  3VS6 A;  2DD5 A;  3ZBD A;  3FIF A;  1N8R R;  3D7S B;  1QKW A;  3EGX A;  5HCK A;  2ZPH B;  2RHI A;  2IVW A;  1M1F A;  2E6N A;  2ZAE A;  2OI3 A;  3JB9 J;  3QII A;  1SSF A;  4ZGD B;  1ABQ A;  2KR3 A;  2E65 A;  3CC2 T;  1AWW A;  1QP3 A;  3ZJV A;  2GFA A;  4C5I A;  5KE3 A;  3TSW A;  3S6W A;  3L2R A;  3DKM A;  2IIM A;  1Q7Y U;  2LCL A;  2FEI A;  1GCQ C;  2LX9 A;  2L2P A;  5D6X A;  3V8K A;  2DXC A;  1O54 A;  2QDL A;  1XNI A;  3JCM b;  1Q82 U;  2A7Y A;  4ARC A;  2DYI A;  1W6X A;  2LNV A;  3M56 A;  3PVQ A;  4JLI A;  3CME A;  2Q1A X;  3CCQ Q;  2LQN A;  3J81 E;  1QMC A;  2DXT A;  1PKT A;  4A4E A;  4LNP A;  2QQB A;  1R0B G;  1IHV A;  2QTX A;  2MPX C;  1RAB B;  5GAN 6;  2ESW A;  2D1X A;  1PHT A;  1K0X A;  2JZ2 A;  3LWH A;  3T9N A;  3JCM J;  4FT4 A;  3I55 Q;  1IZ6 A;  2LVM A;  3CC4 A;  4JDS A;  3LW5 E;  3OYK A;  1YN8 A;  3CCV A;  2MM0 A;  4BY6 C;  3G7Z A;  1X75 C;  2R58 A;  4J5Y A;  2EQI A;  1VQL T;  4RTU A;  1TWB A;  3TU4 K;  4QQ6 A;  2VKN A;  1HD3 A;  4FCY A;  4KLN A;  2EJ9 A;  2EQU A;  2X4J A;  3WVE B;  1K9A A;  1M9S A;  2LC4 A;  5GMK m;  1UG1 A;  2BUD A;  3BY7 A;  1M1K R;  2XU8 A;  2DEQ A;  4C8Q A;  1QW1 A;  4EMK C;  1LPL A;  1W2B A;  4CQN A;  2DKG A;  1ZSZ B;  3CBP A;  4F7U A;  5I2M A;  5I2S A;  4HXJ A;  4IUP A;  1QVF S;  1TUG B;  1KD1 C;  1OPK A;  3M58 A;  3ER0 A;  2JXB A;  2RJE A;  4MMK A;  1MMN A;  3MEV A;  2X9H A;  3CME T;  4J9G A;  2OTJ A;  2OJ2 A;  1S72 T;  4KUL A;  3SWN A;  4RKU E;  1WLP B;  1UGR B;  1UEB A;  3UAT A;  1BCM A;  5DLQ E;  4KRT A;  3LX7 A;  3THK A;  2E64 A;  1I81 A;  3CEY A;  2EYQ A;  1Q95 G;  1SEM A;  4J7I A;  3CCJ T;  1AZG B;  1M90 C;  3RR6 A;  5LJ3 d;  3M0T A;  2JM9 A;  1N6A A;  1JJ2 A;  2A36 A;  4F7U F;  1X27 A;  2V8K A;  4DBF A;  3PNW C;  4F16 A;  2J7I A;  4E7S A;  5GAM g;  4J9C A;  2V8J A;  2XIC A;  1QKX A;  4E6R A;  4BAC A;  1IB8 A;  2DYB A;  3ULR B;  3G71 A;  3M4G A;  1VQ9 A;  2D9T A;  3CCL T;  3OYI A;  3CC2 A;  2NUT A;  5LJ3 j;  2YT6 A;  4J9I A;  5GAN g;  1BK2 A;  2BZY A;  2HQX A;  1JB0 E;  3G6E T;  2VB6 A;  2VGN A;  2JM8 A;  4M7A G;  4NS5 A;  4HA8 A;  4RTY A;  1MUZ A;  1SHF A;  2Y4X A;  4PJJ A;  2LCS A;  2OTJ Q;  2QEX Q;  2CRE A;  1OYX A;  4C5H A;  1VQ4 T;  2DBK A;  2H3J A;  2OTL T;  4PJO A;  4DQ2 A;  2ZPE B;  3UA7 A;  4BI4 A;  1M8M A;  5IHK A;  2C0T A;  1QLY A;  1W2B S;  