2GFAA

Double tudor domain complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
107
Chain Sequence
ALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
total genus 20
structure length 107
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfaA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gfaA02
3MP1A 4LD6A 2VYTA 1OYXA 3UWNA 2EQJA 2XK0A 3FC3A 4FL6A 3UT1A 3OYKA 3F70A 1OI1A 1OZ2A 3Q1JA 2X35A 3NTHA 3OMGA 2RJFA 3LLRA 2NLUA 4Q5WA 5D6YA 5KCOA 2X4XA 2JZ2A 3OYFA 5FRMA 3L2WA 2GFAA 3GOXA 3MP8A 4ZTFA 1H3ZA 3MEVA 2R5MA 5FRNA 4E7JA 4EDUA 3DLMA 2DIGA 2R57A 4C5HA 2EFIA 2DAQA 2EKOA 2EQUA 5KE2A 4PL6A 5KH6A 4ZTJA 1MHNA 3FDRA 5D6XA 1RI0A 4IUQA 4IURA 2QQRA 3PFSA 3OYDA 2EQKA 2R58A 3OYLA 3EAEA 4HCZA 1KHCA 3QJ6A 2GFUA 1WJRA 3KUFA 3OB9A 5C0MA 4A4FA 3S3NA 4BE0A 3L2VA 2RO0A 2RI3A 2M16A 2R5AA 4QQ6A 4C5IA 3OYGA 2BKDN 1WGSA 1OZ3A 4A4HA 5C6SA 2B8AA 5FROA 4BE2A 4IUPA 5CIUA 3MEWA 2XDPA 1G5VA 2RHXA 2RHUA 2X4WA 4CRIA 2EQMA 3LGLA 2QQSA 5M9OA 3NTKA 3ZEHA 5IN1A 2GF7A 4N4HA 4E7IA 2PQWA 3OS2A 2O4XA 4BD3A 3OMCA 4A4EA 5D6WA 3L2UA 3PMTA 2G3RA 2MWPA 3LH0A 3QBYA 1SSFA 3S6WA 2K3YA 3DB3A 4IUTA 2RHZA 1WJQA 4PLLA 2YRVA 2RHYA 2BIVA 2O4XB 3P8DA 2LVMA 3S3MA 3OYAA 3E9GA 2IG0A 4QQDA 2L3RA 2K3XA 4IUUA 3OQ5A 2JTFA 5IAYA 2HQXA 4IUVA 3FLGA 3BDLA 3L42A 3META 3MEUA 2WACA 4B9XA 3H6ZA 2RI5A 3DB4A 3FEOA 3LYIA 4PLIA 3OYJA 4N4IA 4E7KA 2L8DA 3CEYA 3S3OA 3MO8A 2E5QA 3LGFA 2LRQA 3E9FA 3OS1A 2HQEA 2M0OA 1N27A 2CKKA 3OYNA 2RHIA 3OYHA 3ME9A 3LX7A 3SD4A 2MWOA 3ASKA 2L89A 3PNWC 3QIIA 5J26A 2F5KA 2D9TA 1XNIA 4NS5A 4QVZA 2M1HA 2DIQA 3OS0A 4BACA 2BUDA 3MP6A 5KCHA 3OYIA 4X34A 4BDZA 4B9WA 4N4GA 3H8ZA 2RJEA 3OYEA 3L2QA 2LCCA 3C4SA 2FHDA 2X4YA 4FU6A 4QW2A 2P0KA 2RJDA 3O8VA 4QQGA 4UC4A 3OYMA 3OA6A 4BDYA 2RJCA 4RG2A 5KE3A 1WJSA 2RI2A 3NTIA 4II1A 3QKJA 3OY9A 3OYBA 4IKFA 4C5EA 5J39A 4L59A 3OYCA 3P8HA 2LDMA 3L2RA 2LTOA 4E7LA 4BE1A 4E7HA 4OVAA 3M9QA 4A4GA 2E6NA 3MEAA 4GY5A 4Z02A 4C5GA 3PMIA
