2GFAA

Double tudor domain complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
107
Chain Sequence
ALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Jumonji domain-containing protein 2A
publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 107
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfaA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gfaA02
5FROA 4BDZA 2DIGA 2EQJA 2BKDN 3DLMA 3MP6A 2GFAA 3OYJA 3FDRA 4IUUA 2L89A 2B8AA 2L3RA 4A4EA 4E7HA 4A4FA 2R57A 3LX7A 4GY5A 3NTHA 4IUQA 2M16A 3KUFA 3LGLA 2RJFA 3EAEA 4X34A 2EKOA 2RHZA 3E9FA 3OYDA 2CKKA 4L59A 4QQ6A 4RG2A 5IN1A 3OYMA 1H3ZA 2PQWA 5KCOA 4NS5A 3OYNA 3H8ZA 3LYIA 3L42A 5C0MA 3L2RA 1MHNA 3META 4C5GA 2L8DA 1KHCA 3NTKA 2RJDA 3OS2A 4BE1A 4IKFA 2LVMA 1OYXA 2RHXA 4BACA 5KE3A 3MP8A 3GOXA 2RJEA 3BDLA 2X35A 3QIIA 2LTOA 2VYTA 4QQGA 2GF7A 5FRMA 2X4XA 2FHDA 3LH0A 4Q5WA 3L2QA 3MEVA 4IUPA 3L2VA 3OMCA 4PLLA 2HQXA 3OA6A 3P8HA 5KH6A 3OYIA 2E5QA 2RI5A 4QW2A 3ZEHA 1OI1A 3MEWA 2LRQA 3FEOA 3L2UA 4E7JA 3OYKA 3OMGA 3S3NA 1OZ3A 3OYGA 2XDPA 2MWPA 3QKJA 4IUVA 5D6YA 1WJSA 3OB9A 3OYAA 3FC3A 2R5AA 2NLUA 1XNIA 5D6XA 2D9TA 2M0OA 2XK0A 4N4IA 4QVZA 4UC4A 2RHUA 2RO0A 4E7IA 3DB3A 4Z02A 1N27A 2MWOA 3MEUA 2DAQA 3ME9A 2M1HA 3PNWC 3OY9A 4ZTFA 2RI2A 2WACA 4HCZA 4IURA 4OVAA 2RI3A 3FLGA 4IUTA 4A4GA 2O4XB 3UT1A 2QQSA 3OYEA 2GFUA 4E7KA 2JTFA 3NTIA 3P8DA 5KCHA 3UWNA 3H6ZA 3M9QA 2LCCA 3F70A 5D6WA 5J26A 3S3MA 1WJQA 4C5HA 1WGSA 3OYBA 3OYHA 4N4GA 4A4HA 3L2WA 2JZ2A 5J39A 3SD4A 5FRNA 2R58A 3S6WA 4PLIA 3OYLA 2EQMA 2RHYA 4EDUA 4FL6A 4FU6A 3O8VA 4BE0A 2RHIA 5C6SA 3OS0A 4B9XA 3PFSA 4LD6A 2O4XA 3MO8A 2HQEA 3OYCA 3MP1A 3DB4A 4C5IA 3MEAA 3OYFA 2R5MA 3C4SA 4CRIA 3PMIA 5M9OA 2RJCA 3OS1A 2BUDA 1RI0A 2IG0A 3ASKA 4B9WA 4BE2A 2X4YA 3CEYA 2K3YA 2QQRA 3OQ5A 4C5EA 2YRVA 2LDMA 3S3OA 2EFIA 3LLRA 2DIQA 2EQKA 2G3RA 1G5VA 4N4HA 4E7LA 1SSFA 3Q1JA 3QBYA 4II1A 2EQUA 1WJRA 2P0KA 3PMTA 4QQDA 5IAYA 3E9GA 4PL6A 2K3XA 4BD3A 3QJ6A 2BIVA 4ZTJA 3LGFA 2F5KA 2X4WA 2E6NA 5CIUA 4BDYA 1OZ2A 5KE2A
chains in the Genus database with same CATH superfamily
2EQJA 1M27C 2BKDN 4KO8A 4ZGEB 1M90C 2HQHA 2JV2A 3R6OA 3QUIA 2M16A 1QW1A 4MMLA 4HVVA 5A0GA 1PG5B 1YJ9Q 1OPKA 1FX7A 3JB9H 2K6DA 3JB9D 1N9RA 2YUJA 1SF9A 1YHQQ 1M3CA 5C0MA 3L2RA 1MHNA 4C8QF 1G8XA 1VQ9A 5KYYA 2F2XA 4BACA 2YVLA 4BUGA 5CCAA 3BDLA 4E7ZA 3CCQA 2DETA 4CQNA 4QQGA 1UE9A 1YN8A 2GF7A 2E3HA 3L2VA 1VQMT 3AT1B 2QXFA 4XTUA 4JJCA 4RTUA 4M77E 1M1FA 2K2VA 2HDAA 1VQ5A 3S3NA 5KYXA 1WJSA 3GIBA 1XNIA 2XK0A 4OMMA 3MB5A 2NWMA 4OB1B 4IURA 1EIFA 2COZA 4OVAA 1VQ6Q 1ZSZA 5LJ3g 5DY9A 2QQSA 3M0TA 4QVDA 3JB9G 3CCLA 1Y0MA 4Y92A 1KHIA 2COWA 4BB7A 3AHUA 3PTAA 2LZ6B 1OX8A 2FPFA 1K73R 1RI9A 3G71Q 1W70A 9ATCB 1SSHA 2LNHB 1H3HA 1R8OB 3CPWP 4BE0A 1K73C 3ER0A 1T0JA 4C92C 2PVOB 5FU6C 2Z0WA 4F17A 1S72Q 2DRKA 3S3OA 4E47A 1KQSS 3RMQA 1PSEA 2Y90A 3E9GA 2A37A 2FYKA 3ZJUA 1M2VB 4MZTA 2DX1A 2MAMA 5D7UA 1UHFA 4LUEA 5I22A 4IUQA 2KSSA 4ORZA 2EWNA 4PJOE 1RAIB 3VS0A 4M7DD 1I5OB 1UECA 2ZCFB 4N0AA 2RHZA 3E9FA 1VQ9T 4FW2A 1B7TA 3CMEA 3GF5A 3CCQT 3OBYA 4M78D 1OYXA 2QA4A 1VQKQ 3SWNA 2DYIA 1AT1B 5KYXB 1C1AA 2P0QA 2LTOA 4NL3A 4KH1B 2NUZA 4J7IA 3VRZA 2FPEA 4IUPA 2NYSA 1VQ5T 1ZSZB 2CGHA 2HKNA 5GANe 3A8GB 2A7YA 1GL5A 2V1QA 1JBMA 4M7AB 2J05A 3FC3A 1W6XA 3GPLA 1Z9ZA 2D9TA 4E2FB 2YXYA 3UDCA 2EGEA 3ME9A 4OMOA 4A54A 1T3LA 5GAN8 4AFSC 4M7DG 3H6ZA 3I9QA 4X9CA 4KGXB 3JCMV 1G3YA 3C94A 3MKDA 1Y96B 2OTLQ 4M78G 3LW5E 1BCOA 4XU3A 1ZLMA 2M02A 1QQJA 3G6EQ 4YTLA 2DL5A 3BFMA 3RBBB 1Q7YU 4TVRA 4AT1B 4MZMA 4LXCA 1VQ4Q 1RI0A 2FB7A 2QEXQ 3CCUQ 3FPUA 3CXCP 2G3RA 3EGDA 2EQUA 3QWZA 4KUIA 2DJZA 3X26B 3GLXA 1AZEA 3CCSA 3EFOA 5DYGA 3CCET 2ZGWA 4JLGA 2MIOA 4KRTA 5CCXA 2RJFA 2JOYA 3CMET 5CQXA 2Y4XA 1HYOA 2DL7A 2KXCA 2I2LA 4M7AE 2WSEE 2X3WD 2W0ZA 5KCOA 2RPNA 1KHCA 3M56A 4BE1A 2PU9B 4IKFA 1NLPC 4RTXA 5KE3A 2GNCA 2J6KA 1D1AA 3E2UA 3CCRA 1UGVA 2JT4A 3QYHB 3MEVA 3JCMW 3OMCA 1BI0A 5GAOq 3PE0A 1IB8A 2DXBA 2CS7A 3JCMf 2K5IA 2QDLA 1NEGA 4M75G 1UB4A 2NUPA 2DVJA 1Q81U 2QGGA 1AWOA 1I1JA 3QDFA 2EGCA 1KD1U 1KJWA 3VYHB 1WHGA 1M9SA 2GFUA 1X6OA 2FO0A 4FSXA 2VGMA 4ZGJB 2B25A 5IXFA 1RLQC 5LJ3e 5I2SA 1AHJB 5A0DA 4J9FA 2FPDA 4XTWA 1D3BA 2RHYA 4OB0B 3OW2A 2ZAEA 5HY6A 4B9XA 1PHTA 1VQLA 1MNDA 3VJPA 3JCMd 1UGRB 5GAMf 3I35A 1RAFB 4KUDK 2C0IA 3LLRA 3EGXA 2QG9B 3CCST 2FEIA 4QQDA 4BY6B 1N6AA 2EPDA 2A08A 2DPPB 2E6NA 4BDYA 2HCKA 1VQ6T 2BE9B 2ECZA 2AT1B 4BDZA 4FT4A 1QVGP 3GNFB 2ZPGB 2L89A 2QASA 3RUXA 2KVQG 2Q1CX 1QKWA 4HXJA 1SEMA 5GAMg 1YCYA 5L8RE 2DEUA 3HL8A 1WZOA 3CCRT 3CPFA 3JCMb 2AHJB 2L3SA 3OS2A 4XTZA 4J9IA 5CO7A 2MM2A 3QIIA 3A8HB 2NUPB 4J83A 3FPRA 1FMVA 1PRLC 4JZ3A 2RQWA 4FCYA 4RKUE 1JXOA 4ARIA 2OAUA 4ELZC 1VQ8A 1M90U 3OYIA 1BK2A 3OS5A 1OI1A 4M77C 3OMGA 1W2BP 2DFUA 4M7DB 1Y07A 2OI3A 1TWBA 4F04B 5GAOr 2QQ9A 1I07A 1B07A 3I5RA 4M78B 1X27A 1Q7YR 2AZVA 5IT9E 4J6YA 3I56Q 1U8RA 3X24B 5J26A 2YUOA 3OW2S 2KROA 1Q7YC 4RTYA 3EGXB 1VQLT 3S6WA 3I5SA 3V7RA 4FU6A 1YJNQ 2ZPIB 2CZ1B 4RTZA 4FYVB 3OS1A 1GXIE 2IG0A 1D0XA 2X4YA 2DTIA 2K3YA 3CEYA 2MPXC 2DD4A 5DLOA 4B6MA 3TSWA 2CZ6B 2J6FA 1G3WA 5CK9A 1M8VA 1FYNA 2QYZA 1F1BB 1IGUA 1H92A 3CC2A 1UG1A 4PJLA 5KE2A 4E6RA 2LQKA 1KFZA 1TUCA 2GFAA 1JRIA 3THKA 3UATA 1WYXA 3QSUA 4RG8A 1K1ZA 1QVGA 1K73U 4PJOC 1WQWA 2CKKA 3RKXA 3CCJA 4XTYA 1JJ2P 4V2SA 1X2KA 2V8IA 2FL7A 2HEQA 1R7RA 2MM0A 1H8KA 3E19A 3LHDA 2E6ZA 4JJNK 2VYTA 5GANf 3PVLA 3EFRA 1T3SA 2CUBA 2FHDA 1Q81R 2DK3A 1VQ8T 2RQRA 2WSFE 1KQ1A 2DEQA 3J81E 4HT8A 5FTKA 1GCQA 1KD1R 3INZA 2KT1A 2JNGA 1BI2A 1Q81C 1KQ2A 1MMGA 3V8LA 1ZUYA 3H0FA 3L2UA 1QMCA 3HU3A 2J7IA 1OU8A 3I55Q 4N4IA 5IHNA 2V8KA 5ECAA 3DB3A 2DBKA 3HU2A 2JM8A 1IHWA 2AK5A 1TOVA 1VYTA 4DEYA 3UT1A 3CCLQ 1RAAB 4R56A 1UUEA 2QAZA 1YWOA 4FYYB 1VQNQ 3F70A 1K76A 3M4YA 2DE0X 3RESA 4ANJA 3S3MA 4C5HA 5GANd 1E7OA 1V76A 5GMKi 4PLIA 3OYLA 2CP0A 2CH4A 4M77F 3MEAA 1QP2A 3JRZA 2ZPHB 3CCMA 3HRUA 2EVRA 1GFCA 3TEEA 5LJ5f 4EMGA 3QBYA 3CC2T 2JJ9A 1ARKA 3SFMA 2O31A 3GBQA 3WXMB 1I5LA 4M75E 1QCSA 2EKHA 1QVGS 4PFPA 3TVTA 4WTOB 2PJHB 1VQ7A 2AZSA 4A4FA 5DM7R 3CCJT 3LGLA 4C8QA 4X34A 2LQ8A 4AMCA 3REBB 3OYDA 4RG2A 3JB9I 4KGVB 4M7AC 3RERA 4JJDA 1HSQA 2YUQA 3JV3A 4C5GA 1Z9QA 4LDXA 5LJ5g 5A0LA 3VRYA 1E6GA 3VUBA 1QCNA 2XICA 2LT4A 2ROTA 5I21A 4AFQC 3P8BB 3H0HA 5FRMA 3TU4K 1ZX6A 1BI1A 1J3TA 1ACMB 2DD5A 2XHCA 2K4YA 3UA6A 4QT7A 4CI0C 4PFOA 3C12A 3RDVA 2KT8A 3JCMc 3G4SQ 4PJOF 2R5AA 4C92D 1WX6A 4QVZA 2RO0A 5LJ3f 1PCXA 1JO8A 2G6FX 3FLGA 3QQ8A 1RAHB 1I81A 4F7UG 3OYEA 1CZ4A 2WSCE 5FW9A 3M9QA 2LCCA 5GJVB 1RAEB 3QPHA 2VV5A 1YJWA 2LX9A 3OSSC 1Q82U 1TUDA 3DLLA 2R58A 2F69A 1R0CB 2XU8A 1WNLA 4ELYC 3L1AA 5FTLA 1D09B 3MO8A 4JDSA 3CCMT 2RM4A 1PM3A 1WXBA 1XQHA 2EAYA 3OYFA 3CMAA 2JW4A 4EMKA 1M8MA 2QQRA 4C5EA 3FIFA 1QVFP 2Q1DX 1C0MA 1PKSA 5LJ3d 1JU5C 2MMPA 4OB3B 3V8JA 2KE9A 2ENMA 5IAYA 5KYWA 1LVKA 1X43A 2K3XA 1W4SA 4LNPA 4ZTJA 4C92G 6AT1B 1VQ7T 4C0ZA 1PD0A 2MYSA 4CC4B 1VQOT 7AT1B 2FRWA 3CBOA 3CD6Q 1AZGB 4AG1C 1RADB 3EG3A 2X51A 2EGAA 2QTVA 