3C94 A;  1E7O A;  1R0C B;  1YHQ Q;  1VQK T;  3E9F A;  3OBW A;  1B34 B;  1MHN A;  2KXC A;  3HU3 A;  1Y7X A;  4EMK A;  2FPD A;  4PFO A;  1K73 U;  1XQH A;  2IPO B;  4VUB A;  1KD1 U;  1VQM A;  2E41 A;  2XMF A;  3BFM A;  5LJ5 g;  4E7K A;  1OU9 A;  5HKC A;  4MML A;  1Z9Q A;  4M7A A;  2KK4 A;  3FJ5 A;  1WHH A;  1M3C A;  1QDN A;  2BE9 B;  2HBP A;  3MEU A;  1XJW B;  1CSK A;  3PE0 A;  1JJ2 S;  3C95 A;  2PUK B;  4J7F A;  1Q82 R;  3MP1 A;  4D8D A;  4YTL A;  5I11 A;  2ED1 A;  5GAO n;  3G4S T;  3L2Q A;  4M7D F;  2EBP A;  2DTH A;  2KVQ G;  4KBM B;  3H9N A;  2EYZ A;  1Q7Y C;  2L8D A;  1WQ7 A;  1N9S A;  4LE9 A;  1PCX A;  1KHI A;  1W2B P;  2CZ1 B;  1VQ7 A;  2QK0 A;  1BI0 A;  2K5I A;  4BI3 A;  3SWN C;  3HL8 A;  3QQ8 A;  2F2X A;  5GAM h;  3CME Q;  5A2Q E;  1MGQ A;  5L8R E;  1BI3 A;  4M7A E;  5FTJ A;  4C5G A;  2O88 A;  3QYG B;  4RG8 A;  4E7I A;  1U1T A;  3PGG A;  4BY6 B;  3I55 A;  2L5Q A;  4M78 E;  1NJI R;  3CCJ A;  1KQ2 A;  2DIQ A;  1TOV A;  1ZSZ A;  4FYX B;  2O9V A;  4M77 B;  5D7U A;  4F7U B;  4M77 F;  1I9G A;  3QHS A;  4B9X A;  1Q81 C;  4C0Z A;  2ROT A;  2DVJ A;  5KE2 A;  4C92 E;  3OQ5 A;  3FRN A;  3GBQ A;  3L2Z A;  1S72 A;  4Y28 E;  1R77 A;  3QZ9 B;  4JJN K;  3CPW A;  2O4X B;  3CXC A;  4RV0 A;  4OB1 B;  2HAX A;  4J9H A;  4F7U G;  2L3P A;  1NZ9 A;  3CCU Q;  3NFC A;  1YIJ Q;  2DIL A;  2ED0 A;  3ZL7 C;  3A98 A;  5KYW A;  5LJ5 d;  5C18 A;  3OYE A;  1YJW A;  1E32 A;  3URG A;  5CKH A;  2EAY A;  2DPP B;  3HRS A;  2DK3 A;  4V2S A;  5FRN A;  2BE7 D;  5KCH A;  5CVI A;  1Q7Y R;  4QVD A;  5KYW B;  3KXT A;  1ABO A;  2X51 A;  3LWI A;  1D0Y A;  1YP5 A;  3LGF A;  1C6V X;  2GTJ A;  2RQR A;  2JJ9 A;  5GLF A;  4XQ3 A;  1VOM A;  2YSQ A;  4EMG A;  1WQW A;  3MP6 A;  1VYU A;  4FYW B;  5GAN 3;  1VQK A;  1QVF P;  2RQT A;  1OOT A;  5LJ5 e;  4M77 D;  1G3T A;  3GNG A;  1PM3 A;  4PL6 A;  2YHT A;  2GFU A;  2MI6 A;  3S3M A;  2KDS A;  4XTZ A;  3CD6 Q;  3JCM g;  4HKE A;  2DLP A;  2HQE A;  1YCS B;  5B6C A;  3SDZ A;  4X9D A;  3JB9 I;  2DM1 A;  4P5N A;  2COY A;  2KMT A;  4J8O A;  4C8Q F;  2DIG A;  1C1A A;  1UUE A;  2CH4 A;  3WXM B;  4M78 A;  4M7D E;  3CQT A;  4LDU A;  2RI3 A;  4M78 G;  3DLM A;  2O31 A;  2LJ0 A;  4KO8 A;  5FW9 A;  2V1R A;  3M54 A;  2WSF E;  1I8F A;  3HKS A;  1WHK A;  4OP0 A;  5I21 A;  4M78 B;  1KIK A;  5C1B A;  2LP5 A;  3ZJT A;  