chains in the Genus database with same CATH superfamily
2CSIA 3G1JA 1YWPA 3MCAB 3QJYA 5IHNA 1X2KA 3RKYA 5DYIA 4RMOA 2D0NA 4MZTA 3RMQA 3CC7A 1QVFA 1NLOC 4HKEA 1ZUKA 4XTUA 4C0ZA 2GQIA 1E6GA 2QEXA 5C1BA 3FDRA 1WHJA 1SHGA 1RL2A 4M77G 2ABLA 5B6CA 5C18A 1RLQC 4CC3A 1VQLQ 1G3YA 4DQ2A 3OYGA 1ABQA 1Y0MA 3BE3A 3I56Q 4A53A 1AEYA 1X75C 1ZBJA 3OSSC 3PTAA 2F2VA 1I4K1 1QVFP 1WHMA 4RTVA 1S1NA 2F1LA 1D1CA 4M78E 3CCET 3CC2Q 1B34B 5LJ5e 1VQ5T 1W4SA 1W2BP 2RQWA 1IRXA 4B9XA 3QQ8A 4QVDA 4LUEA 2WSCE 1BBZA 3RESA 4V2SA 3ME9A 3G6ET 5J26A 1VQ9A 4QVZA 1WHHA 4BACA 1Z9QA 5KCHA 4X34A 4BDZA 2WSEE 4EPCA 3A8HB 2FHDA 1QCOA 5A0DA 1U1TA 3JCMP 3L2RA 1OU8A 4A54A 2A37A 3QYHB 5CQYA 2DXTA 2V8JA 2Y4XA 4QT7A 1LNXA 3OW2P 2LC4A 2RJFA 3D7SB 1E7OA 2FPEA 3VYGA 5FTMA 2XI9A 4JZ3A 4PKCC 3MHXA 3EG9B 2DKGA 4FW2A 5A2QE 2V1RA 4FYYB 1S72Q 3A8GB 4HCCA 4IURA 3JCMW 3OYDA 1QCNA 4LUDA 3JB9I 3S3NA 4C8QA 1U8RA 4BE0A 2L3PA 2YWWA 1D0ZA 2KGTA 4C5IA 4M78C 5CAIA 2CP0A 4FT2A 1WXUA 4J6WA 3A5ZB 4GLKA 2QGGA 2MOXA 2SEMA 1BI2A 5CK9A 2BIVA 4HCKA 1K73U 1NZ9A 2LVMA 5GAMd 3G71A 4PJLA 2QQ9A 1YJWQ 2FRYA 4HXJA 5L8RE 5L23A 2E65A 5CKHA 1ZQ1A 3DKMA 3MEUA 2K5LA 1N5ZA 3VS6A 2DEUA 1H8KA 1Q81R 2BE7D 2GTJA 2NYSA 1Q95G 1D3BB 1IGUA 2A08A 3LGFA 3OYHA 2HKNA 1MMNA 2F5KA 1R0CB 3JB9F 4B9WA 1YITQ 2LT1A 1VQ8Q 4KBMB 2CT3A 2KQWA 3I56T 3LH5A 4BDYA 5LJ5d 3EGXA 2DD4A 3CPWS 3JB9J 3OBYA 1KJWA 1CKBA 4C92A 3EGDB 4C92G 1VQ5A 1M90C 1R7RA 4OB1B 1K0XA 3PMIA 3M0TA 