3L2ZA 4Y28E 5FU7C 2LJ1A 2OX7A 3H8ZA 1M1KR 2YWWA 3CC4Q 3WVEB 2HSEB 1NG2A 1FWZA 1FMWA 4FIBA 1BB9A 3JCMh 3CBPA 1IXDA 3A8OB 3EHQA 5CKBA 3KXTA 3JCMQ 2RJEA 1M1KC 1EZZB 3HTRA 3RNJA 3M59A 5KYYB 5GAN3 1I8FA 4ARCA 4JPBW 3H41A 3CCVA 2DKGA 3CCEA 4CC7A 3JCMJ 2IPOB 3N5BB 1YIJQ 1QCOA 2JS0A 2K79A 1SHGA 3M0PA 3G1JA 2HBPA 2XDBA 1YITQ 4M7AF 4J9HA 2M0OA 1WHMA 4DBQA 4HA8A 2RHUA 3MPUB 4JLIA 3MEUA 3OY9A 1D0YA 1PD1A 3A98A 2W10A 3HPWA 1U1TA 4OMQA 3P8DA 3JCMP 1YJWT 4EMKB 1WDXA 5D6WA 4C0DB 4F7UA 2BTTA 2A3LA 1VQPQ 3OYBA 1I4K1 4PK4A 2DJQA 2PUOB 3E1SA 2PZ1A 4FL6A 2KEAA 1JQQA 3FRNA 5KYWB 4LDYA 3CMAT 5C6SA 4RCBA 1MMAA 5LL6S 4C5IA 2QQBA 1TS9A 3LGAA 3OQ5A 1KIKA 2FG0A 1YI2Q 2JTEA 2JVVA 3TQ7P 3I55T 1YHQA 8AT1B 2CZ7B 1K0SA 1MV3A 1OQKA 2FVUA 5GAN2 2OTJT 2F5KA 2P84A 1QVFA 3MP6A 4J6XA 4C92A 1W1FA 1WLPB 1WA7A 3M53A 3EAEA 3CC7Q 1UDLA 4GBQA 3CPWA 3V8KA 2PUKB 5IXBA 8ATCB 1BKBA 1H3ZA 4NS5A 3KBGA 2HL5C 3D7SB 4DBHA 4M78C 1WPYA 5DLQE 5HK3A 2DL4A 1M4ZA 2K3BA 1M1GA 5LJ5e 3CCVT 1VQ6A 1WXUA 3L2QA 3SWNB 2KDSA 5AT1B 2E5KA 2HQXA 3VS7A 3PIPA 1X2QA 5GAOn 4JRKA 3ZEHA 1Y57A 1RACB 3G71A 1NLOC 2CSQA 1SRMA 1TH7A 4AG2C 2EYYA 3QKJA 4F7UB 2DF6A 1QWFA 3X28B 1IRXA 3JB9F 3QWYA 1Q82R 4KDIA 2CT3A 3BDUA 4JZ4A 1S72A 1Q82C 1JXMA 4MDXA 1YBYA 3QJYA 4A4KA 2OJ2A 1QWEA 4A4HA 1Q86U 3ZJVA 4ZN1A 1QP3A 2F5TX 3HFOA 1YJ9T 5HK0A 2RNAA 1XJWB 2VASA 5FTNA 4AQ7A 1YHQT 4C92B 3A8LB 4RTVA 3T9NA 1WHJA 1QVFS 2GCXA 5B6CA 3RIRA 3VU3C 3NGPA 1R77A 2MF2A 1U1SA 4KULA 4J9EA 4KODA 2RQTA 4E7SA 1VQKA 1AOJA 1OZ2A 3EGDB 3FJ5A 5CKHA 2NUTA 2LT1A 3FB9A 4M75C 3CPWS 2KBTA 2DZCA 3PIOA 2R57A 2XI9A 5GANh 2A36A 3EFOB 5GAOp 5I2MA 2CP3A 1O75A 1TSFA 4M77D 2FRYA 4L59A 4QQ6A 1M3BA 1KG1A 3M54A 3L42A 1M3AA 2EBPA 1TTHB 1MGQA 3CXCA 1TU0B 1ZBXA 5I11A 4AS1A 2X35A 4BI8B 3ZFJA 5CD1A 1U3OA 1ABQA 2EW3A 3EH2A 5HCKA 3G71T 4FM4B 1UFFA 2KMTA 1N8RR 2HKQB 4QW2A 2OTLA 1VYUA 3QC8A 4E7JA 1WHLA 3ULRB 4PFZA 5GAMd 1N8RC 2MWPA 4IUVA 2RN8A 3O5ZA 2RB6A 1GBQA 4M7DF 1MMNA 2EYWA 1S72T 1CKAA 1VQ4A 1OU9A 3QHSA 3PNWC 3HU1A 1C6VX 3C95A 3CBMA 3CCUA 2EYZA 4M78F 2F2WA 3QXEB 4M77G 1PC0A 2RMOA 3EG1A 1V29B 5CQYA 1VQMQ 2A0FB 2K9GA 2KI7A 1SRLA 2CP2A 3SD4A 2L3PA 3IQLA 3PVQA 1K4US 3JCMX 3OS0A 4MMKA 2ROLA 1ZA2B 3DB4A 1D3BB 3LH5A 2KRMA 4CRIA 1VOMA 2NUTB 4C8QD 1KC8R 4PJOD 2VWFA 1G3SA 2P0PA 4J9CA 2DIQA 4BI3A 1KC8C 4AFUC 1VQKT 1M2OA 1WJRA 2XMFA 4LUDA 4D6WA 4PL6A 5IH2A 1D1BA 3M0RA 2X4WA 3DLMA 5GJWB 2LCLA 2C06A 2B8AA 1M5Q1 2DA9A 2K2MA 3QZ9B 2LJ3A 5J3BA 2DNUA 1N9SA 1NM7A 5IHIA 3CXCS 1PRMC 2PTKA 2GGRA 4PJJA 1UGQB 4C8QG 4PJOG 3A5ZB 1YWPA 2E65A 5LJ3h 2OTLT 3P8HA 4M75F 4PKCC 4M7DE 4DEXA 4JRPA 3G6ET 2CP6A 2FZGB 5CAIA 2DRMA 1R0BG 2H8HA 5IHKA 2V26A 3HKSA 2D8JA 3NHNA 2JXBA 1VQ4T 1VQ9Q 2E70A 1IO6A 1KSWA 4M78E 4PJMA 2QEXT 3CCQQ 1RAGB 3EG2A 3CCUT 1Q86R 2GQIA 1AD5A 2AKLA 2M51A 4IUTA 4A4GA 1UJ0A 1ZQ1A 2LCSA 1K8AU 2RF0A 4J9DA 1Q86C 1M1KU 4RUGA 2F2VA 2RQVA 2L5QA 4DBFA 3CF2A 2KXDA 2QK0A 3QO3A 3G7ZA 5DYIA 1QKXA 4M77A 1WGSA 1VQ5Q 3OYHA 1EX4A 2GQVA 2YUPA 3SDZA 3VYGA 2I0NA 3TIWA 5HKCA 1W2BA 3EG9A 1HD3A 2RK2A 2O9SA 4LDVA 1X6BA 4R0KA 2YRVA 2SRCA 1G5VA 2QDYB 2O9VA 4KDLA 1Y7XA 2EJGA 4A63B 3KFVA 1VIFA 1WLFA 4X9DA 2AKKA 1X75C 2KYMA 4PJNA 5GAN6 3URGA 4EIKA 2CH4W 3M0SA 2HD0A 4HCBA 1UEBA 3NMZC 4HT9A 4F14A 2COYA 4HVWA 3MP8A 2JM9A 5GLFA 1G83A 4M4ZA 1OULA 1YNZA 1ZA1B 1QDNA 2CP5A 5CKEA 4XTXA 1ZSZC 1K9MU 4C0DC 4XU1A 1O54A 3I56A 2KY9A 2DVEA 1VQOA 1KK7A 3CCEQ 4PJOA 3EFSA 1AWXA 4ZN3A 5CR2A 1WHHA 2YHTA 1K9AA 2E5QA 1UTIA 3CMEQ 3EH1A 3VUZA 1OPLA 5D6YA 4X1VA 3HFNA 3H0IA 1YJNA 4M77B 4L5GA 2CDTA 1JJ2A 2QA4Q 1ABOA 3EHRA 2KYBA 4J5YA 3J7AF 2DM1A 4ZGDB 5LJ5d 1PKTA 4QKUA 2XG8D 3VV0A 3EG9B 1OOTA 4O5VA 1SHFA 5CVIA 4RV0A 1E6HA 5GMKh 1D1CA 4FYWB 2DTOA 3MHXA 5FRNA 5GAN4 5GMKj 4OB2B 1E32A 2CSIA 2CREA 2EQMA 3UPUA 1W2BS 2BZXA 4RTWA 2CZ0B 3PFSA 4JJBA 2O4XA 4ESRA 2K5FA 2Q18X 2R5MA 3C4SA 4MZPA 1BI3A 1VIEA 4B9WA 1NJIR 3TCJA 1FXXA 1Y71A 2DXTA 2L0AA 4N0AC 3LWIA 1ZC1A 1CZ5A 1G3TA 2LP5A 4DBRA 1NJIC 1M2VA 5FLXE 1HK9A 2O88A 2ZPBB 3LGFA 1HXDA 2DMOA 4LD9K 3X20B 3SWNC 2CYZB 3PGGA 1NPPA 2L3QA 2FZKB 2XD0A 2YT6A 3JB9J 4XK8E 2P4TA 1LJOA 3TREA 3M0UA 3PT9A 1YCSB 4PNOA 1V1CA 2DILA 5FWBA 2QQAA 4C8QB 1NBEB 4PJOB 2HMAA 4J9GA 2E1HA 3EG0A 1UJYA 3VKIA 4JRQA 3QG1A 3I55A 1OV3A 2QTXA 3CCSQ 2MCNA 4C0FA 2OTJA 1VA7A 3I56T 4Q5WA 4WCIA 2JS2A 4KT0E 4J9BA 1VQNA 2OAWA 4M7AA 3WVDB 5C1BA 1BYMA 2RI5A 2YUNA 1CSKA 4J7FA 1YJNT 1K8AR 1JJ2S 3MJXA 2XIDA 1OZ3A 2K7AA 1K8AC 1QVPA 3CCRQ 3VS3A 4C0GA 2RI2A 2X9HA 2O4XB 1GRIA 2DBMA 2DLPA 2YSQA 2KAFA 1Y96A 5KCHA 2LMJA 4J8OA 1BBZA 1GCPA 3V7CA 4LDUA 1WJQA 2MK5A 3ZBDA 1IHVA 5J39A 4WF2A 2LW6A 3A8MB 1ZHIA 3BY7A 3O8VA 4GLKA 4OF1A 4XAXB 2DTHA 2HQEA 3MP1A 5EQJB 2VXEA 4EMHA 4XU0A 2RJCA 4C8QE 1N8RU 1N5ZA 3SEMA 2LDMA 5GAMh 1FMKA 2LQNA 2XKOC 4BY6C 2KRSA 3JAME 5GAMj 2Q19X 4OMNA 3SB2A 4CC2A 1WQ7A 1UHCA 1GBRA 5CIUA 3ZJTA 3HRTA 3QZ5B 3FDRA 3M55A 1VQLQ 4JUVA 4GY5A 1YJ9A 1DJ7B 2RK1A 2E12A 4BI4A 5L23A 2B86A 3M57A 5KYUA 2PQWA 1K9MR 3VS5A 5CKFA 4NL2A 4IIMA 2IIMA 3NTKA 3G4SA 1MNEA 1OX9A 5GAN5 2JTMA 3NPFA 1K9MC 1KC8U 3CCLT 4OP0A 1X01A 2O2OA 1VQNT 3HSBA 2M0YA 5ERGB 4PLLA 4LN2A 1B3QA 4EPCA 4Z88A 3JSCA 3OW2P 2C0TA 5KH6A 2E41A 2IVWA 1MUZA 1LOJA 2VGNA 2CUDA 2Y4YA 1WHKA 4M7DC 3MEWA 2LRQA 5GAOm 3OYKA 2GTOA 4K11A 4FW1A 3FJPA 1X6GA 4F7UF 2BZYA 2DERA 4UC4A 4E7IA 4Z02A 3U23A 1N27A 1D0ZA 2P4RA 1NE8A 2D6FA 2RI3A 2KGTA 1AVZC 4E7KA 3OBWA 3NTIA 2K57A 1VQ8Q 1RLPC 1Q95G 5EC7A 3L2WA 2ZZDA 4CC3A 1RL2A 2JZ2A 4M75D 3FPTA 4VUBA 1SPKA 3CQTA 2EJ9A 2LJ0A 2PWYA 3CD6A 1TUGB 4OGEA 1AEYA 2D0NA 1EFNA 2ABLA 3ZL7C 3ASKA 2YRDA 1LCKA 4J6WA 1GFDA 3OSVA 1M30A 1WFWA 2FZCB 4C92F 4HCCA 4N4HA 1G2BA 2QA4T 2X4JA 3CC4A 1I9GA 5KYUB 2BIVA 3SHWA 3OYYA 5FROA 3OYJA 2V1RA 5GMKm 2L3RA 1NEBA 4E7HA 2E10A 3LX7A 3NTHA 4Z89A 3KUFA 1SKUB 2E4HA 4KH0B 2H3JA 2EKOA 1WXTA 5FU6B 3G4ST 5IN1A 1JEGA 4RMOA 1YIJA 3QQ7A 3LYIA 5FU7B 4JS5A 5GAOl 1YITA 3QYGB 2DXCA 2ED0A 3CC2Q 1JB0E 2YLBA 3RMSA 1XOVA 4XQ3A 1VYVA 4HKEA 3ZGZA 2RQUA 2X4XA 4OMLA 4F16A 4P5NA 2ED1A 3OA6A 1NYGA 3UF4A 5GANj 2RA2A 5EPPA 2MOXA 4F7UE 4M7DA 3EGUA 1VQPA 3CCJQ 2KR3A 3FEOA 2ZPEB 2XDPA 3V7SA 3JCMg 4A53A 3OYAA 2NLUA 5D6XA 4M78A 2MWOA 2DL3A 2J06A 2DAQA 4ZTFA 2M1HA 2VB6A 4XTVA 3A1PA 2WACA 5EG2A 3BW1A 1ZBJA 2JTFA 1YI2A 2PNIA 4FSSA 2M9UA 1LNXA 2GTJA 1X69A 2J6OA 4N4GA 3M4GA 2EYXA 3CD6T 4EDUA 5GAN7 3G6EA 2HBWA 1RUWA 1YP5A 4C92E 1P92A 4LDWA 4GLMA 1XTDA 1NPRA 5GMKl 1BCMA 3PMIA 2JMCA 2YLCA 3QDRB 4Y91A 3BQBA 3CC7A 2YRCA 2QEXA 3CC4T 4OMFB 4E7LA 1BU1A 2ATCB 4RTTA 1NZ9A 2H3EB 3QJ6A 5LJ5h 1YFNA 2D8HA 4BE2A 5LJ5j 2SEMA 4DA4A 2DIGA 1ZSGA 3RKYA 3M58A 4IUUA 4R55A 4ME7A 2QGFB 2PVDB 1YIJT 1B34A 3CCMQ 1GCQC 1LPLA 3J80E 3M0QA 1UGPB 1BIAA 3OYMA 4RCCA 1YITT 1QLYA 3R6NA 3M5AA 2RD1A 2F1LA 3META 5FWCA 4JS4A 5AYFA 2KRNA 2RJDA 2HZYA 2RHXA 2L2PA 2HAXA 4M75A 2BE7D 2EYQA 1NJIU 4FT2A 4QVCA 2CP7A 2MI6A 3LH0A 1VQ7Q 1PWTA 1MV0B 1VQPT 4LE9A 5CCBA 2VUBA 1VQOQ 2VVKA 3LWHA 2D0QB 4HCKA 2AIRB 4L6V5 2JMAA 1S3SA 4KBMB 3HHTB 2PVGB 1YI2T 