2KGT A;  3VS1 A;  2XHC A;  5GAN 5;  1I4K 1;  1OQK A;  1QVG A;  1YFN A;  3CBM A;  5GAN 8;  4ZTJ A;  3NGP A;  1ZSG A;  2LCC A;  2CS7 A;  3OY9 A;  1S72 Q;  4C92 B;  3FB9 A;  1VQN Q;  2LT1 A;  2P0P A;  5DYG A;  1V1C A;  1QWF A;  2RD1 A;  3NPF A;  1EFN A;  4HVW A;  1M1K U;  1NEB A;  4BD3 A;  1SF9 A;  1JO8 A;  4FM4 B;  2KY9 A;  2DET A;  2LQ8 A;  1M30 A;  3UWN A;  2K57 A;  3NHN A;  2EW3 A;  3BDU A;  3VS7 A;  2Q18 X;  2W10 A;  4ATO A;  3CC7 Q;  3QJY A;  3QDF A;  2FYK A;  3A8L B;  1GRI A;  3MO8 A;  4KUD K;  1OV3 A;  3EH1 A;  2K6D A;  1VIE A;  3MP8 A;  1LJO A;  1X6G A;  3F70 A;  3CCS A;  4Z8A A;  4RTT A;  3V8L A;  4LD9 K;  1N9R A;  1M1K C;  4PJO G;  4M77 C;  2DO3 A;  2ZPG B;  4C0D B;  2M51 A;  3VS5 A;  2KRN A;  2NWM A;  4CI0 C;  4RTX A;  3OYN A;  4C92 F;  3R6O A;  4JRQ A;  3SD4 A;  1RLP C;  3CCS T;  4X1V A;  2VAS A;  3E2U A;  3VU3 C;  1WHG A;  2K2V A;  3RDV A;  1ZUK A;  4K11 A;  1U8R A;  4JLG A;  1UDL A;  1U5S A;  2RHU A;  3WVD B;  2EQJ A;  2XD0 A;  3CF2 A;  2SEM A;  3M0Q A;  4PJM A;  4AFQ C;  1YWO A;  5IHI A;  5L23 A;  1YJN A;  2YDL A;  3ME9 A;  3HRT A;  1ARK A;  2RI5 A;  1V76 A;  1VQ5 A;  2O2O A;  2PUO B;  4II1 A;  3TEE A;  3HHT B;  2YVL A;  1NPR A;  1YHQ T;  4ZTF A;  2M0Y A;  3LH0 A;  5GAO r;  4F14 A;  2VUB A;  2FZG B;  1RLQ C;  4N4G A;  4IKF A;  3QXE B;  5DYI A;  3CCE Q;  1S1N A;  1H92 A;  2DE0 X;  2XID A;  4ME7 A;  3JCM Q;  5FLX E;  1NYF A;  1JEG A;  1UFF A;  2JTE A;  3QSU A;  3QQ7 A;  2MWP A;  3RIR A;  3EGD A;  3I35 A;  4WTO B;  2GTO A;  4M4Z A;  2LT4 A;  1XOV A;  1D3B A;  1MND A;  3CCL A;  3RNJ A;  2AHJ B;  4J6X A;  4JJD A;  3PIP A;  2AT1 B;  3G6E Q;  2DBM A;  5ERG B;  1M2O A;  2JVV A;  2L89 A;  5GJV B;  1VYV A;  1YIJ A;  3OYM A;  2AKL A;  4LN2 A;  2YLB A;  1BB9 A;  1WXU A;  1Y07 A;  1X2K A;  2DL5 A;  3GP8 A;  5DY9 A;  5CK9 A;  3L42 A;  1SSH A;  3FJP A;  4BE0 A;  4FSS A;  5FRO A;  2DD4 A;  2KEA A;  1GXI E;  2RNA A;  2D8J A;  3OYC A;  7AT1 B;  1Q86 C;  4XTY A;  4QVZ A;  4JJB A;  1Q82 C;  1WJR A;  2DNU A;  1ZBJ A;  2CP6 A;  4HT9 A;  5IXF A;  3EG0 A;  4DOV A;  1N8R C;  2CP5 A;  4JZ3 A;  3IQL A;  4PLL A;  3A5Z B;  3EGD B;  2B86 A;  4PLI A;  3OYF A;  1WXT A;  2HEQ A;  1BBZ A;  2YWW A;  4M7D D;  1IRX A;  5AT1 B;  4KGV B;  3PMI A;  5KYN A;  1GCP A;  2ROL A;  3P8B B;  3JCM W;  2IG0 A;  3QWX X;  1YJ9 A;  5CQX