3CCEA 1JBMA 1WXTA 1RAFB 1VQNQ 2X4XA 1U3OA 2JZ2A 3OYFA 5ECAA 4Z8AA 2R5MA 2E12A 3H0FA 1Q86U 3GNGA 1GXIE 3JB9G 4ZTJA 2M0YA 1WLFA 2L2PA 3L1AA 1RI9A 3UF4A 2RB6A 5KYWA 3X25B 4M7DA 2BKDN 1OZ3A 1KQSS 4N0AC 2E6ZA 1LJOA 4JZ4A 4OF1A 2YVLA 3HTRA 4CRIA 4OB2B 4XU1A 5HY6A 2KR3A 1JB0E 4EMKC 1VQNA 4KO8A 1K8AR 2QI2A 2QAZA 3CF2A 2C06A 1MMAA 1OOTA 4MZMA 4ZNXA 2CGHA 2PU9B 1RACB 4FM4B 1JQQA 2PJHB 3P8DA 3S3MA 1N8RU 4M7AF 4IUUA 2CP2A 2DYBA 2VWFA 2HQXA 5GANf 3QWXX 1QVGP 3FEOA 4PLIA 3CC2T 2L8DA 2LCSA 1NLPC 1RAIB 3VU3C 5IH2A 2J6KA 4RTZA 1TWBA 3CC7T 2DA9A 2YUJA 3UA7A 2OX7A 5CCAA 4LD9K 1TUCA 1UTIA 1BI3A 4QW2A 2X4YA 1FMWA 2DETA 3OA6A 3ZFJA 2MMPA 3OS5A 1WDXA 3V8LA 1YI2T 1QVGA 3DLLA 2LTOA 1AT1B 2KRNA 1KC8C 4Z88A 3QHSA 2X51A 3RNJA 4KDLA 1PKTA 4C5GA 3BQBA 1UGSB 1YJNA 2VXFA 1TS9A 2VYTA 5HK3A 3JCMb 3OSVA 4FL6A 2OTJT 3AT1B 2Q18X 2EJ9A 1XJWB 3NMZC 2NUTB 2EAYA 3M5AA 2JVVA 1WHLA 3CCLQ 3EHQA 4ELYC 3V7CA 3CC4A 1ZHIA 1GBQA 2EKOA 2KNBB 3X28B 4HT8A 3ZBDA 1QVGS 3CCVA 4NOYA 3CCLT 1G8XA 3QDRB 3QWYA 3JCMV 4LDWA 2GFUA 4M78F 2RO0A 2LT4A 3BW1A 3OBWA 3M58A 1M1GA 1YJNQ 1XOVA 5FROA 2DILA 3G4SA 2QQSA 1CZ4A 4CC7A 3ZEHA 4QKUA 2HL5C 3HRUA 1C0MA 1SRMA 4D8DA 1M1KU 2A3LA 2O4XB 2RPNA 1VQPA 2BZYA 2GCXA 1JU5C 3M0SA 3FLGA 4CQNA 3META 3CCUT 2ED1A 4M7DC 3EHRA 2LX7A 3OYJA 2KK4A 3S3OA 3JCMX 2LJ1A 3TVTA 1YJWT 2KRSA 1N27A 1OQKA 2GGRA 1NG2A 3RDVA 1R77A 3PT9A 2KYMA 1AD5A 1VQLA 2BUDA 3E2UA 1M9SA 1VQKT 2BZXA 3V8JA 3I5RA 5CKBA 2ESWA 1IZ6A 3CCUA 1PC0A 3J81E 2RJCA 5KE3A 2XG8D 2QGFB 1K9AA 1CZ5A 1AVZC 2HL3A 2JN0A 4R55A 3L2ZA 4M7AA 3UWNA 1OEBA 2EQJA 3UT1A 1OZ2A 3EG0A 2F2XA 5GANd 3HU3A 4Q5WA 2O88A 2FL7A 3QDFA 1S3SA 1M8VA 4C92B 4M77D 4PJOD 3MEVA 3HHTB 4J7IA 3VV0A 1KQ2A 