1U5SA 1ZUKA 4HCZA 1K0XA 2HNIA 5LJ3j 1ZUUA 4KLNA 3VS4A 1S1NA 2LNVA 1BIBA 4HVUA 2VC8A 5FTJA 1IZ6A 3DKMA 2EIFA 5GMKe 3CC7T 3NFCA 4AFZC 1HJDA 1CR5A 4IIOA 1NYFA 5KYNA 3MCAB 4C8QC 1KQSP 2DYBA 1TXQA 3RKWA 1H641 1SSFA 2YDLA 3H9NA 3Q1JA 1B34B 4II1A 1MMDA 3PMTA 3QWXX 2X3XD 1AWJA 2LX7A 1YJWQ 1UGSB 2LC4A 1RABB 2VKNA 5A2QE 5FTMA 2QI2A 3HRSA 4ATOA 5C18A 2DL8A 2V8JA 4A4EA 4M75B 2ESWA 2Q1AX 4D8DA 3CMAQ 1T0HA 4M7AD 1PNJA 2BZ8A 1WIEA 2KNBB 4OGCA 3OYNA 1PSFA 2DO3A 1KD1C 2E3IA 2L8DA 3VS6A 3TSZA 4DQ2A 2A28A 2HSPA 3REAB 2LVMA 4ZNXA 3GOXA 1IGQA 4XU2A 3VS2A 2OTJQ 4O6JA 3RR6A 4DOWA 1AWWA 4NOYA 5GANg 2EJFA 3GNGA 1VQMA 2ZPFB 2XDDA 4KGZB 3VS1A 3OYGA 1A0NB 2K5LA 3OB9A 1SG5A 4D8KA 1OEBA 1IREB 2RH2A 1U06A 1TG0A 2E64A 3JCMe 2D1XA 4M7AG 4EMKC 4DOVA 5CKDA 2KQWA 4FYXB 3UWNA 3CCVQ 3BE3A 3UA7A 3C0CA 2HL3A 2DXUA 1QCFA 2KK4A 2CT4A 1CKBA 2RHIA 2DZ9A 4LD6A 3X25B 3OYCA 2JN0A 2LQWA 4JRIA 2VXFA 2EQIA 5M9OA 1O9SA 2BUDA 4Z8AA 1WI7A 2EFIA 1VUBA 2JUFA 4OMPA 2EQKA 2C0OA 2P0KA 3GP8A 2O01E 1M90R 4BD3A 1KQSA 5GAMe 1I0CA 4MDWA 2GBQA 3HP9A
chains in the Genus database with same CATH topology
2LQKA 2EQJA 2LT1A 2BKDN 3FB9A 2GFAA 1JRIA 4M75C 4ZGEB 3CPWS 4KO8A 3QZ5B 1M90C 2JV2A 3FDRA 3M55A 4JUVA 3R6OA 2DZCA 3PIOA 4RG8A 3QSUA 2R57A 3QUIA 4GY5A 2XI9A 2M16A 1QW1A 4MMLA 5GANh 1YJ9A 5A0GA 5GAOp 1FX7A 1DJ7B 2RK1A 2E12A 5I2MA 4BI4A 1QVGA 3JB9H 1O75A 3JB9D 4M77D 3M57A 1K73U 1N9RA 1WQWA 2CKKA 4L59A 4QQ6A 4XTYA 3RKXA 3CCJA 4V2SA 2YUJA 1KG1A 2PQWA 3M54A 2V8IA 5C0MA 3L42A 4NL2A 5CKFA 1MHNA 3L2RA 3G4SA 3NTKA 4C8QF 2FL7A 1VQ9A 4BACA 1R7RA 2YVLA 5GAN5 1MGQA 2JTMA 3E19A 1ZBXA 4BUGA 5CCAA 3CXCA 3BDLA 1K9MC 2E6ZA 3CCQA 1KC8U 4AS1A 2X35A 3CCLT 4OP0A 1X01A 4JJNK 2VYTA 5GANf 4CQNA 4QQGA 1VQNT 2GF7A 3HSBA 3EFRA 4BI8B 2FHDA 3ZFJA 5CD1A 2DK3A 1VQ8T 2WSFE 1KQ1A 5ERGB 2DEQA 3L2VA 1VQMT 3J81E 4PLLA 4EPCA 4HT8A 5FTKA 3INZA 3G71T 3JSCA 2QXFA 4FM4B 4XTUA 2KMTA 2JNGA 1BI2A 5KH6A 1Q81C 2E41A 2IVWA 1LOJA 2VGNA 4M77E 1M1FA 2K2VA 2Y4YA 4QW2A 3V8LA 1VQ5A 2OTLA 1KQ2A 4M7DC 3MEWA 4E7JA 2LRQA 3L2UA 5GAOm 3S3NA 3OYKA 3HU3A 3QC8A 5GAMd 1N8RC 2MWPA 4IUVA 1WJSA 3FJPA 3GIBA 2RB6A 1XNIA 4N4IA 2XK0A 4F7UF 4M7DF 1S72T 3MB5A 4UC4A 4E7IA 2V8KA 3DB3A 4Z02A 4OB1B 1N27A 1VQ4A 3HU2A 3QHSA 3PNWC 3HU1A 1NE8A 1EIFA 3C95A 4IURA 4OVAA 2RI3A 2D6FA 5LJ3g 3CBMA 5DY9A 3UT1A 3CCUA 2QQSA 4QVDA 3OBWA 4E7KA 4M78F 3NTIA 3QXEB 4M77G 4R56A 3JB9G 1KHIA 2K57A 4BB7A 3AHUA 3F70A 3M4YA 3PTAA 3RESA 1V29B 5CQYA 3S3MA 4C5HA 5GANd 3L2WA 2ZZDA 1RL2A 2JZ2A 3SD4A 5GMKi 4M75D 3FPTA 4PLIA 3OYLA 4VUBA 3JCMX 1R8OB 4BE0A 2EJ9A 2PWYA 3OS0A 4MMKA 1K73C 3CD6A 3ER0A 4M77F 4OGEA 3DB4A 1D3BB 3MEAA 1QP2A 4CRIA 3JRZA 4C92C 2ZPHB 4C8QD 2PVOB 4PJOC 5FU6C 4PJOD 3ASKA 1G3SA 2P0PA 3CCMA 3S3OA 4J6WA 4E47A 3HRUA 1KQSS 3OSVA 3TEEA 4C92F 2DIQA 4BI3A 5LJ5f 4HCCA 4N4HA 1KC8C 4EMGA 1VQKT 2QA4T 2X4JA 3CC4A 3QBYA 3RMQA 1I9GA 1WJRA 3CC2T 1PSEA 4D6WA 2Y90A 3SFMA 3E9GA 4PL6A 2BIVA 2FYKA 2X4WA 3WXMB 1I5LA 4M75E 3OYYA 1QCSA 5FROA 3ZJUA 3DLMA 4MZTA 3OYJA 2MAMA 1QVGS 2LCLA 2C06A 5GMKm 2B8AA 1M5Q1 2PJHB 1VQ7A 2L3RA 4E7HA 2E10A 4A4FA 3LX7A 3QZ9B 5J3BA 5DM7R 3NTHA 4IUQA 3CCJT 3KUFA 2KSSA 3LGLA 4C8QA 1N9SA 2EWNA 4PJOE 4X34A 2LQ8A 2H3JA 2EKOA 4M7DD 2ZCFB 4N0AA 5FU6B 3G4ST 2RHZA 3E9FA 3OYDA 5IN1A 4RG2A 3JB9I 4M7AC 4RMOA 1VQ9T 3CXCS 3CMEA 3RERA 1YIJA 3QQ7A 3LYIA 5FU7B 4C5GA 4JS5A 3GF5A 5GAOl 3OBYA 3CCQT 1YITA 4LDXA 3QYGB 5LJ5g 4M78D 5A0LA 1OYXA 3VUBA 2QA4A 2XICA 2DXCA 1UGQB 2LT4A 1JB0E 3SWNA 5I21A 2YLBA 3RMSA 1XOVA 2P0QA 2LTOA 4XQ3A 4HKEA 3P8BB 4C8QG 4NL3A 3ZGZA 4PJOG 5FRMA 2X4XA 3TU4K 3A5ZB 4J7IA 5LJ3h 2E65A 1BI1A 4IUPA 4P5NA 1VQ5T 2OTLT 3OA6A 3P8HA 2DD5A 4M75F 4PKCC 2XHCA 2K4YA 5GANj 2RA2A 5EPPA 4F7UE 4M7DE 4JRPA 2CGHA 1VQPA 4M7DA 4CI0C 3G6ET 3C12A 5CAIA 5GANe 3FEOA 3A8GB 2A7YA 2ZPEB 3JCMc 1JBMA 2XDPA 3HKSA 4M7AB 3V7SA 3FC3A 3JCMg 4A53A 4PJOF 3OYAA 2NLUA 2R5AA 1VQ4T 3GPLA 2E70A 4C92D 4M78E 2D9TA 5D6XA 4M78A 4QVZA 2RO0A 2QEXT 5LJ3f 3UDCA 3CCUT 2MWOA 4ZTFA 2DAQA 3ME9A 2M1HA 4XTVA 4A54A 2WACA 5GAN8 4IUTA 3FLGA 4A4GA 3QQ8A 5EG2A 1ZQ1A 1K8AU 1I81A 3BW1A 4F7UG 3OYEA 4M7DG 1Q86C 2JTFA 1CZ4A 1M1KU 1YI2A 2WSCE 3H6ZA 3M9QA 2LCCA 2M9UA 2L5QA 4X9CA 3CF2A 1LNXA 3JCMV 3QPHA 1G3YA 3C94A 3G7ZA 3QO3A 5DYIA 2VV5A 4M77A 1WGSA 1Y96B 3OYHA 4N4GA 1YJWA 2LX9A 3OSSC 1Q82U 4M78G 3LW5E 3M4GA 3DLLA 2GQVA 2R58A 3CD6T 2F69A 4XU3A 4EDUA 5GAN7 3SDZA 2XU8A 1WNLA 4YTLA 4ELYC 3L1AA 3VYGA 3G6EA 5FTLA 3BFMA 1Q7YU 4TVRA 3MO8A 4C92E 3TIWA 1P92A 4JDSA 4LDWA 3CCMT 2RM4A 5HKCA 3OYFA 1XQHA 1XTDA 1NPRA 2EAYA 4MZMA 5GMKl 3PMIA 1W2BA 2YLCA 3QDRB 4Y91A 3CMAA 4EMKA 2RK2A 3CC7A 3BQBA 1RI0A 4LDVA 2QEXA 2FB7A 4C5EA 2QQRA 3CC4T 2YRVA 3FPUA 3FIFA 2Q1DX 1G5VA 2G3RA 2QDYB 4OMFB 5LJ3d 4E7LA 4KDLA 1Y7XA 2EJGA 2EQUA 2MMPA 4OB3B 3V8JA 3QWZA 1NZ9A 5IAYA 4KUIA 2DJZA 2K3XA 3X26B 3QJ6A 5LJ5h 1W4SA 1VIFA 3GLXA 4ZTJA 4C92G 4BE2A 1WLFA 5LJ5j 4C0ZA 3CCSA 4DA4A 1VQ7T 2DIGA 3RKYA 3M58A 4X9DA 5DYGA 4IUUA 1VQOT 3CCET 2ZGWA 3CBOA 4JLGA 1X75C 4R55A 4ME7A 5CCXA 1YJ9T 2RJFA 2JOYA 2PVDB 3CMET 1YIJT 1B34A 2Y4XA 3L2ZA 5CQXA 4M7AE 3J80E 2I2LA 1UGPB 2WSEE 4Y28E 1BIAA 5FU7C 4RCCA 3URGA 5GAN6 3OYMA 1YITT 2HD0A 4HCBA 1UEBA 5KCOA 1VQOA 3M5AA 3H8ZA 2RD1A 3META 3WVEB 1KHCA 3M56A 4JS4A 4HT9A 4FIBA 1FWZA 2RJDA 2PU9B 5AYFA 4BE1A 4IKFA 3JCMh 3CBPA 3A8OB 2RHXA 5CKBA 3KXTA 5KE3A 3MP8A 3JCMQ 2HAXA 2RJEA 4M75A 1M1KC 3CCRA 5GLFA 2EYQA 3M59A 1NJIU 4FT2A 4QVCA 5GAN3 2MI6A 3QYHB 3LH0A 1I8FA 1QDNA 4ARCA 3MEVA 3JCMW 5CKEA 4XTXA 1VQPT 1K9MU 4C0DC 3OMCA 5CCBA 4XU1A 3CCVA 1O54A 3I56A 3LHDA 2KY9A 1BI0A 2DKGA 2DVEA 2VUBA 5GAOq 3LWHA 3CCEA 3EFSA 5CR2A 4ZN3A 2DXBA 4PJOA 2CS7A 2YHTA 3JCMJ 2D0QB 2E5QA 3N5BB 3JCMf 2K5IA 4L6V5 4M75G 3VUZA 1UB4A 1S3SA 2XDBA 2HBPA 5D6YA 3HFNA 4KBMB 4M77B 1YJNA 1Q81U 4L5GA 4M7AF 2M0OA 1JJ2A 3HHTB 4HA8A 2RHUA 4J5YA 4JLIA 3J7AF 4ZGDB 5LJ5d 2PVGB 1KD1U 3MEUA 3OY9A 1YI2T 3VYHB 3CCLA 4HCZA 1M9SA 3CC2A 3HPWA 1U1TA 1X6OA 2GFUA 2HNIA 3P8DA 2XG8D 3VV0A 5LJ3j 3JCMP 1YJWT 4FSXA 4KLNA 2VGMA 4EMKB 4ZGJB 4O5VA 2B25A 5D6WA 4C0DB 4F7UA 5LJ3e 5CVIA 4RV0A 2A3LA 5I2SA 2LNVA 1AHJB 5A0DA 5GMKh 1I4K1 3OYBA 1BIBA 2VC8A 2DTOA 2PUOB 3E1SA 4XTWA 3MHXA 5FRNA 5GAN4 5GMKj 4OB2B 1E32A 5FTJA 1D3BA 3UPUA 1IZ6A 2EQMA 3DKMA 2RHYA 4OB0B 4FL6A 1W2BS 3OW2A 3FRNA 2EIFA 4LDYA 3CMAT 5GMKe 5C6SA 4RCBA 3CC7T 4B9XA 2CZ0B 3PFSA 5HY6A 2O4XA 5LL6S 2K5FA 1VQLA 3NFCA 3VJPA 4C5IA 3JCMd 1CR5A 2Q18X 2R5MA 3C4SA 2QQBA 1UGRB 4MZPA 5GAMf 1BI3A 1VIEA 3LGAA 4B9WA 3MCAB 2MM0A 4C8QC 4KUDK 3OQ5A 3TCJA 3RKWA 1FXXA 1Y71A 2DXTA 1H641 3LLRA 4N0AC 3LWIA 1ZC1A 1CZ5A 2JVVA 3I55T 1YHQA 1G3TA 1SSFA 3Q1JA 1B34B 4II1A 3CCST 3PMTA 2CZ7B 1NJIC 5FLXE 4QQDA 4BY6B 2FVUA 1N6AA 5GAN2 1UGSB 2OTJT 1HK9A 2ZPBB 2DPPB 2F5KA 2E6NA 2LC4A 3LGFA 4BDYA 1QVFA 1VQ6T 1HXDA 4LD9K 4BDZA 3MP6A 4FT4A 5A2QE 5FTMA 3X20B 2QI2A 4J6XA 3HRSA 3GNFB 3SWNC 4ATOA 2CYZB 3PGGA 5C18A 1NPPA 2ZPGB 2L89A 3RUXA 4C92A 2V8JA 4A4EA 3M53A 4M75B 2KVQG 2Q1AX 2XD0A 2Q1CX 3EAEA 3JB9J 4XK8E 3CPWA 2P4TA 1LJOA 