A;  1ZSZ C;  5CD1 A;  3V7S A;  2E5Q A;  1WXB A;  1YCY A;  1JXM A;  1NJI C;  2CP2 A;  4CC3 A;  4XTX A;  1VA7 A;  2K5L A;  2QGF B;  4L5G A;  3MEW A;  4NL2 A;  3UDC A;  2EJG A;  1K9M C;  5FTM A;  2K9G A;  4M7A B;  1WDX A;  2QQR A;  3QWY A;  2JOY A;  2RQU A;  3EFO A;  3NMZ C;  2HKQ B;  1BU1 A;  1NLP C;  4BUG A;  1KQS P;  4F7U E;  1UEC A;  3E19 A;  2K3X A;  4M77 A;  2A37 A;  2A08 A;  1WHM A;  1NG2 A;  2K3Y A;  1OX9 A;  4RCC A;  5HK0 A;  4PJL A;  2O9S A;  2B25 A;  4FT2 A;  1UTI A;  1YWP A;  4OF1 A;  1JJ2 P;  4J9E A;  3JB9 G; 
#chains in the Genus database with same CATH homology
 3J7A F;  3CPW S;  3LYI A;  4QVC A;  1VQK T;  5LJ3 f;  3E9F A;  1VQ5 T;  3X24 B;  3DB3 A;  3OBW A;  3LLR A;  1B34 B;  3OYB A;  1MHN A;  4R55 A;  1O75 A;  2PU9 B;  3JCM c;  1KQ1 A;  4KDI A;  3JRZ A;  4M7A C;  2JTF A;  3HU3 A;  1JBM A;  1YIT A;  2R5A A;  3OW2 S;  4RCB A;  2WSE E;  1Y7X A;  3EAE A;  4EMK A;  1VQ8 T;  3JCM e;  4ARI A;  1K73 U;  1XQH A;  3A8M B;  2GQV A;  2XI9 A;  4VUB A;  5IAY A;  1VQM A;  1Q81 U;  1KD1 U;  2E41 A;  3FLG A;  4LD6 A;  3BFM A;  3VYH B;  5LJ5 g;  4GY5 A;  4E7K A;  5CIU A;  2M1H A;  1X6O A;  5HKC A;  1KC8 U;  4MML A;  4M7A A;  3ZJU A;  2KK4 A;  3GLX A;  3JCM X;  3RMS A;  4Y91 A;  5FTL A;  4M78 D;  1OZ2 A;  3CXC S;  1D3B B;  4HCZ A;  3OSV A;  1QDN A;  4KOD A;  1H64 1;  2HBP A;  1EIF A;  5GAN f;  5GAN 2;  3L2V A;  2E6Z A;  4IUR A;  1VQN A;  2CYZ B;  3MEU A;  3RKW A;  1IRE B;  2QI2 A;  5AYF A;  2FVU A;  3INZ A;  2RK2 A;  1QVP A;  3C12 A;  3RES A;  3PIO A;  2EIF A;  1JJ2 S;  3C95 A;  2PUK B;  4M75 A;  4J7F A;  2MF2 A;  2PVD B;  2ZPI B;  3X26 B;  4O5V A;  3OYY A;  2Y90 A;  4C92 D;  2ZPB B;  3MP1 A;  3OSS C;  2ZPF B;  3CCQ A;  3QDR B;  1YJW T;  4YTL A;  5GAO n;  3G4S T;  4M7D F;  3L2Q A;  2FL7 A;  3AHU A;  3LGL A;  2DTH A;  3S3O A;  2KVQ G;  1NPP A;  3CC4 T;  4KBM B;  2DZC A;  2MMP A;  2M9U A;  1Q7Y C;  4UC4 A;  1TH7 A;  4JRP A;  4J6Y A;  1YI2 T;  3V7R A;  2L8D A;  3M53 A;  1FX7 A;  3JB9 H;  4MZP A;  1WQ7 A;  3CCQ T;  1N9S A;  3EFS A;  4LDV A;  2LRQ A;  4IUT A;  2XDP A;  4EMK B;  1KHI A;  3SB2 A;  4ZGJ B;  5DLO A;  5FTK A;  4M75 E;  5GAN h;  5GAM j;  2CZ1 B;  1VQ7 A;  2RJF A;  4L6V 5;  1BI0 A;  2K5I A;  3OB9 A;  3OMC A;  4BI3 A;  4DOW A;  5B6C A;  3SWN C;  2QQS A;  3HL8 A;  4M78 F;  3SWN B;  4TVR A;  1VQ4 