1LOJA 1GL5A 2EFIA 2DAQA 5LJ3h 4MDWA 1UHCA 2K5FA 3CCUQ 1I8FA 1T0JA 2OJ2A 1SRLA 5GAOl 2EW3A 2ZCFB 4DA4A 2D0QB 1VQOT 3I5SA 4D6WA 3QJ6A 1H92A 4LDVA 3CCVT 1X69A 2DRKA 3CXCP 1W6XA 2QXFA 1IB8A 4AT1B 4A4HA 2EYXA 4OGEA 5FTLA 1ZBXA 3HRSA 4IUPA 2J7IA 5CIUA 1SKUB 1D0XA 1Q7YC 2OTLT 1AWJA 4OMMA 1QLYA 2OTJQ 1O54A 4XTYA 2DO3A 4DEYA 1YJNT 1X27A 2E1HA 5LJ3d 1AHJB 1N8RR 4PLLA 2FPFA 3G6EQ 2D8JA 4A63B 5KYUA 3P8BB 4J9FA 1YJ9A 2IG0A 1V76A 2L3RA 2JNGA 1Y07A 3M59A 1YI2A 4PJJA 5I22A 4RTTA 2E3HA 3FB9A 3CPWA 2KBTA 4JDSA 1MMDA 4ARIA 1X6OA 1TU0B 1WLPB 3LX7A 1BI1A 1QMCA 3EFOA 1SF9A 3GP8A 4ELZC 2GTOA 2LW6A 1N9SA 3KBGA 1T0HA 4LDUA 8AT1B 3CCJT 1M27C 4J6XA 2AZVA 2PUKB 2RI2A 1UDLA 5AYFA 1FWZA 2NUPA 3QQ7A 3RKXA 2IVWA 4E7HA 1OPLA 3E1SA 4GY5A 4MZPA 4M7DD 1KD1C 1PD1A 4M7DE 4FSXA 2JW4A 3FC3A 1WIEA 3I9QA 4M7AB 1UHFA 2PVGB 5KCOA 1H641 2KXCA 3ULRB 3REAB 4C8QG 1NYFA 2ZGWA 4ZTFA 5GAOm 4IIOA 2FZGB 2ZAEA 2MPXC 4M75A 1TG0A 2R57A 2YLBA 4LXCA 2JTEA 4M75F 5KE2A 3CCMQ 3TREA 1SG5A 4HVWA 3PFSA 4RTWA 4XTXA 4C8QD 1NPPA 8ATCB 4DBQA 5KYXB 3EG1A 1LPLA 2AK5A 2KYBA 2QQBA 2R5AA 3JCMJ 1VQ8A 1KC8R 5FWBA 3RKWA 4C8QB 1IREB 2M9UA 3VKIA 2ROTA 3QO3A 4J9DA 5A0GA 1KG1A 4N4HA 2V1QA 4RKUE 3JSCA 1K0SA 1VYVA 3A8LB 3H0HA 1SSFA 1WJQA 2CYZB 1VQ4A 5GAOn 4YTLA 5GMKe 2DFUA 2K3XA 1LVKA 4M7DF 3I56A 2YDLA 2PTKA 3G4SQ 4M7DB 4J6YA 4N4IA 2LZ6B 2AHJB 2NUTA 2OAWA 3NHNA 1RAGB 1XQHA 2H8HA 1GCPA 1DJ7B 2EJFA 3HSBA 1MV3A 3PNWC 2O9VA 3QZ5B 1VQPQ 1D3BA 4M78B 1GCQA 3SEMA 2LNHB 2RNAA 3L2QA 1RUWA 3KFVA 4FU6A 2DL5A 3RR6A 2P4RA 4PK4A 1TH7A 4M7AE 2VGNA 2AKKA 4FIBA 1KQ1A 3EH2A 4RCBA 3QXEB 4WF2A 3UPUA 2K9GA 2XHCA 2HD0A 4KRTA 4F7UE 2NLUA 1K73R 2DVJA 3AHUA 5FLXE 1YWOA 5FRMA 4O5VA 4DOVA 2X9HA 