4M7AD 3TREA 3V8KA 2PUKB 3PT9A 1BKBA 5GAMg 1YCYA 4PNOA 2QQAA 4C8QB 1H3ZA 5L8RE 4OGCA 4NS5A 3HL8A 1PSFA 2DO3A 3OYNA 1KD1C 4PJOB 2L8DA 3KBGA 3CCRT 2E1HA 3CPFA 3JCMb 2AHJB 3OS2A 3VKIA 4XTZA 4DQ2A 4JRQA 3QG1A 2LVMA 3I55A 2QTXA 3GOXA 5CO7A 2MM2A 4M78C 3QIIA 1WPYA 5DLQE 4XU2A 3A8HB 4C0FA 5HK3A 3CCVT 1M4ZA 4J83A 1M1GA 5LJ5e 3I56T 2OTJA 4O6JA 1VQ6A 4DOWA 3FPRA 4Q5WA 3L2QA 3SWNB 4KT0E 4NOYA 2KDSA 4RKUE 5GANg 2HQXA 3PIPA 4ARIA 1VQNA 2OAUA 2EJFA 4ELZC 1VQ8A 1M90U 3OYIA 4M7AA 3WVDB 5C1BA 5GAOn 3GNGA 1VQMA 1BYMA 2RI5A 3OS5A 4JRKA 2ZPFB 4J7FA 3ZEHA 2XDDA 1YJNT 1OI1A 1JJ2S 3G71A 4M77C 3OMGA 2XIDA 1OZ3A 3OYGA 1TH7A 2K5LA 3QKJA 4F7UB 4M7DB 3OB9A 1IREB 3X28B 1Y07A 1K8AC 2RH2A 1QVPA 3JB9F 2E64A 5GAOr 4KDIA 3BDUA 3JCMe 2QQ9A 4C0GA 2RI2A 4M78B 1S72A 2O4XB 4M7AG 4EMKC 4DOVA 5CKDA 4J6YA 5IT9E 1Q82C 2KQWA 2KAFA 1Y96A 5KCHA 3UWNA 4MDXA 4J8OA 1YBYA 1U8RA 3X24B 3V7CA 5J26A 3QJYA 3OW2S 4LDUA 1Q7YC 1WJQA 4A4KA 2DXUA 3ZBDA 4A4HA 5J39A 4WF2A 1Q86U 3ZJVA 1VQLT 3S6WA 4ZN1A 2KK4A 2LW6A 1QP3A 3V7RA 3A8MB 4FU6A 1ZHIA 3BY7A 2F5TX 3O8VA 4GLKA 2RHIA 2ZPIB 4OF1A 3HFOA 4XAXB 2DZ9A 2DTHA 4LD6A 3X25B 2HQEA 5HK0A 3OYCA 2JN0A 2CZ1B 3MP1A 2VXEA 4JRIA 4EMHA 5EQJB 2VXFA 5M9OA 4XU0A 5FTNA 2RJCA 1O9SA 4C8QE 3OS1A 1N8RU 1GXIE 2BUDA 2IG0A 4AQ7A 1YHQT 2X4YA 2DTIA 2K3YA 3A8LB 3CEYA 4C92B 2LDMA 2EFIA 3T9NA 2DD4A 1VUBA 2JUFA 5DLOA 2EQKA 5GAMh 2GCXA 1QVFS 5B6CA 3RIRA 2XKOC 4BY6C 3JAME 3VU3C 2CZ6B 5GAMj 2Q19X 2P0KA 3GP8A 2O01E 2MF2A 1U1SA 4KULA 1G3WA 1KQSA 4BD3A 4KODA 3SB2A 5GAMe 5CK9A 4MDWA 1M8VA 1WQ7A 3ZJTA 5CIUA 1VQKA 3HP9A 3HRTA 1OZ2A 5CKHA 5KE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRO A;  4BDZ A;  2DIG A;  2EQJ A;  2BKD N;  3DLM A;  3MP6 A;  2GFA A;  3OYJ A;  3FDR A;  4IUU A;  2L89 A;  2B8A A;  2L3R A;  4A4E A;  4E7H A;  4A4F A;  2R57 A;  3LX7 A;  4GY5 A;  3NTH A;  4IUQ A;  2M16 A;  3KUF A;  3LGL A;  2RJF A;  3EAE A;  4X34 A;  2EKO A;  2RHZ A;  3E9F A;  3OYD A;  2CKK A;  4L59 A;  4QQ6 A;  4RG2 A;  5IN1 A;  3OYM A;  1H3Z A;  2PQW A;  5KCO A;  4NS5 A;  3OYN A;  3H8Z A;  3LYI A;  3L42 A;  5C0M A;  3L2R A;  1MHN A;  3MET A;  4C5G A;  2L8D A;  1KHC A;  3NTK A;  2RJD A;  3OS2 A;  4BE1 A;  4IKF A;  2LVM A;  1OYX A;  2RHX A;  4BAC A;  5KE3 A;  3MP8 A;  3GOX A;  2RJE A;  3BDL A;  2X35 A;  3QII A;  2LTO A;  2VYT A;  4QQG A;  2GF7 A;  5FRM A;  2X4X A;  2FHD A;  3LH0 A;  4Q5W A;  3L2Q A;  3MEV A;  4IUP A;  3L2V A;  3OMC A;  4PLL A;  2HQX A;  3OA6 A;  3P8H A;  5KH6 A;  3OYI A;  2E5Q A;  2RI5 A;  4QW2 A;  3ZEH A;  1OI1 A;  3MEW A;  2LRQ A;  3FEO A;  3L2U A;  4E7J A;  3OYK A;  3OMG A;  3S3N A;  1OZ3 A;  3OYG A;  2XDP A;  2MWP A;  3QKJ A;  4IUV A;  5D6Y A;  1WJS A;  3OB9 A;  3OYA A;  3FC3 A;  2R5A A;  2NLU A;  1XNI A;  5D6X A;  2D9T A;  2M0O A;  2XK0 A;  4N4I A;  4QVZ A;  4UC4 A;  2RHU A;  2RO0 A;  4E7I A;  3DB3 A;  4Z02 A;  1N27 A;  2MWO A;  3MEU A;  2DAQ A;  3ME9 A;  2M1H A;  3PNW C;  3OY9 A;  4ZTF A;  2RI2 A;  2WAC A;  4HCZ A;  4IUR A;  4OVA A;  2RI3 A;  3FLG A;  4IUT A;  4A4G A;  2O4X B;  3UT1 A;  2QQS A;  3OYE A;  2GFU A;  4E7K A;  2JTF A;  3NTI A;  3P8D A;  5KCH A;  3UWN A;  3H6Z A;  3M9Q A;  2LCC A;  3F70 A;  5D6W A;  5J26 A;  3S3M A;  1WJQ A;  4C5H A;  1WGS A;  3OYB A;  3OYH A;  4N4G A;  4A4H A;  3L2W A;  2JZ2 A;  5J39 A;  3SD4 A;  5FRN A;  2R58 A;  3S6W A;  4PLI A;  3OYL A;  2EQM A;  2RHY A;  4EDU A;  4FL6 A;  4FU6 A;  3O8V A;  4BE0 A;  2RHI A;  5C6S A;  3OS0 A;  4B9X A;  3PFS A;  4LD6 A;  2O4X A;  3MO8 A;  2HQE A;  3OYC A;  3MP1 A;  3DB4 A;  4C5I A;  3MEA A;  3OYF A;  2R5M A;  3C4S A;  4CRI A;  3PMI A;  5M9O A;  2RJC A;  3OS1 A;  2BUD A;  1RI0 A;  2IG0 A;  3ASK A;  4B9W A;  4BE2 A;  2X4Y A;  3CEY A;  2K3Y A;  2QQR A;  3OQ5 A;  4C5E A;  2YRV A;  2LDM A;  3S3O A;  2EFI A;  3LLR A;  2DIQ A;  2EQK A;  2G3R A;  1G5V A;  4N4H A;  4E7L A;  1SSF A;  3Q1J A;  3QBY A;  4II1 A;  2EQU A;  1WJR A;  2P0K A;  3PMT A;  4QQD A;  5IAY A;  3E9G A;  4PL6 A;  2K3X A;  4BD3 A;  3QJ6 A;  2BIV A;  4ZTJ A;  3LGF A;  2F5K A;  2X4W A;  2E6N A;  5CIU A;  4BDY A;  1OZ2 A;  5KE2 A; 
#chains in the Genus database with same CATH topology
 2EQJ A;  1M27 C;  2BKD N;  4KO8 A;  4ZGE B;  1M90 C;  2HQH A;  2JV2 A;  3R6O A;  3QUI A;  2M16 A;  1QW1 A;  4MML A;  4HVV A;  5A0G A;  1PG5 B;  1YJ9 Q;  1OPK A;  1FX7 A;  3JB9 H;  2K6D A;  3JB9 D;  1N9R A;  2YUJ A;  1SF9 A;  1YHQ Q;  1M3C A;  5C0M A;  3L2R A;  1MHN A;  4C8Q F;  1G8X A;  1VQ9 A;  5KYY A;  2F2X A;  4BAC A;  2YVL A;  4BUG A;  5CCA A;  3BDL A;  4E7Z A;  3CCQ A;  2DET A;  4CQN A;  4QQG A;  1UE9 A;  1YN8 A;  2GF7 A;  2E3H A;  3L2V A;  1VQM T;  3AT1 B;  2QXF A;  4XTU A;  4JJC A;  4RTU A;  4M77 E;  1M1F A;  2K2V A;  2HDA A;  1VQ5 A;  3S3N A;  5KYX A;  1WJS A;  3GIB A;  1XNI A;  2XK0 A;  4OMM A;  3MB5 A;  2NWM A;  4OB1 B;  4IUR A;  1EIF A;  2COZ A;  4OVA A;  1VQ6 Q;  1ZSZ A;  5LJ3 g;  5DY9 A;  2QQS A;  3M0T A;  4QVD A;  3JB9 G;  3CCL A;  1Y0M A;  4Y92 A;  1KHI A;  2COW A;  4BB7 A;  3AHU A;  3PTA A;  2LZ6 B;  1OX8 A;  2FPF A;  1K73 R;  1RI9 A;  3G71 Q;  1W70 A;  9ATC B;  1SSH A;  2LNH B;  1H3H A;  1R8O B;  3CPW P;  4BE0 A;  1K73 C;  3ER0 A;  1T0J A;  4C92 C;  2PVO B;  5FU6 C;  2Z0W A;  4F17 A;  1S72 Q;  2DRK A;  3S3O A;  4E47 A;  1KQS S;  3RMQ A;  1PSE A;  2Y90 A;  3E9G A;  2A37 A;  2FYK A;  3ZJU A;  1M2V B;  4MZT A;  2DX1 A;  2MAM A;  5D7U A;  1UHF A;  4LUE A;  5I22 A;  4IUQ A;  2KSS A;  4ORZ A;  2EWN A;  4PJO E;  1RAI B;  3VS0 A;  4M7D D;  1I5O B;  1UEC A;  2ZCF B;  4N0A A;  2RHZ A;  3E9F A;  1VQ9 T;  4FW2 A;  1B7T A;  3CME A;  3GF5 A;  3CCQ T;  3OBY A;  4M78 D;  1OYX A;  2QA4 A;  1VQK Q;  3SWN A;  2DYI A;  1AT1 B;  5KYX B;  1C1A A;  2P0Q A;  2LTO A;  4NL3 A;  4KH1 B;  2NUZ A;  4J7I A;  3VRZ A;  2FPE A;  4IUP A;  2NYS A;  1VQ5 T;  1ZSZ B;  2CGH A;  2HKN A;  5GAN e;  3A8G B;  2A7Y A;  1GL5 A;  2V1Q A;  1JBM A;  4M7A B;  2J05 A;  3FC3 A;  1W6X A;  3GPL A;  1Z9Z A;  2D9T A;  4E2F B;  2YXY A;  3UDC A;  2EGE A;  3ME9 A;  4OMO A;  4A54 A;  1T3L A;  5GAN 8;  4AFS C;  4M7D G;  3H6Z A;  3I9Q A;  4X9C A;  4KGX B;  3JCM V;  1G3Y A;  3C94 A;  3MKD A;  1Y96 B;  2OTL Q;  4M78 G;  3LW5 E;  1BCO A;  4XU3 A;  1ZLM A;  2M02 A;  1QQJ A;  3G6E Q;  4YTL A;  2DL5 A;  3BFM A;  3RBB B;  1Q7Y U;  4TVR A;  4AT1 B;  4MZM A;  4LXC A;  1VQ4 Q;  1RI0 A;  2FB7 A;  2QEX Q;  3CCU Q;  3FPU A;  3CXC P;  2G3R A;  3EGD A;  2EQU A;  3QWZ A;  4KUI A;  2DJZ A;  3X26 B;  3GLX A;  1AZE A;  3CCS A;  3EFO A;  5DYG A;  3CCE T;  2ZGW A;  4JLG A;  2MIO A;  4KRT A;  5CCX A;  2RJF A;  2JOY A;  3CME T;  5CQX A;  2Y4X A;  1HYO A;  2DL7 A;  2KXC A;  2I2L A;  4M7A E;  2WSE E;  2X3W D;  2W0Z A;  5KCO A;  2RPN A;  1KHC A;  3M56 A;  4BE1 A;  2PU9 B;  4IKF A;  1NLP C;  4RTX A;  5KE3 A;  2GNC A;  2J6K A;  1D1A A;  3E2U A;  3CCR A;  1UGV A;  2JT4 A;  3QYH B;  3MEV A;  3JCM W;  3OMC A;  1BI0 A;  5GAO q;  3PE0 A;  1IB8 A;  2DXB A;  