A;  5GAN j;  1VQ6 A;  5GAM h;  3QQ8 A;  2X4X A;  2I2L A;  3M9Q A;  4M77 G;  5A2Q E;  3I55 T;  3L2W A;  2EKO A;  1MGQ A;  2QQA A;  2DXU A;  5L8R E;  4XU1 A;  1BI3 A;  4M7A E;  1VUB A;  4OGE A;  5FTJ A;  4C5G A;  1R7R A;  3OYL A;  3QYG B;  4CRI A;  3CCR A;  3VV0 A;  1KQS S;  3CD6 A;  4RG8 A;  3RUX A;  4E7I A;  2F69 A;  4M7D C;  1U1T A;  2KSS A;  3PGG A;  5LJ5 j;  4IUV A;  4BY6 B;  4ZN3 A;  2L5Q A;  3I55 A;  4M7D A;  3E1S A;  4M78 E;  1ZBX A;  2GCX A;  3RMQ A;  1JRI A;  3O8V A;  3CCJ A;  1PSE A;  1KQ2 A;  2DIQ A;  3CCU A;  4IUU A;  4OB2 B;  4M77 B;  1U1S A;  4F7U B;  1RI0 A;  3HFN A;  4FIB A;  4M77 F;  1FWZ A;  4C0D C;  3CCM A;  3BW1 A;  1I9G A;  3QHS A;  2VC8 A;  4B9X A;  2HNI A;  1ZQ1 A;  3N5B B;  2RI2 A;  3L2R A;  1Q81 C;  4KUI A;  4XK8 E;  3JCM V;  4C0Z A;  1VQM T;  4EMH A;  1WGS A;  5KE2 A;  3PT9 A;  4C92 E;  3OQ5 A;  4LDX A;  2KQW A;  1QVF A;  5CCB A;  3FRN A;  3KUF A;  3L2Z A;  4A4F A;  1S72 A;  5FRM A;  4Y28 E;  3VYG A;  3QZ9 B;  4JJN K;  2YLC A;  4JUV A;  3M57 A;  2FHD A;  4JS4 A;  2VYT A;  3CPW A;  2O4X B;  3CXC A;  2DJZ A;  4RV0 A;  4OB1 B;  2HAX A;  3KBG A;  3HU1 A;  4E7H A;  4F7U G;  1NZ9 A;  3FPT A;  1VQ9 T;  2Q1C X;  3HRU A;  2G3R A;  3NFC A;  1WPY A;  3QUI A;  5LJ5 h;  4DA4 A;  2QA4 T;  5CKD A;  2VXF A;  3LHD A;  3VUB A;  2XK0 A;  4BB7 A;  1PSF A;  4NL3 A;  4AS1 A;  5LJ5 d;  5C18 A;  2D0Q B;  1XTD A;  4JS5 A;  2JTM A;  1W4S A;  3OYE A;  5FTN A;  1YJW A;  3MCA B;  3QBY A;  1E32 A;  2DAQ A;  4M75 G;  3URG A;  4KT0 E;  4OVA A;  4XAX B;  5GAO p;  5CKH A;  2EAY A;  3OS5 A;  1ZHI A;  3GIB A;  2DPP B;  5CKE A;  4GLK A;  3HRS A;  1K8A C;  2DK3 A;  4V2S A;  5FRN A;  4M7A D;  2MWO A;  1BYM A;  1CR5 A;  1YHQ A;  5KCH A;  2O01 E;  5CVI A;  2Q1D X;  4BE2 A;  3VJP A;  4C5E A;  4Q5W A;  4LDY A;  4QVD A;  2CZ6 B;  3QYH B;  5LJ3 e;  1WJS A;  4A54 A;  3KXT A;  2BIV A;  3LWI A;  1UGQ B;  2ZCF B;  2M16 A;  2PQW A;  1VQ7 T;  3LGF A;  3GPL A;  5GMK h;  3OS1 A;  2RK1 A;  1UGS B;  1KG1 A;  3GF5 A;  4XQ3 A;  3OS0 A;  1G5V A;  2NLU A;  4C8Q E;  5GLF A;  1VQO T;  2QEX A;  4X9C A;  4EMG A;  5GMK j;  1B34 A;  1WQW A;  3MP6 A;  3QKJ A;  1VQK A;  5GAN 3;  3E9G A;  5LJ5 e;  4FU6 A;  3CCR T;  4M77 D;  5GAN 4;  3NTK A;  1G3T A;  3GNG A;  3CD6 T;  2LW6 A;  4PL6 A;  3HU2 A;  2YHT A;  2GFU A;  2MI6 A;  3PTA A;  2KDS A;  