1G83A 1BIBA 4JPBW 3WVDB 2NUZA 4M77A 3JB9H 2EQUA 3IQLA 1VOMA 3JCMg 3JAME 3EFOB 5D6XA 2DX1A 4PJNA 2CDTA 1S72T 3EAEA 1GRIA 4HCZA 2EPDA 4F7UG 4A4FA 1UB4A 2V26A 2RD1A 1YN8A 1IHVA 3TCJA 2DL4A 1OX8A 2LMJA 1WQ7A 2QTVA 2MM2A 1M3AA 4E47A 5AT1B 1FMVA 3ER0A 1PG5B 2GF7A 4E7IA 1M1FA 4C8QC 4WCIA 2I2LA 2CH4W 2HBPA 4IIMA 2JJ9A 1ZA1B 5KYWB 1FMKA 4OMNA 4DBFA 2CT4A 4Y91A 1B7TA 2M51A 3MJXA 4Y92A 4D8KA 1N9RA 5LL6S 3H6ZA 1YP5A 1ZUUA 2FZKB 2MK5A 3KXTA 1V1CA 3CQTA 2QTXA 3CC4Q 4E6RA 4Y28E 3EG3A 5GMKh 2LQ8A 3EH1A 3VJPA 1VQ9T 3G6EA 4KH1B 1F1BB 1U1SA 4AQ7A 5LJ5h 2E64A 3HFOA 2RH2A 1Y96B 3QZ9B 4M4ZA 4VUBA 3QG1A 1Y57A 3CD6T 1ZUYA 2L3SA 2XICA 3H0IA 2LDMA 4HA8A 2ZPEB 4F04B 4OGCA 3M9QA 1GFCA 3LHDA 1UGQB 3MEAA 2KDSA 4FYWB 3M0UA 1W2BS 1NEGA 2L0AA 2FRWA 4M75E 3QUIA 5IT9E 5GANh 4Z89A 3CD6Q 5D6YA 1HXDA 1M2VB 2A28A 2QK0A 1M1KC 2GFAA 3MP8A 4C92C 3SDZA 1QVPA 2NUPB 1WYXA 1BU1A 4RTUA 1UE9A 2CZ1B 5FW9A 5KH6A 2J6FA 4OB3B 2IPOB 1M8MA 5DYGA 1WX6A 2DZ9A 4MDXA 3GNFB 3PVLA 1OU9A 4ZGJB 2QEXT 2M16A 4OB0B 1WGSA 1KIKA 2JMCA 1QKWA 3ZJVA 5GLFA 2RQRA 2DXUA 3LGLA 2DK3A 5CR2A 2WSFE 2MIOA 2O4XA 5HKCA 3L2UA 4XU3A 2HQHA 2JMAA 3CMEQ 3S6WA 2K3YA 3R6OA 4KGXB 5KYYA 2D6FA 1VQMA 2RHYA 2AIRB 4LN2A 1MV0B 5IAYA 2O9SA 3A8MB 4JLGA 3VUBA 1X2QA 5GAMe 2RI5A 1YCSB 3INZA 3LYIA 2QASA 2ZPIB 3PGGA 4ANJA 4FYVB 4RV0A 5GANe 2EGEA 2VB6A 5I2SA 2PNIA 5CO7A 4M75B 2C0OA 2MCNA 3CC7Q 4C0GA 2K4YA 4C0DB 2M0OA 4NS5A 2X3WD 4WTOB 1KQSP 4PJOA 1R8OB 2K7AA 4JJDA 4LNPA 4MMLA 2JT4A 2EJGA 2M1HA 5LJ3e 1X43A 2DTHA 4KLNA 3M53A 3JCMf 3O8VA 4QQGA 2XMFA 1WJSA 1UJ0A 3QKJA 4L59A 4JJNK 2DL7A 4LDXA 1FXXA 1I5OB 4E7LA 2SRCA 2Y90A 1WNLA 1OV3A 1NM7A 4DBHA 4KGZB 2FEIA 3HU2A 2L5QA 4JRQA 3FJ5A 1SSHA 3PE0A 