2CS7 A;  3JCM f;  2K5I A;  2QDL A;  1NEG A;  4M75 G;  1UB4 A;  2NUP A;  2DVJ A;  1Q81 U;  2QGG A;  1AWO A;  1I1J A;  3QDF A;  2EGC A;  1KD1 U;  1KJW A;  3VYH B;  1WHG A;  1M9S A;  2GFU A;  1X6O A;  2FO0 A;  4FSX A;  2VGM A;  4ZGJ B;  2B25 A;  5IXF A;  1RLQ C;  5LJ3 e;  5I2S A;  1AHJ B;  5A0D A;  4J9F A;  2FPD A;  4XTW A;  1D3B A;  2RHY A;  4OB0 B;  3OW2 A;  2ZAE A;  5HY6 A;  4B9X A;  1PHT A;  1VQL A;  1MND A;  3VJP A;  3JCM d;  1UGR B;  5GAM f;  3I35 A;  1RAF B;  4KUD K;  2C0I A;  3LLR A;  3EGX A;  2QG9 B;  3CCS T;  2FEI A;  4QQD A;  4BY6 B;  1N6A A;  2EPD A;  2A08 A;  2DPP B;  2E6N A;  4BDY A;  2HCK A;  1VQ6 T;  2BE9 B;  2ECZ A;  2AT1 B;  4BDZ A;  4FT4 A;  1QVG P;  3GNF B;  2ZPG B;  2L89 A;  2QAS A;  3RUX A;  2KVQ G;  2Q1C X;  1QKW A;  4HXJ A;  1SEM A;  5GAM g;  1YCY A;  5L8R E;  2DEU A;  3HL8 A;  1WZO A;  3CCR T;  3CPF A;  3JCM b;  2AHJ B;  2L3S A;  3OS2 A;  4XTZ A;  4J9I A;  5CO7 A;  2MM2 A;  3QII A;  3A8H B;  2NUP B;  4J83 A;  3FPR A;  1FMV A;  1PRL C;  4JZ3 A;  2RQW A;  4FCY A;  4RKU E;  1JXO A;  4ARI A;  2OAU A;  4ELZ C;  1VQ8 A;  1M90 U;  3OYI A;  1BK2 A;  3OS5 A;  1OI1 A;  4M77 C;  3OMG A;  1W2B P;  2DFU A;  4M7D B;  1Y07 A;  2OI3 A;  1TWB A;  4F04 B;  5GAO r;  2QQ9 A;  1I07 A;  1B07 A;  3I5R A;  4M78 B;  1X27 A;  1Q7Y R;  2AZV A;  5IT9 E;  4J6Y A;  3I56 Q;  1U8R A;  3X24 B;  5J26 A;  2YUO A;  3OW2 S;  2KRO A;  1Q7Y C;  4RTY A;  3EGX B;  1VQL T;  3S6W A;  3I5S A;  3V7R A;  4FU6 A;  1YJN Q;  2ZPI B;  2CZ1 B;  4RTZ A;  4FYV B;  3OS1 A;  1GXI E;  2IG0 A;  1D0X A;  2X4Y A;  2DTI A;  2K3Y A;  3CEY A;  2MPX C;  2DD4 A;  5DLO A;  4B6M A;  3TSW A;  2CZ6 B;  2J6F A;  1G3W A;  5CK9 A;  1M8V A;  1FYN A;  2QYZ A;  1F1B B;  1IGU A;  1H92 A;  3CC2 A;  1UG1 A;  4PJL A;  5KE2 A;  4E6R A;  2LQK A;  1KFZ A;  1TUC A;  2GFA A;  1JRI A;  3THK A;  3UAT A;  1WYX A;  3QSU A;  4RG8 A;  1K1Z A;  1QVG A;  1K73 U;  4PJO C;  1WQW A;  2CKK A;  3RKX A;  3CCJ A;  4XTY A;  1JJ2 P;  4V2S A;  1X2K A;  2V8I A;  2FL7 A;  2HEQ A;  1R7R A;  2MM0 A;  1H8K A;  3E19 A;  3LHD A;  2E6Z A;  4JJN K;  2VYT A;  5GAN f;  3PVL A;  3EFR A;  1T3S A;  2CUB A;  2FHD A;  1Q81 R;  2DK3 A;  1VQ8 T;  2RQR A;  2WSF E;  1KQ1 A;  2DEQ A;  3J81 E;  4HT8 A;  5FTK A;  1GCQ A;  1KD1 R;  3INZ A;  2KT1 A;  2JNG A;  1BI2 A;  1Q81 C;  1KQ2 A;  1MMG A;  3V8L A;  1ZUY A;  3H0F A;  3L2U A;  1QMC A;  3HU3 A;  2J7I A;  1OU8 A;  3I55 Q;  4N4I A;  5IHN A;  2V8K A;  5ECA A;  3DB3 A;  2DBK A;  3HU2 A;  2JM8 A;  1IHW A;  2AK5 A;  1TOV A;  1VYT A;  4DEY A;  3UT1 A;  3CCL Q;  1RAA B;  4R56 A;  1UUE A;  2QAZ A;  1YWO A;  4FYY B;  1VQN Q;  3F70 A;  1K76 A;  3M4Y A;  2DE0 X;  3RES A;  4ANJ A;  3S3M A;  4C5H A;  5GAN d;  1E7O A;  1V76 A;  5GMK i;  4PLI A;  3OYL A;  2CP0 A;  2CH4 A;  4M77 F;  3MEA A;  1QP2 A;  3JRZ A;  2ZPH B;  3CCM A;  3HRU A;  2EVR A;  1GFC A;  3TEE A;  5LJ5 f;  4EMG A;  3QBY A;  3CC2 T;  2JJ9 A;  1ARK A;  3SFM A;  2O31 A;  3GBQ A;  3WXM B;  1I5L A;  4M75 E;  1QCS A;  2EKH A;  1QVG S;  4PFP A;  3TVT A;  4WTO B;  2PJH B;  1VQ7 A;  2AZS A;  4A4F A;  5DM7 R;  3CCJ T;  3LGL A;  4C8Q A;  4X34 A;  2LQ8 A;  4AMC A;  3REB B;  3OYD A;  4RG2 A;  3JB9 I;  4KGV B;  4M7A C;  3RER A;  4JJD A;  1HSQ A;  2YUQ A;  3JV3 A;  4C5G A;  1Z9Q A;  4LDX A;  5LJ5 g;  5A0L A;  3VRY A;  1E6G A;  3VUB A;  1QCN A;  2XIC A;  2LT4 A;  2ROT A;  5I21 A;  4AFQ C;  3P8B B;  3H0H A;  5FRM A;  3TU4 K;  1ZX6 A;  1BI1 A;  1J3T A;  1ACM B;  2DD5 A;  2XHC A;  2K4Y A;  3UA6 A;  4QT7 A;  4CI0 C;  4PFO A;  3C12 A;  3RDV A;  2KT8 A;  3JCM c;  3G4S Q;  4PJO F;  2R5A A;  4C92 D;  1WX6 A;  4QVZ A;  2RO0 A;  5LJ3 f;  1PCX A;  1JO8 A;  2G6F X;  3FLG A;  3QQ8 A;  1RAH B;  1I81 A;  4F7U G;  3OYE A;  1CZ4 A;  2WSC E;  5FW9 A;  3M9Q A;  2LCC A;  5GJV B;  1RAE B;  3QPH A;  2VV5 A;  1YJW A;  2LX9 A;  3OSS C;  1Q82 U;  1TUD A;  3DLL A;  2R58 A;  2F69 A;  1R0C B;  2XU8 A;  1WNL A;  4ELY C;  3L1A A;  5FTL A;  1D09 B;  3MO8 A;  4JDS A;  3CCM T;  2RM4 A;  1PM3 A;  1WXB A;  1XQH A;  2EAY A;  3OYF A;  3CMA A;  2JW4 A;  4EMK A;  1M8M A;  2QQR A;  4C5E A;  3FIF A;  1QVF P;  2Q1D X;  1C0M A;  1PKS A;  5LJ3 d;  1JU5 C;  2MMP A;  4OB3 B;  3V8J A;  2KE9 A;  2ENM A;  5IAY A;  5KYW A;  1LVK A;  1X43 A;  2K3X A;  1W4S A;  4LNP A;  4ZTJ A;  4C92 G;  6AT1 B;  1VQ7 T;  4C0Z A;  1PD0 A;  2MYS A;  4CC4 B;  1VQO T;  7AT1 B;  2FRW A;  3CBO A;  3CD6 Q;  1AZG B;  4AG1 C;  1RAD B;  3EG3 A;  2X51 A;  2EGA A;  2QTV A;  3L2Z A;  4Y28 E;  5FU7 C;  2LJ1 A;  2OX7 A;  3H8Z A;  1M1K R;  2YWW A;  3CC4 Q;  3WVE B;  2HSE B;  1NG2 A;  1FWZ A;  1FMW A;  4FIB A;  1BB9 A;  3JCM h;  3CBP A;  1IXD A;  3A8O B;  3EHQ A;  5CKB A;  3KXT A;  3JCM Q;  2RJE A;  1M1K C;  1EZZ B;  3HTR A;  3RNJ A;  3M59 A;  5KYY B;  5GAN 3;  1I8F A;  4ARC A;  4JPB W;  3H41 A;  3CCV A;  2DKG A;  3CCE A;  4CC7 A;  3JCM J;  2IPO B;  3N5B B;  1YIJ Q;  1QCO A;  2JS0 A;  2K79 A;  1SHG A;  3M0P A;  3G1J A;  2HBP A;  2XDB A;  1YIT Q;  4M7A F;  4J9H A;  2M0O A;  1WHM A;  4DBQ A;  4HA8 A;  2RHU A;  3MPU B;  4JLI A;  3MEU A;  3OY9 A;  1D0Y A;  1PD1 A;  3A98 A;  2W10 A;  3HPW A;  1U1T A;  4OMQ A;  3P8D A;  3JCM P;  1YJW T;  4EMK B;  1WDX A;  5D6W A;  4C0D B;  4F7U A;  2BTT A;  2A3L A;  1VQP Q;  3OYB A;  1I4K 1;  4PK4 A;  2DJQ A;  2PUO B;  3E1S A;  2PZ1 A;  4FL6 A;  2KEA A;  1JQQ A;  3FRN A;  5KYW B;  4LDY A;  3CMA T;  5C6S A;  4RCB A;  1MMA A;  5LL6 S;  4C5I A;  2QQB A;  1TS9 A;  3LGA A;  3OQ5 A;  1KIK A;  2FG0 A;  1YI2 Q;  2JTE A;  2JVV A;  3TQ7 P;  3I55 T;  1YHQ A;  8AT1 B;  2CZ7 B;  1K0S A;  1MV3 A;  1OQK A;  2FVU A;  5GAN 2;  2OTJ T;  2F5K A;  2P84 A;  1QVF A;  3MP6 A;  4J6X A;  4C92 A;  1W1F A;  1WLP B;  1WA7 A;  3M53 A;  3EAE A;  3CC7 Q;  1UDL A;  4GBQ A;  3CPW A;  3V8K A;  2PUK B;  5IXB A;  8ATC B;  1BKB A;  1H3Z A;  4NS5 A;  3KBG A;  2HL5 C;  3D7S B;  4DBH A;  4M78 C;  1WPY A;  5DLQ E;  5HK3 A;  2DL4 A;  1M4Z A;  2K3B A;  1M1G A;  5LJ5 e;  3CCV T;  1VQ6 A;  1WXU A;  3L2Q A;  3SWN B;  2KDS A;  5AT1 B;  2E5K A;  2HQX A;  3VS7 A;  3PIP A;  1X2Q A;  5GAO n;  4JRK A;  3ZEH A;  1Y57 A;  1RAC B;  3G71 A;  1NLO C;  2CSQ A;  1SRM A;  1TH7 A;  4AG2 C;  2EYY A;  3QKJ A;  4F7U B;  2DF6 A;  1QWF A;  3X28 B;  1IRX A;  3JB9 F;  3QWY A;  1Q82 R;  4KDI A;  2CT3 A;  3BDU A;  4JZ4 A;  1S72 A;  1Q82 C;  1JXM A;  4MDX A;  1YBY A;  3QJY A;  4A4K A;  2OJ2 A;  1QWE A;  4A4H A;  1Q86 U;  3ZJV A;  4ZN1 A;  1QP3 A;  2F5T X;  3HFO A;  1YJ9 T;  5HK0 A;  2RNA A;  1XJW B;  2VAS A;  5FTN A;  4AQ7 A;  1YHQ T;  4C92 B;  3A8L B;  4RTV A;  3T9N A;  1WHJ A;  1QVF S;  2GCX A;  5B6C A;  3RIR A;  3VU3 C;  3NGP A;  1R77 A;  2MF2 A;  1U1S A;  4KUL A;  4J9E A;  4KOD A;  2RQT A;  4E7S A;  1VQK A;  1AOJ A;  1OZ2 A;  3EGD B;  3FJ5 A;  5CKH A;  2NUT A;  2LT1 A;  3FB9 A;  4M75 C;  3CPW S;  2KBT A;  2DZC A;  3PIO A;  2R57 A;  2XI9 A;  5GAN h;  2A36 A;  3EFO B;  5GAO p;  