2RA2 A;  4PNO A;  5IT9 E;  3S3M A;  4N0A C;  4XTZ A;  3JB9 F;  4QQG A;  3JCM g;  4HKE A;  2HQE A;  2L3R A;  4WF2 A;  5HY6 A;  3SDZ A;  4X9D A;  3JB9 I;  2OTJ T;  2PVO B;  3EFR A;  4P5N A;  1DJ7 B;  2KMT A;  5DM7 R;  4PJO C;  4OB0 B;  4J83 A;  1YI2 A;  1CZ4 A;  3CCM T;  4J8O A;  2MAM A;  4C8Q F;  4A4K A;  2DIG A;  1OI1 A;  1RL2 A;  5GAN d;  3WXM B;  1WJQ A;  3L1A A;  2DXB A;  4M78 A;  4J6W A;  4QW2 A;  3CCU T;  4M7D G;  4M7D E;  1YIJ T;  4LDU A;  4N0A A;  1FXX A;  4E47 A;  2VXE A;  3JSC A;  4C0G A;  2RI3 A;  1G3W A;  4M78 G;  1BI1 A;  1VIF A;  3DLM A;  2XKO C;  3QJ6 A;  3C4S A;  1LOJ A;  3ZFJ A;  5A0L A;  2F5T X;  3CCE T;  4KO8 A;  4N4H A;  4B9W A;  3M54 A;  1VQL A;  2WSF E;  1I8F A;  3HKS A;  4D6W A;  4N4I A;  5FU7 B;  4OP0 A;  5I21 A;  3G4S A;  4M78 B;  5LL6 S;  5C1B A;  4M75 C;  1WNL A;  3ASK A;  5CCA A;  2VGM A;  3ZEH A;  3CMA T;  2JV2 A;  3ZJT A;  4A4H A;  2X35 A;  2XHC A;  3Q1J A;  5GAN 5;  1I4K 1;  1M1G A;  4KDL A;  4M7D B;  1G3S A;  1QVG A;  4C0F A;  3CBM A;  5GAN 8;  4ZTJ A;  3BQB A;  2XDD A;  1UGP B;  1QVG S;  2PVG B;  4NOY A;  2PJH B;  1BIA A;  1K73 C;  2LCC A;  2CS7 A;  3OY9 A;  1O9S A;  4C92 B;  3FB9 A;  3CMA A;  4XU0 A;  3CC7 A;  4FSX A;  2WSC E;  2CZ7 B;  2LT1 A;  1Y96 B;  2P0P A;  3TCJ A;  2C06 A;  5DYG A;  2RD1 A;  4XTV A;  2JNG A;  1M1K U;  3MEA A;  4C92 A;  4BD3 A;  3CCV T;  1I5L A;  4HCC A;  2OAU A;  4FM4 B;  1G3Y A;  2KY9 A;  2LQK A;  2Y4Y A;  2LQ8 A;  3UWN A;  2DTI A;  2K57 A;  4C8Q D;  1VQ6 T;  2D6F A;  2DD5 A;  3BDU A;  1M5Q 1;  2RHZ A;  3ZBD A;  3FIF A;  4E7J A;  4HCB A;  3A8H B;  1CZ5 A;  3H8Z A;  2CGH A;  3HP9 A;  3CBO A;  2Q18 X;  2ZPH B;  2RHI A;  4XU2 A;  5IN1 A;  3QO3 A;  2IVW A;  4ATO A;  1M1F A;  4XTW A;  3QJY A;  2E6N A;  4OB3 B;  3MB5 A;  2R57 A;  2FYK A;  3A8L B;  4RMO A;  3G71 T;  5FU7 C;  1KC8 C;  3MO8 A;  3JB9 J;  4KUD K;  1VQP T;  2DZ9 A;  3QII A;  4BDY A;  1HXD A;  3OYJ A;  1SSF A;  1UB4 A;  2RB6 A;  4ZGD B;  3DLL A;  2E65 A;  5C6S A;  1NJI U;  1M90 U;  3CC2 T;  1QP3 A;  3ZJV A;  4CQN A;  1VIE A;  5CQY A;  4C8Q G;  3MP8 A;  5GAN e;  1LJO A;  3F70 A;  2CKK A;  2GFA A;  3FC3 A;  1BKB A;  3CCS A;  2X4Y A;  4FL6 A;  2RHY A;  3QWZ A;  3V8L A;  3M5A A;  5CKB A;  4C5I A;  1N9R A;  3S6W A;  5KE3 A;  4PJO G;  3DKM A;  2DO3 A;  4M77 C;  4PKC C;  5GAM f;  2ZPG B;  