4JLIA 2DL8A 3PVQA 3CCQA 2KT1A 2DTOA 1M90R 1AWXA 2F2WA 1OI1A 2VXEA 2YRCA 1BIAA 3NTHA 5GAOp 3LLRA 2RQTA 4J9EA 1FYNA 3QYGB 1MNDA 3VS2A 2ED0A 3GOXA 1T3SA 1H3ZA 1E32A 1U5SA 2MAMA 4C5HA 1B3QA 2E5KA 2FG0A 1VQ4Q 5DY9A 1RLPC 2LP5A 1G2BA 1GBRA 4IUQA 5KYXA 2EQKA 3CCSA 1Q82U 3TQ7P 2CH4A 5IXFA 3CCRT 1IHWA 2K3BA 4DOWA 4KUIA 5LJ3g 1Z9ZA 1PSFA 4PJOE 1W2BA 2K57A 3CCQQ 1EZZB 1VA7A 5GAOq 4ESRA 2FPDA 2XDPA 1G5VA 4AFUC 3C12A 4BI8B 5GANg 1QVFS 4KODA 2EIFA 3M0PA 1YFNA 2EBPA 2K2MA 4E7ZA 1HYOA 2RN8A 1T3LA 2MWPA 1OPKA 3DB3A 2DM1A 2J06A 4EIKA 2RHZA 2KRMA 2YRVA 2J6OA 1U06A 1I81A 3EGDA 2PVOB 3M57A 3OQ5A 5A0LA 1TSFA 4FT4A 1Q7YU 2GQVA 2DTIA 2QYZA 3FPTA 2OI3A 1Q86C 2BE9B 3VRYA 1NPRA 4OMQA 2DXCA 4M7AC 2E5QA 2LRQA 5GAN2 3OS1A 2HQEA 2DEQA 3SD4A 2MWOA 1XNIA 4OMOA 3CMAT 4F7UA 5CQXA 4C0DC 3OYIA 2YRDA 1JRIA 1TUDA 2FB7A 2JM8A 2LQKA 4N4GA 4PFZA 4XQ3A 2JV2A 1QKXA 2LCCA 3VS0A 4M77E 2V8KA 1K9MU 4AFZC 1CR5A 1EIFA 2COZA 3WXMB 5J39A 4P5NA 4HCBA 2LJ0A 2IIMA 2KI7A 3URGA 3FPUA 4Z02A 5EPPA 4AFSC 4ZN3A 3ZJTA 2DERA 3OYKA 1CKAA 3V8KA 3I55T 3CBPA 4CI0C 1EFNA 3M0RA 3RMSA 2DF6A 3JCMe 3CCJA 3C95A 2ZPGB 2DIGA 1X01A 1WHGA 3EG2A 1BB9A 1Q7YR 4J9GA 2XDBA 1WJRA 3KUFA 4KH0B 2MF2A 4OMPA 3A1PA 2DNUA 5FU7B 4B6MA 1GCQC 2DXBA 4M75D 3GIBA 2EQMA 4RTYA 4KUDK 2YHTA 5GANj 2H3EB 4BD3A 1SPKA 2ZZDA 3SWNB 4JRKA 3QBYA 5DLOA 1VQ6A 4M77B 5CD1A 3GF5A 5GAN3 1QDNA 4NL2A 3A98A 4PJOF 4QQDA 1Q82R 2D1XA 4JRPA 4M77C 4IUVA 1C1AA 1M90U 3BDLA 4E7KA 2PUOB 3SB2A 2W10A 1RABB 1AWOA 3O5ZA 2QA4A 1IGQA 3CMEA 1J3TA 3CCVQ 5GMKm 4XK8E 1VQOQ 3QIIA 2PZ1A 1QP3A 2VV5A 3I55A 3OS0A 2DYIA 2KY9A 3MP6A 4F7UB 3H8ZA 4BB7A 1WPYA 2P0KA 2RJDA 3FJPA 3REBB 3QC8A 2ROLA 4II1A 3JCMh 5GAN7 2NWMA 3VS5A 2Q1AX 2X4JA 