5I2M A;  2CP3 A;  1O75 A;  1TSF A;  4M77 D;  2FRY A;  4L59 A;  4QQ6 A;  1M3B A;  1KG1 A;  3M54 A;  3L42 A;  1M3A A;  2EBP A;  1TTH B;  1MGQ A;  3CXC A;  1TU0 B;  1ZBX A;  5I11 A;  4AS1 A;  2X35 A;  4BI8 B;  3ZFJ A;  5CD1 A;  1U3O A;  1ABQ A;  2EW3 A;  3EH2 A;  5HCK A;  3G71 T;  4FM4 B;  1UFF A;  2KMT A;  1N8R R;  2HKQ B;  4QW2 A;  2OTL A;  1VYU A;  3QC8 A;  4E7J A;  1WHL A;  3ULR B;  4PFZ A;  5GAM d;  1N8R C;  2MWP A;  4IUV A;  2RN8 A;  3O5Z A;  2RB6 A;  1GBQ A;  4M7D F;  1MMN A;  2EYW A;  1S72 T;  1CKA A;  1VQ4 A;  1OU9 A;  3QHS A;  3PNW C;  3HU1 A;  1C6V X;  3C95 A;  3CBM A;  3CCU A;  2EYZ A;  4M78 F;  2F2W A;  3QXE B;  4M77 G;  1PC0 A;  2RMO A;  3EG1 A;  1V29 B;  5CQY A;  1VQM Q;  2A0F B;  2K9G A;  2KI7 A;  1SRL A;  2CP2 A;  3SD4 A;  2L3P A;  3IQL A;  3PVQ A;  1K4U S;  3JCM X;  3OS0 A;  4MMK A;  2ROL A;  1ZA2 B;  3DB4 A;  1D3B B;  3LH5 A;  2KRM A;  4CRI A;  1VOM A;  2NUT B;  4C8Q D;  1KC8 R;  4PJO D;  2VWF A;  1G3S A;  2P0P A;  4J9C A;  2DIQ A;  4BI3 A;  1KC8 C;  4AFU C;  1VQK T;  1M2O A;  1WJR A;  2XMF A;  4LUD A;  4D6W A;  4PL6 A;  5IH2 A;  1D1B A;  3M0R A;  2X4W A;  3DLM A;  5GJW B;  2LCL A;  2C06 A;  2B8A A;  1M5Q 1;  2DA9 A;  2K2M A;  3QZ9 B;  2LJ3 A;  5J3B A;  2DNU A;  1N9S A;  1NM7 A;  5IHI A;  3CXC S;  1PRM C;  2PTK A;  2GGR A;  4PJJ A;  1UGQ B;  4C8Q G;  4PJO G;  3A5Z B;  1YWP A;  2E65 A;  5LJ3 h;  2OTL T;  3P8H A;  4M75 F;  4PKC C;  4M7D E;  4DEX A;  4JRP A;  3G6E T;  2CP6 A;  2FZG B;  5CAI A;  2DRM A;  1R0B G;  2H8H A;  5IHK A;  2V26 A;  3HKS A;  2D8J A;  3NHN A;  2JXB A;  1VQ4 T;  1VQ9 Q;  2E70 A;  1IO6 A;  1KSW A;  4M78 E;  4PJM A;  2QEX T;  3CCQ Q;  1RAG B;  3EG2 A;  3CCU T;  1Q86 R;  2GQI A;  1AD5 A;  2AKL A;  2M51 A;  4IUT A;  4A4G A;  1UJ0 A;  1ZQ1 A;  2LCS A;  1K8A U;  2RF0 A;  4J9D A;  1Q86 C;  1M1K U;  4RUG A;  2F2V A;  2RQV A;  2L5Q A;  4DBF A;  3CF2 A;  2KXD A;  2QK0 A;  3QO3 A;  3G7Z A;  5DYI A;  1QKX A;  4M77 A;  1WGS A;  1VQ5 Q;  3OYH A;  1EX4 A;  2GQV A;  2YUP A;  3SDZ A;  3VYG A;  2I0N A;  3TIW A;  5HKC A;  1W2B A;  3EG9 A;  1HD3 A;  2RK2 A;  2O9S A;  4LDV A;  1X6B A;  4R0K A;  2YRV A;  2SRC A;  1G5V A;  2QDY B;  2O9V A;  4KDL A;  1Y7X A;  2EJG A;  4A63 B;  3KFV A;  1VIF A;  1WLF A;  4X9D A;  2AKK A;  1X75 C;  2KYM A;  4PJN A;  5GAN 6;  3URG A;  4EIK A;  2CH4 W;  3M0S A;  2HD0 A;  4HCB A;  1UEB A;  3NMZ C;  4HT9 A;  4F14 A;  2COY A;  4HVW A;  3MP8 A;  2JM9 A;  5GLF A;  1G83 A;  4M4Z A;  1OUL A;  1YNZ A;  1ZA1 B;  1QDN A;  2CP5 A;  5CKE A;  4XTX A;  1ZSZ C;  1K9M U;  4C0D C;  4XU1 A;  1O54 A;  3I56 A;  2KY9 A;  2DVE A;  1VQO A;  1KK7 A;  3CCE Q;  4PJO A;  3EFS A;  1AWX A;  4ZN3 A;  5CR2 A;  1WHH A;  2YHT A;  1K9A A;  2E5Q A;  1UTI A;  3CME Q;  3EH1 A;  3VUZ A;  1OPL A;  5D6Y A;  4X1V A;  3HFN A;  3H0I A;  1YJN A;  4M77 B;  4L5G A;  2CDT A;  1JJ2 A;  2QA4 Q;  1ABO A;  3EHR A;  2KYB A;  4J5Y A;  3J7A F;  2DM1 A;  4ZGD B;  5LJ5 d;  1PKT A;  4QKU A;  2XG8 D;  3VV0 A;  3EG9 B;  1OOT A;  4O5V A;  1SHF A;  5CVI A;  4RV0 A;  1E6H A;  5GMK h;  1D1C A;  4FYW B;  2DTO A;  3MHX A;  5FRN A;  5GAN 4;  5GMK j;  4OB2 B;  1E32 A;  2CSI A;  2CRE A;  2EQM A;  3UPU A;  1W2B S;  2BZX A;  4RTW A;  2CZ0 B;  3PFS A;  4JJB A;  2O4X A;  4ESR A;  2K5F A;  2Q18 X;  2R5M A;  3C4S A;  4MZP A;  1BI3 A;  1VIE A;  4B9W A;  1NJI R;  3TCJ A;  1FXX A;  1Y71 A;  2DXT A;  2L0A A;  4N0A C;  3LWI A;  1ZC1 A;  1CZ5 A;  1G3T A;  2LP5 A;  4DBR A;  1NJI C;  1M2V A;  5FLX E;  1HK9 A;  2O88 A;  2ZPB B;  3LGF A;  1HXD A;  2DMO A;  4LD9 K;  3X20 B;  3SWN C;  2CYZ B;  3PGG A;  1NPP A;  2L3Q A;  2FZK B;  2XD0 A;  2YT6 A;  3JB9 J;  4XK8 E;  2P4T A;  1LJO A;  3TRE A;  3M0U A;  3PT9 A;  1YCS B;  4PNO A;  1V1C A;  2DIL A;  5FWB A;  2QQA A;  4C8Q B;  1NBE B;  4PJO B;  2HMA A;  4J9G A;  2E1H A;  3EG0 A;  1UJY A;  3VKI A;  4JRQ A;  3QG1 A;  3I55 A;  1OV3 A;  2QTX A;  3CCS Q;  2MCN A;  4C0F A;  2OTJ A;  1VA7 A;  3I56 T;  4Q5W A;  4WCI A;  2JS2 A;  4KT0 E;  4J9B A;  1VQN A;  2OAW A;  4M7A A;  3WVD B;  5C1B A;  1BYM A;  2RI5 A;  2YUN A;  1CSK A;  4J7F A;  1YJN T;  1K8A R;  1JJ2 S;  3MJX A;  2XID A;  1OZ3 A;  2K7A A;  1K8A C;  1QVP A;  3CCR Q;  3VS3 A;  4C0G A;  2RI2 A;  2X9H A;  2O4X B;  1GRI A;  2DBM A;  2DLP A;  2YSQ A;  2KAF A;  1Y96 A;  5KCH A;  2LMJ A;  4J8O A;  1BBZ A;  1GCP A;  3V7C A;  4LDU A;  1WJQ A;  2MK5 A;  3ZBD A;  1IHV A;  5J39 A;  4WF2 A;  2LW6 A;  3A8M B;  1ZHI A;  3BY7 A;  3O8V A;  4GLK A;  4OF1 A;  4XAX B;  2DTH A;  2HQE A;  3MP1 A;  5EQJ B;  2VXE A;  4EMH A;  4XU0 A;  2RJC A;  4C8Q E;  1N8R U;  1N5Z A;  3SEM A;  2LDM A;  5GAM h;  1FMK A;  2LQN A;  2XKO C;  4BY6 C;  2KRS A;  3JAM E;  5GAM j;  2Q19 X;  4OMN A;  3SB2 A;  4CC2 A;  1WQ7 A;  1UHC A;  1GBR A;  5CIU A;  3ZJT A;  3HRT A;  3QZ5 B;  3FDR A;  3M55 A;  1VQL Q;  4JUV A;  4GY5 A;  1YJ9 A;  1DJ7 B;  2RK1 A;  2E12 A;  4BI4 A;  5L23 A;  2B86 A;  3M57 A;  5KYU A;  2PQW A;  1K9M R;  3VS5 A;  5CKF A;  4NL2 A;  4IIM A;  2IIM A;  3NTK A;  3G4S A;  1MNE A;  1OX9 A;  5GAN 5;  2JTM A;  3NPF A;  1K9M C;  1KC8 U;  3CCL T;  4OP0 A;  1X01 A;  2O2O A;  1VQN T;  3HSB A;  2M0Y A;  5ERG B;  4PLL A;  4LN2 A;  1B3Q A;  4EPC A;  4Z88 A;  3JSC A;  3OW2 P;  2C0T A;  5KH6 A;  2E41 A;  2IVW A;  1MUZ A;  1LOJ A;  2VGN A;  2CUD A;  2Y4Y A;  1WHK A;  4M7D C;  3MEW A;  2LRQ A;  5GAO m;  3OYK A;  2GTO A;  4K11 A;  4FW1 A;  3FJP A;  1X6G A;  4F7U F;  2BZY A;  2DER A;  4UC4 A;  4E7I A;  4Z02 A;  3U23 A;  1N27 A;  1D0Z A;  2P4R A;  1NE8 A;  2D6F A;  2RI3 A;  2KGT A;  1AVZ C;  4E7K A;  3OBW A;  3NTI A;  2K57 A;  1VQ8 Q;  1RLP C;  1Q95 G;  5EC7 A;  3L2W A;  2ZZD A;  4CC3 A;  1RL2 A;  2JZ2 A;  4M75 D;  3FPT A;  4VUB A;  1SPK A;  3CQT A;  2EJ9 A;  2LJ0 A;  2PWY A;  3CD6 A;  1TUG B;  4OGE A;  1AEY A;  2D0N A;  1EFN A;  2ABL A;  3ZL7 C;  3ASK A;  2YRD A;  1LCK A;  4J6W A;  1GFD A;  3OSV A;  1M30 A;  1WFW A;  2FZC B;  4C92 F;  4HCC A;  4N4H A;  1G2B A;  2QA4 T;  2X4J A;  3CC4 A;  1I9G A;  5KYU B;  2BIV A;  3SHW A;  3OYY A;  5FRO A;  3OYJ A;  2V1R A;  5GMK m;  2L3R A;  1NEB A;  4E7H A;  2E10 A;  3LX7 A;  3NTH A;  4Z89 A;  3KUF A;  1SKU B;  2E4H A;  4KH0 B;  2H3J A;  2EKO A;  1WXT A;  5FU6 B;  3G4S T;  5IN1 A;  1JEG A;  4RMO A;  1YIJ A;  3QQ7 A;  3LYI A;  5FU7 B;  4JS5 A;  5GAO l;  1YIT A;  3QYG B;  2DXC A;  2ED0 A;  3CC2 Q;  1JB0 E;  2YLB A;  3RMS A;  1XOV A;  4XQ3 A;  1VYV A;  4HKE A;  3ZGZ A;  2RQU A;  2X4X A;  4OML A;  4F16 A;  4P5N A;  2ED1 A;  3OA6 A;  1NYG A;  3UF4 A;  5GAN j;  2RA2 A;  5EPP A;  2MOX A;  4F7U E;  4M7D A;  3EGU A;  1VQP A;  3CCJ Q;  2KR3 A;  3FEO A;  2ZPE B;  2XDP A;  3V7S A;  3JCM g;  4A53 A;  3OYA A;  2NLU A;  5D6X A;  4M78 A;  2MWO A;  2DL3 A;  2J06 A;  2DAQ A;  4ZTF A;  2M1H A;  2VB6 A;  4XTV A;  3A1P A;  2WAC A;  5EG2 A;  3BW1 A;  1ZBJ A;  2JTF A;  1YI2 A;  2PNI A;  4FSS A;  2M9U A;  1LNX A;  2GTJ A;  1X69 A;  