2LCL A;  2EQK A;  4M75 B;  4C0D B;  2LX9 A;  1Q7Y U;  1WLF A;  3X28 B;  2R5M A;  2QDY B;  4XU3 A;  2FB7 A;  3BDL A;  4CI0 C;  4O6J A;  4LDW A;  3OYN A;  5D6X A;  1LNX A;  3V8K A;  4C92 F;  3R6O A;  4JRQ A;  2DXC A;  3SD4 A;  1O54 A;  3CCS T;  1H3Z A;  1XNI A;  2E10 A;  2A3L A;  3VU3 C;  3JCM h;  3JCM b;  1Y96 A;  1Q82 U;  2A7Y A;  1V29 B;  4ARC A;  3L2U A;  2LNV A;  3GNF B;  3M56 A;  2K2V A;  2VV5 A;  4JLI A;  3CME A;  2Q1A X;  2P0Q A;  3HPW A;  3DB4 A;  3PFS A;  2M0O A;  4JLG A;  4L59 A;  5CO7 A;  1U8R A;  1K8A U;  3CPF A;  3J81 E;  3M4Y A;  2QA4 A;  2RHU A;  2DXT A;  2EFI A;  2Q19 X;  4XTU A;  3WVD B;  4A4E A;  5GAM d;  2EQJ A;  4ELY C;  2XD0 A;  3CF2 A;  4ZN1 A;  3LGA A;  3VKI A;  4BE1 A;  2QQB A;  1YJN A;  1AHJ B;  2QTX A;  3VUZ A;  3RKY A;  4HT8 A;  2DVE A;  5GAN 6;  3OS2 A;  2E70 A;  3ME9 A;  3HRT A;  2RI5 A;  5D6W A;  4AQ7 A;  1VQ5 A;  2JZ2 A;  4EPC A;  2PUO B;  4II1 A;  3TEE A;  3HHT B;  3LWH A;  1NPR A;  5CAI A;  1YHQ T;  4ZTF A;  1YIT T;  2YVL A;  3LH0 A;  3T9N A;  3NTH A;  4ELZ C;  3JCM J;  5FU6 C;  5GAO r;  4FT4 A;  3QZ5 B;  4A4G A;  2VUB A;  3CC7 T;  1IZ6 A;  2LVM A;  5J26 A;  1NE8 A;  1YJ9 T;  4MDX A;  1Y71 A;  2GF7 A;  4N4G A;  4IKF A;  2EWN A;  3QXE B;  2P0K A;  3V8J A;  4ZGE B;  5C0M A;  4JDS A;  3LW5 E;  5CR2 A;  3CC4 A;  2MM0 A;  5DYI A;  4MDW A;  3OYK A;  2XID A;  5GMK i;  3CCV A;  4BY6 C;  1P92 A;  1X75 C;  3G7Z A;  4ME7 A;  5FLX E;  2R58 A;  3JCM Q;  4BDZ A;  4J5Y A;  5J3B A;  1HK9 A;  2YRV A;  3OYH A;  1VQL T;  3QSU A;  3A8G B;  3QQ7 A;  3TU4 K;  4Z02 A;  4QQ6 A;  2MWP A;  5KCO A;  4RG2 A;  3RIR A;  1YBY A;  2LT4 A;  3I56 T;  1XOV A;  4KLN A;  1D3B A;  2EJ9 A;  2EQU A;  3CCL A;  1QP2 A;  2X4J A;  4PJO D;  2AHJ B;  4J6X A;  1R8O B;  2ZZD A;  3PIP A;  4R56 A;  4BI8 B;  3G6E A;  3WVE B;  2O4X A;  5ERG B;  4M75 D;  1M9S A;  3OYA A;  5LJ3 h;  3J80 E;  2RM4 A;  3JAM E;  2LC4 A;  4MZT A;  5GMK m;  2JVV A;  2RO0 A;  5GMK e;  2JN0 A;  2L89 A;  3OW2 A;  1VQP A;  2E1H A;  4PJO E;  1ZC1 A;  1YIJ A;  3OYM A;  4C92 C;  2BUD A;  3QPH A;  3BY7 A;  2QXF A;  2XU8 A;  2DEQ A;  2WAC A;  2YLB A;  4C8Q A;  1VQO A;  1QW1 A;  1Y07 A;  2EJF A;  4M77 E;  5D6Y A;  4EMK C;  2DKG A;  3PMT A;  2QEX T;  5FU6 B;  3X25 B;  1W2B A;  3GP8 A;  3CBP A;  5DY9 A;  4F7U A;  2LTO A;  5I2M A;  5CK9 A;  5I2S A;  3CCE