2J6O A;  4N4G A;  3M4G A;  2EYX A;  3CD6 T;  4EDU A;  5GAN 7;  3G6E A;  2HBW A;  1RUW A;  1YP5 A;  4C92 E;  1P92 A;  4LDW A;  4GLM A;  1XTD A;  1NPR A;  5GMK l;  1BCM A;  3PMI A;  2JMC A;  2YLC A;  3QDR B;  4Y91 A;  3BQB A;  3CC7 A;  2YRC A;  2QEX A;  3CC4 T;  4OMF B;  4E7L A;  1BU1 A;  2ATC B;  4RTT A;  1NZ9 A;  2H3E B;  3QJ6 A;  5LJ5 h;  1YFN A;  2D8H A;  4BE2 A;  5LJ5 j;  2SEM A;  4DA4 A;  2DIG A;  1ZSG A;  3RKY A;  3M58 A;  4IUU A;  4R55 A;  4ME7 A;  2QGF B;  2PVD B;  1YIJ T;  1B34 A;  3CCM Q;  1GCQ C;  1LPL A;  3J80 E;  3M0Q A;  1UGP B;  1BIA A;  3OYM A;  4RCC A;  1YIT T;  1QLY A;  3R6N A;  3M5A A;  2RD1 A;  2F1L A;  3MET A;  5FWC A;  4JS4 A;  5AYF A;  2KRN A;  2RJD A;  2HZY A;  2RHX A;  2L2P A;  2HAX A;  4M75 A;  2BE7 D;  2EYQ A;  1NJI U;  4FT2 A;  4QVC A;  2CP7 A;  2MI6 A;  3LH0 A;  1VQ7 Q;  1PWT A;  1MV0 B;  1VQP T;  4LE9 A;  5CCB A;  2VUB A;  1VQO Q;  2VVK A;  3LWH A;  2D0Q B;  4HCK A;  2AIR B;  4L6V 5;  2JMA A;  1S3S A;  4KBM B;  3HHT B;  2PVG B;  1YI2 T;  1U5S A;  1ZUK A;  4HCZ A;  1K0X A;  2HNI A;  5LJ3 j;  1ZUU A;  4KLN A;  3VS4 A;  1S1N A;  2LNV A;  1BIB A;  4HVU A;  2VC8 A;  5FTJ A;  1IZ6 A;  3DKM A;  2EIF A;  5GMK e;  3CC7 T;  3NFC A;  4AFZ C;  1HJD A;  1CR5 A;  4IIO A;  1NYF A;  5KYN A;  3MCA B;  4C8Q C;  1KQS P;  2DYB A;  1TXQ A;  3RKW A;  1H64 1;  1SSF A;  2YDL A;  3H9N A;  3Q1J A;  1B34 B;  4II1 A;  1MMD A;  3PMT A;  3QWX X;  2X3X D;  1AWJ A;  2LX7 A;  1YJW Q;  1UGS B;  2LC4 A;  1RAB B;  2VKN A;  5A2Q E;  5FTM A;  2QI2 A;  3HRS A;  4ATO A;  5C18 A;  2DL8 A;  2V8J A;  4A4E A;  4M75 B;  2ESW A;  2Q1A X;  4D8D A;  3CMA Q;  1T0H A;  4M7A D;  1PNJ A;  2BZ8 A;  1WIE A;  2KNB B;  4OGC A;  3OYN A;  1PSF A;  2DO3 A;  1KD1 C;  2E3I A;  2L8D A;  3VS6 A;  3TSZ A;  4DQ2 A;  2A28 A;  2HSP A;  3REA B;  2LVM A;  4ZNX A;  3GOX A;  1IGQ A;  4XU2 A;  3VS2 A;  2OTJ Q;  4O6J A;  3RR6 A;  4DOW A;  1AWW A;  4NOY A;  5GAN g;  2EJF A;  3GNG A;  1VQM A;  2ZPF B;  2XDD A;  4KGZ B;  3VS1 A;  3OYG A;  1A0N B;  2K5L A;  3OB9 A;  1SG5 A;  4D8K A;  1OEB A;  1IRE B;  2RH2 A;  1U06 A;  1TG0 A;  2E64 A;  3JCM e;  2D1X A;  4M7A G;  4EMK C;  4DOV A;  5CKD A;  2KQW A;  4FYX B;  3UWN A;  3CCV Q;  3BE3 A;  3UA7 A;  3C0C A;  2HL3 A;  2DXU A;  1QCF A;  2KK4 A;  2CT4 A;  1CKB A;  2RHI A;  2DZ9 A;  4LD6 A;  3X25 B;  3OYC A;  2JN0 A;  2LQW A;  4JRI A;  2VXF A;  2EQI A;  5M9O A;  1O9S A;  2BUD A;  4Z8A A;  1WI7 A;  2EFI A;  1VUB A;  2JUF A;  4OMP A;  2EQK A;  2C0O A;  2P0K A;  3GP8 A;  2O01 E;  1M90 R;  4BD3 A;  1KQS A;  5GAM e;  1I0C A;  4MDW A;  2GBQ A;  3HP9 A; 
#chains in the Genus database with same CATH homology
 2LQK A;  2EQJ A;  2LT1 A;  2BKD N;  3FB9 A;  2GFA A;  1JRI A;  4M75 C;  4ZGE B;  3CPW S;  4KO8 A;  3QZ5 B;  1M90 C;  2JV2 A;  3FDR A;  3M55 A;  4JUV A;  3R6O A;  2DZC A;  3PIO A;  4RG8 A;  3QSU A;  2R57 A;  3QUI A;  4GY5 A;  2XI9 A;  2M16 A;  1QW1 A;  4MML A;  5GAN h;  1YJ9 A;  5A0G A;  5GAO p;  1FX7 A;  1DJ7 B;  2RK1 A;  2E12 A;  5I2M A;  4BI4 A;  1QVG A;  3JB9 H;  1O75 A;  3JB9 D;  4M77 D;  3M57 A;  1K73 U;  1N9R A;  1WQW A;  2CKK A;  4L59 A;  4QQ6 A;  4XTY A;  3RKX A;  3CCJ A;  4V2S A;  2YUJ A;  1KG1 A;  2PQW A;  3M54 A;  2V8I A;  5C0M A;  3L42 A;  4NL2 A;  5CKF A;  1MHN A;  3L2R A;  3G4S A;  3NTK A;  4C8Q F;  2FL7 A;  1VQ9 A;  4BAC A;  1R7R A;  2YVL A;  5GAN 5;  1MGQ A;  2JTM A;  3E19 A;  1ZBX A;  4BUG A;  5CCA A;  3CXC A;  3BDL A;  1K9M C;  2E6Z A;  3CCQ A;  1KC8 U;  4AS1 A;  2X35 A;  3CCL T;  4OP0 A;  1X01 A;  4JJN K;  2VYT A;  5GAN f;  4CQN A;  4QQG A;  1VQN T;  2GF7 A;  3HSB A;  3EFR A;  4BI8 B;  2FHD A;  3ZFJ A;  5CD1 A;  2DK3 A;  1VQ8 T;  2WSF E;  1KQ1 A;  5ERG B;  2DEQ A;  3L2V A;  1VQM T;  3J81 E;  4PLL A;  4EPC A;  4HT8 A;  5FTK A;  3INZ A;  3G71 T;  3JSC A;  2QXF A;  4FM4 B;  4XTU A;  2KMT A;  2JNG A;  1BI2 A;  5KH6 A;  1Q81 C;  2E41 A;  2IVW A;  1LOJ A;  2VGN A;  4M77 E;  1M1F A;  2K2V A;  2Y4Y A;  4QW2 A;  3V8L A;  1VQ5 A;  2OTL A;  1KQ2 A;  4M7D C;  3MEW A;  4E7J A;  2LRQ A;  3L2U A;  5GAO m;  3S3N A;  3OYK A;  3HU3 A;  3QC8 A;  5GAM d;  1N8R C;  2MWP A;  4IUV A;  1WJS A;  3FJP A;  3GIB A;  2RB6 A;  1XNI A;  4N4I A;  2XK0 A;  4F7U F;  4M7D F;  1S72 T;  3MB5 A;  4UC4 A;  4E7I A;  2V8K A;  3DB3 A;  4Z02 A;  4OB1 B;  1N27 A;  1VQ4 A;  3HU2 A;  3QHS A;  3PNW C;  3HU1 A;  1NE8 A;  1EIF A;  3C95 A;  4IUR A;  4OVA A;  2RI3 A;  2D6F A;  5LJ3 g;  3CBM A;  5DY9 A;  3UT1 A;  3CCU A;  2QQS A;  4QVD A;  3OBW A;  4E7K A;  4M78 F;  3NTI A;  3QXE B;  4M77 G;  4R56 A;  3JB9 G;  1KHI A;  2K57 A;  4BB7 A;  3AHU A;  3F70 A;  3M4Y A;  3PTA A;  3RES A;  1V29 B;  5CQY A;  3S3M A;  4C5H A;  5GAN d;  3L2W A;  2ZZD A;  1RL2 A;  2JZ2 A;  3SD4 A;  5GMK i;  4M75 D;  3FPT A;  4PLI A;  3OYL A;  4VUB A;  3JCM X;  1R8O B;  4BE0 A;  2EJ9 A;  2PWY A;  3OS0 A;  4MMK A;  1K73 C;  3CD6 A;  3ER0 A;  4M77 F;  4OGE A;  3DB4 A;  1D3B B;  3MEA A;  1QP2 A;  4CRI A;  3JRZ A;  4C92 C;  2ZPH B;  4C8Q D;  2PVO B;  4PJO C;  5FU6 C;  4PJO D;  3ASK A;  1G3S A;  2P0P A;  3CCM A;  3S3O A;  4J6W A;  4E47 A;  3HRU A;  1KQS S;  3OSV A;  3TEE A;  4C92 F;  2DIQ A;  4BI3 A;  5LJ5 f;  4HCC A;  4N4H A;  1KC8 C;  4EMG A;  1VQK T;  2QA4 T;  2X4J A;  3CC4 A;  3QBY A;  3RMQ A;  1I9G A;  1WJR A;  3CC2 T;  1PSE A;  4D6W A;  2Y90 A;  3SFM A;  3E9G A;  4PL6 A;  2BIV A;  2FYK A;  2X4W A;  3WXM B;  1I5L A;  4M75 E;  3OYY A;  1QCS A;  5FRO A;  3ZJU A;  3DLM A;  4MZT A;  3OYJ A;  2MAM A;  1QVG S;  2LCL A;  2C06 A;  5GMK m;  2B8A A;  1M5Q 1;  2PJH B;  1VQ7 A;  2L3R A;  4E7H A;  2E10 A;  4A4F A;  3LX7 A;  3QZ9 B;  5J3B A;  5DM7 R;  3NTH A;  4IUQ A;  3CCJ T;  3KUF A;  2KSS A;  3LGL A;  4C8Q A;  1N9S A;  2EWN A;  4PJO E;  4X34 A;  2LQ8 A;  2H3J A;  2EKO A;  4M7D D;  2ZCF B;  4N0A A;  5FU6 B;  3G4S T;  2RHZ A;  3E9F A;  3OYD A;  5IN1 A;  4RG2 A;  3JB9 I;  4M7A C;  4RMO A;  1VQ9 T;  3CXC S;  3CME A;  3RER A;  1YIJ A;  3QQ7 A;  3LYI A;  5FU7 B;  4C5G A;  4JS5 A;  3GF5 A;  5GAO l;  3OBY A;  3CCQ T;  1YIT A;  4LDX A;  3QYG B;  5LJ5 g;  4M78 D;  5A0L A;  1OYX A;  3VUB A;  2QA4 A;  2XIC A;  2DXC A;  1UGQ B;  2LT4 A;  1JB0 E;  3SWN A;  5I21 A;  2YLB A;  3RMS A;  1XOV A;  2P0Q A;  2LTO A;  4XQ3 A;  4HKE A;  3P8B B;  4C8Q G;  4NL3 A;  3ZGZ A;  4PJO G;  5FRM A;  2X4X A;  3TU4 K;  3A5Z B;  4J7I A;  5LJ3 h;  2E65 A;  1BI1 A;  4IUP A;  4P5N A;  1VQ5 T;  2OTL T;  3OA6 A;  3P8H A;  2DD5 A;  4M75 F;  4PKC C;  2XHC A;  2K4Y A;  5GAN j;  2RA2 A;  5EPP A;  4F7U E;  4M7D E;  4JRP A;  2CGH A;  1VQP A;  4M7D A;  4CI0 C;  3G6E T;  3C12 A;  5CAI A;  5GAN e;  3FEO A;  3A8G B;  2A7Y A;  2ZPE B;  3JCM c;  1JBM A;  2XDP A;  3HKS A;  4M7A B;  3V7S A;  3FC3 A;  3JCM g;  4A53 A;  4PJO F;  3OYA A;  2NLU A;  2R5A A;  1VQ4 T;  3GPL A;  2E70 A;  4C92 D;  4M78 E;  2D9T A;  5D6X A;  4M78 A;  4QVZ A;  2RO0 A;  2QEX T;  5LJ3 f;  3UDC A;  3CCU T;  2MWO A;  4ZTF A;  2DAQ A;  3ME9 A;  2M1H A;  4XTV A;  4A54 A;  2WAC A;  5GAN 8;  4IUT A;  3FLG A;  4A4G A;  3QQ8 A;  5EG2 A;  1ZQ1 A;  1K8A U;  1I81 A;  3BW1 A;  4F7U G;  3OYE A;  4M7D G;  1Q86 C;  2JTF A;  1CZ4 A;  1M1K U;  1YI2 A;  2WSC E;  3H6Z A;  3M9Q A;  2LCC A;  2M9U A;  2L5Q A;  4X9C A;  3CF2 A;  1LNX A;  3JCM V;  3QPH A;  1G3Y A;  3C94 A;  3G7Z A;  3QO3 A;  5DYI A;  2VV5 A;  4M77 A;  1WGS A;  1Y96 B;  3OYH A;  4N4G A;  1YJW A;  2LX9 A;  3OSS C;  1Q82 U;  4M78 G;  3LW5 E;  3M4G A;  3DLL A;  2GQV A;  2R58 A;  3CD6 T;  2F69 A;  4XU3 A;  4EDU A;  5GAN 7;  3SDZ A;  2XU8 A;  1WNL A;  4YTL A;  4ELY C;  3L1A A;  3VYG A;  3G6E A;  5FTL A;  3BFM A;  1Q7Y U;  4TVR A;  3MO8 A;  4C92 E;  3TIW A;  1P92 A;  4JDS A;  4LDW A;  3CCM T;  2RM4 A;  5HKC A;  3OYF A;  1XQH A;  1XTD A;  1NPR A;  2EAY A;  4MZM A;  5GMK l;  3PMI A;  1W2B A;  2YLC A;  3QDR B;  4Y91 A;  3CMA A;  4EMK A;  2RK2 A;  3CC7 A;  3BQB A;  1RI0 A;  4LDV A;  2QEX A;  2FB7 A;  4C5E A;  2QQR A;  3CC4 T;  2YRV A;  3FPU A;  3FIF A;  2Q1D X;  1G5V A;  2G3R A;  2QDY B;  4OMF B;  5LJ3 d;  4E7L A;  4KDL A;  1Y7X A;  2EJG A;  2EQU A;  2MMP A;  4OB3 B;  3V8J A;  3QWZ A;  1NZ9 A;  5IAY A;  4KUI A;  2DJZ A;  2K3X A;  3X26 B;  3QJ6 A;  5LJ5 h;  1W4S A;  1VIF A;  3GLX A;  4ZTJ A;  4C92 G;  4BE2 A;  1WLF A;  5LJ5 j;  4C0Z A;  3CCS A;  4DA4 A;  1VQ7 T;  2DIG A;  3RKY A;  3M58 A;  4X9D A;  5DYG A;  4IUU A;  1VQO T;  3CCE T;  2ZGW A;  3CBO A;  4JLG A;  1X75 C;  4R55 A;  4ME7 A;  5CCX A;  1YJ9 T;  2RJF A;  2JOY A;  2PVD B;  3CME T;  1YIJ T;  1B34 A;  2Y4X A;  3L2Z A;  5CQX A;  4M7A E;  3J80 E;  2I2L A;  1UGP B;  2WSE E;  4Y28 E;  1BIA A;  5FU7 C;  4RCC A;  3URG A;  5GAN 6;  3OYM A;  1YIT T;  2HD0 A;  4HCB A;  1UEB A;  5KCO A;  1VQO A;  3M5A A;  3H8Z A;  2RD1 A;  3MET A;  3WVE B;  1KHC A;  3M56 A;  4JS4 A;  4HT9 A;  4FIB A;  1FWZ A;  2RJD A;  2PU9 B;  5AYF A;  4BE1 A;  4IKF A;  3JCM h;  3CBP A;  3A8O B;  2RHX A;  5CKB A;  3KXT A;  5KE3 A;  3MP8 A;  3JCM Q;  2HAX A;  2RJE A;  4M75 A;  1M1K C;  3CCR A;  5GLF A;  2EYQ A;  3M59 A;  1NJI U;  4FT2 A;  4QVC A;  5GAN 3;  2MI6 A;  3QYH B;  3LH0 A;  1I8F A;  1QDN A;  4ARC A;  3MEV A;  3JCM W;  5CKE A;  4XTX A;  1VQP T;  1K9M U;  4C0D C;  3OMC A;  5CCB A;  4XU1 A;  3CCV A;  1O54 A;  3I56 A;  3LHD A;  2KY9 A;  1BI0 A;  2DKG A;  2DVE A;  2VUB A;  5GAO q;  3LWH A;  3CCE A;  3EFS A;  5CR2 A;  4ZN3 A;  2DXB A;  4PJO A;  2CS7 A;  2YHT A;  3JCM J;  2D0Q B;  2E5Q A;  3N5B B;  3JCM f;  2K5I A;  4L6V 5;  4M75 G;  3VUZ A;  1UB4 A;  1S3S A;  2XDB A;  2HBP A;  5D6Y A;  3HFN A;  4KBM B;  4M77 B;  1YJN A;  1Q81 U;  4L5G A;  4M7A F;  2M0O A;  1JJ2 A;  3HHT B;  4HA8 A;  2RHU A;  4J5Y A;  4JLI A;  3J7A F;  4ZGD B;  5LJ5 d;  2PVG B;  1KD1 U;  3MEU A;  3OY9 A;  1YI2 T;  3VYH B;  3CCL A;  4HCZ A;  1M9S A;  3CC2 A;  3HPW A;  1U1T A;  1X6O A;  2GFU A;  2HNI A;  3P8D A;  2XG8 D;  3VV0 A;  5LJ3 j;  3JCM P;  1YJW T;  4FSX A;  4KLN A;  2VGM A;  4EMK B;  4ZGJ B;  4O5V A;  2B25 A;  5D6W A;  4C0D B;  4F7U A;  5LJ3 e;  5CVI A;  4RV0 A;  2A3L A;  5I2S A;  2LNV A;  1AHJ B;  5A0D A;  5GMK h;  1I4K 1;  3OYB A;  1BIB A;  2VC8 A;  2DTO A;  2PUO B;  3E1S A;  4XTW A;  3MHX A;  5FRN A;  5GAN 4;  5GMK j;  4OB2 B;  1E32 A;  5FTJ A;  1D3B A;  3UPU A;  1IZ6 A;  2EQM A;  3DKM A;  2RHY A;  4OB0 B;  4FL6 A;  1W2B S;  3OW2 A;  3FRN A;  2EIF A;  4LDY A;  3CMA T;  5GMK e;  5C6S A;  4RCB A;  3CC7 T;  4B9X A;  2CZ0 B;  3PFS A;  5HY6 A;  2O4X A;  5LL6 S;  2K5F A;  1VQL A;  3NFC A;  3VJP A;  4C5I A;  3JCM d;  1CR5 A;  2Q18 X;  2R5M A;  3C4S A;  2QQB A;  1UGR B;  4MZP A;  5GAM f;  1BI3 A;  1VIE A;  3LGA A;  4B9W A;  3MCA B;  2MM0 A;  4C8Q C;  4KUD K;  3OQ5 A;  3TCJ A;  3RKW A;  1FXX A;  1Y71 A;  2DXT A;  1H64 1;  3LLR A;  4N0A C;  3LWI A;  1ZC1 A;  1CZ5 A;  2JVV A;  3I55 T;  1YHQ A;  1G3T A;  1SSF A;  3Q1J A;  1B34 B;  4II1 A;  3CCS T;  3PMT A;  2CZ7 B;  1NJI C;  5FLX E;  4QQD A;  4BY6 B;  2FVU A;  1N6A A;  5GAN 2;  1UGS B;  2OTJ T;  1HK9 A;  2ZPB B;  2DPP B;  2F5K A;  2E6N A;  2LC4 A;  3LGF A;  4BDY A;  1QVF A;  1VQ6 T;  1HXD A;  4LD9 K;  4BDZ A;  3MP6 A;  4FT4 A;  5A2Q E;  5FTM A;  3X20 B;  2QI2 A;  4J6X A;  3HRS A;  3GNF B;  3SWN C;  4ATO A;  2CYZ B;  3PGG A;  5C18 A;  1NPP A;  2ZPG B;  2L89 A;  3RUX A;  4C92 A;  2V8J A;  4A4E A;  3M53 A;  4M75 B;  2KVQ G;  2Q1A X;  2XD0 A;  2Q1C X;  3EAE A;  3JB9 J;  4XK8 E;  3CPW A;  2P4T A;  1LJO A;  4M7A D;  3TRE A;  3V8K A;  2PUK B;  3PT9 A;  1BKB A;  5GAM g;  1YCY A;  4PNO A;  2QQA A;  4C8Q B;  1H3Z A;  5L8R E;  4OGC A;  4NS5 A;  3HL8 A;  1PSF A;  2DO3 A;  3OYN A;  1KD1 C;  4PJO B;  2L8D A;  3KBG A;  3CCR T;  2E1H A;  3CPF A;  3JCM b;  2AHJ B;  3OS2 A;  3VKI A;  4XTZ A;  4DQ2 A;  4JRQ A;  3QG1 A;  2LVM A;  3I55 A;  2QTX A;  3GOX A;  5CO7 A;  2MM2 A;  4M78 C;  3QII A;  1WPY A;  5DLQ E;  4XU2 A;  3A8H B;  4C0F A;  5HK3 A;  3CCV T;  1M4Z A;  4J83 A;  1M1G A;  5LJ5 e;  3I56 T;  2OTJ A;  4O6J A;  1VQ6 A;  4DOW A;  3FPR A;  4Q5W A;  3L2Q A;  3SWN B;  4KT0 E;  4NOY A;  2KDS A;  4RKU E;  5GAN g;  2HQX A;  3PIP A;  4ARI A;  1VQN A;  2OAU A;  2EJF A;  4ELZ C;  1VQ8 A;  1M90 U;  3OYI A;  4M7A A;  3WVD B;  5C1B A;  5GAO n;  3GNG A;  1VQM A;  1BYM A;  2RI5 A;  3OS5 A;  4JRK A;  2ZPF B;  4J7F A;  3ZEH A;  2XDD A;  1YJN T;  1OI1 A;  1JJ2 S;  3G71 A;  4M77 C;  3OMG A;  2XID A;  1OZ3 A;  3OYG A;  1TH7 A;  2K5L A;  3QKJ A;  4F7U B;  4M7D B;  3OB9 A;  1IRE B;  3X28 B;  1Y07 A;  1K8A C;  2RH2 A;  1QVP A;  3JB9 F;  2E64 A;  5GAO r;  4KDI A;  3BDU A;  3JCM e;  2QQ9 A;  4C0G A;  2RI2 A;  4M78 B;  1S72 A;  2O4X B;  4M7A G;  4EMK C;  4DOV A;  5CKD A;  4J6Y A;  5IT9 E;  1Q82 C;  2KQW A;  2KAF A;  1Y96 A;  5KCH A;  3UWN A;  4MDX A;  4J8O A;  1YBY A;  1U8R A;  3X24 B;  3V7C A;  5J26 A;  3QJY A;  3OW2 S;  4LDU A;  1Q7Y C;  1WJQ A;  4A4K A;  2DXU A;  3ZBD A;  4A4H A;  5J39 A;  4WF2 A;  1Q86 U;  3ZJV A;  1VQL T;  3S6W A;  4ZN1 A;  2KK4 A;  2LW6 A;  1QP3 A;  3V7R A;  3A8M B;  4FU6 A;  1ZHI A;  3BY7 A;  2F5T X;  3O8V A;  4GLK A;  2RHI A;  2ZPI B;  4OF1 A;  3HFO A;  4XAX B;  2DZ9 A;  2DTH A;  4LD6 A;  3X25 B;  2HQE A;  5HK0 A;  3OYC A;  2JN0 A;  2CZ1 B;  3MP1 A;  2VXE A;  4JRI A;  4EMH A;  5EQJ B;  2VXF A;  5M9O A;  4XU0 A;  5FTN A;  2RJC A;  1O9S A;  4C8Q E;  3OS1 A;  1N8R U;  1GXI E;  2BUD A;  2IG0 A;  4AQ7 A;  1YHQ T;  2X4Y A;  2DTI A;  2K3Y A;  3A8L B;  3CEY A;  4C92 B;  2LDM A;  2EFI A;  3T9N A;  2DD4 A;  1VUB A;  2JUF A;  5DLO A;  2EQK A;  5GAM h;  2GCX A;  1QVF S;  5B6C A;  3RIR A;  2XKO C;  4BY6 C;  3JAM E;  3VU3 C;  2CZ6 B;  5GAM j;  2Q19 X;  2P0K A;  3GP8 A;  2O01 E;  2MF2 A;  1U1S A;  4KUL A;  1G3W A;  1KQS A;  4BD3 A;  4KOD A;  3SB2 A;  5GAM e;  5CK9 A;  4MDW A;  1M8V A;  1WQ7 A;  3ZJT A;  5CIU A;  1VQK A;  3HP9 A;  3HRT A;  1OZ2 A;  5CKH A;  5KE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...