A;  1S3S A;  2YUJ A;  3L42 A;  4IUP A;  5EPP A;  1QVF S;  3RER A;  3FJP A;  4BE0 A;  3UT1 A;  3UPU A;  2OTL A;  2RJD A;  1KD1 C;  2EQM A;  3M58 A;  3ER0 A;  2DD4 A;  2K4Y A;  5FRO A;  2XDB A;  1GXI E;  4MZM A;  2RJE A;  4MMK A;  3OYC A;  5LJ5 f;  1Q86 C;  4C8Q C;  2KAF A;  3MEV A;  4QVZ A;  4XTY A;  5M9O A;  3CME T;  2OTJ A;  1Q82 C;  1WJR A;  4JRK A;  4M7A F;  4HT9 A;  1S72 T;  1QCS A;  4KUL A;  3SWN A;  4RKU E;  3FPR A;  3P8H A;  2QQ9 A;  4DOV A;  5KH6 A;  3OA6 A;  1N8R C;  3HFO A;  1UGR B;  1K9M U;  4PLL A;  1UEB A;  5DLQ E;  1KQS A;  1M8V A;  3LX7 A;  2RHX A;  2E64 A;  3A5Z B;  4M75 F;  1VQ8 A;  2DTO A;  1I81 A;  4X34 A;  1Q86 U;  4PLI A;  1BIB A;  3CEY A;  3OYF A;  2EYQ A;  2K5F A;  2ZGW A;  5GAO l;  4J7I A;  5GAO m;  3M55 A;  1BI2 A;  3CCJ T;  3H6Z A;  4M7D D;  5GAN 7;  1M90 C;  3HSB A;  3PMI A;  3JB9 D;  5LJ3 d;  3FPU A;  1N6A A;  1JJ2 A;  3P8B B;  3OYG A;  3MET A;  3JCM W;  2IG0 A;  1YJ9 A;  4F7U F;  5CQX A;  2RH2 A;  4EDU A;  2V8K A;  3P8D A;  3PNW C;  2MM2 A;  5CKF A;  3OMG A;  2X4W A;  5CD1 A;  2LDM A;  1N8R U;  3V7S A;  2E5Q A;  5GAM g;  2V8J A;  4QQD A;  1VQN T;  3QC8 A;  1YCY A;  4PJO B;  3SFM A;  2XIC A;  1NJI C;  2E12 A;  4BAC A;  1M4Z A;  4XTX A;  2K5L A;  3G71 A;  3A8O B;  4C8Q B;  5GMK l;  3M4G A;  4L5G A;  3MEW A;  4NL2 A;  1VQ9 A;  2D9T A;  3UDC A;  2EJG A;  3I56 A;  3CCL T;  2JUF A;  3OYI A;  1K9M C;  1KHC A;  4E7L A;  5HK3 A;  3CC2 A;  5FTM A;  4A53 A;  5LJ3 j;  3OYD A;  1N27 A;  5GAN g;  4M7A B;  3S3N A;  2HQX A;  3QG1 A;  4IUQ A;  2QQR A;  2JOY A;  1JB0 E;  3G6E T;  4OGC A;  5A0G A;  3JCM d;  2VGN A;  5GAO q;  3M59 A;  3V7C A;  2BKD N;  2XG8 D;  2RJC A;  3NTI A;  4M78 C;  3X20 B;  4M7A G;  4NS5 A;  5J39 A;  4HA8 A;  3RKX A;  4BUG A;  4F7U E;  2F5K A;  2Y4X A;  3E19 A;  3GOX A;  2K3X A;  4M77 A;  2V8I A;  5CCX A;  5LJ3 g;  5EQJ B;  5GAM e;  3FDR A;  2K3Y A;  1OYX A;  1X01 A;  2B8A A;  4C5H A;  1VQ4 T;  4RCC A;  5HK0 A;  2PWY A;  2B25 A;  2HD0 A;  2H3J A;  2OTL T;  4PJO A;  2P4T A;  3OBY A;  2CZ0 B;  4FT2 A;  5EG2 A;  4DQ2 A;  3MHX A;  4C92 G;  3ZGZ A;  1OZ3 A;  3JCM f;  2ZPE B;  4OF1 A;  4BI4 A;  1YJN T;  3JCM P;  4JRI A;  3FEO A;  3TIW A;  5A0D A;  3JB9 G;  1W2B S;  3TRE A;  4LD9 K;  4OMF B;  3C94 A;  1M1K C;  4PJO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...