2DJQA 1TXQA 4LD6A 1MNEA 2A7YA 1M2VA 1Y7XA 3SWNC 1JJ2S 3CXCA 4OMFB 3N5BB 1Y96A 1ZSZA 2XIDA 4QVCA 2RQVA 1VQKQ 1VQMQ 4PL6A 2VVKA 1IO6A 2YUNA 1E6HA 1M30A 1TTHB 4DEXA 2LJ3A 3CCRA 3CCST 4ARCA 5C6SA 4BE2A 4DBRA 4F16A 4J9CA 1KK7A 3VS4A 4EMGA 1PSEA 2DPPB 2AZSA 3NTKA 1VQ7A 3CCMA 3CCEQ 3H9NA 2DMOA 4PNOA 4L5GA 3CCSQ 2CZ0B 2M02A 4ZGDB 4HT9A 3OYAA 3E9GA 1K1ZA 1K4US 3G4ST 3L42A 1BK2A 2WACA 1Q81C 1YNZA 2RA2A 2Y4YA 2MI6A 1YIJA 1HD3A 2DE0X 5GMKi 2CP7A 1B34A 1QP2A 3CCLA 2CKKA 3H41A 1UECA 1K9MR 1A0NB 1JEGA 5FTJA 2W0ZA 5GJVB 3BFMA 2BZ8A 4XAXB 2ZPHB 1MMGA 1UG1A 2XU8A 4R56A 3RIRA 1K76A 1YCYA 2KE9A 4UC4A 1PRMC 5CCBA 4RG2A 3OYBA 3NTIA 3C94A 2O2OA 2JXBA 2KT8A 3A8OB 2QEXQ 3GLXA 4TVRA 5LJ5f 2E6NA 1YIJQ 3OYYA 3VUZA 1UGVA 2DVEA 3LGAA 1OYXA 2XK0A 1KD1R 3M4GA 2E10A 3EFRA 3Q1JA 1VQMT 3OMGA 1ZA2B 1QWFA 3L2WA 1C6VX 1BI0A 2H3JA 1RAAB 1GFDA 3PIOA 1VUBA 1MHNA 1UJYA 1PRLC 3CPWP 4RUGA 3TIWA 2GNCA 4AG2C 3VS7A 1R0BG 2DZCA 2EGCA 2HCKA 3CC2A 4E2FB 3GPLA 3QPHA 3NPFA 3SFMA 2LQWA 3CCJQ 4O6JA 5IXBA 4C0FA 2CS7A 2HKQB 1ZSGA 2OAUA 2Z0WA 2MM0A 3CPFA 5LJ3j 4E7SA 4LDYA 1PHTA 1KC8U 4C8QF 1BCOA 3WVEB 3M54A 2Q19X 1VQNT 5CKFA 1QQJA 1ZSZB 2JTMA 3CEYA 3CD6A 2YT6A 3X20B 5FWCA 4FCYA 5FU7C 2CUDA 2JUFA 3OYNA 3G7ZA 2O01E 3M56A 1VIFA 2L89A 1P92A 1QCFA 3T9NA 3TU4K 2DIQA 2HAXA 1RADB 4JUVA 2E4HA 4BY6B 4A4KA 2LNVA 2OTLQ 4LE9A 4FW1A 2C0IA 1VYUA 5ERGB 3J80E 2JOYA 1W70A 1N8RC 4M78D 2XKOC 4ME7A 3HKSA 5GAMj 1K8AU 1SEMA 4FYXB 3CBMA 2E70A 2KAFA 1ACMB 3CMAQ 1ARKA 3EGXB 3HL8A 1LCKA 2HSPA 1PD0A 4J7FA 2FO0A 1ZC1A 2CUBA 2K79A 4JJBA 1YJ9Q 4ORZA 1YI2Q 3EGUA 4PJOG 5KYYB 2B86A 1AZEA 2XDDA 2K2VA 1UFFA 1NE8A 1BYMA 3QSUA 2R58A 4J9IA 5CKEA 3OYLA 3BDUA 2P0QA 3OB9A 3L2VA 1TUGB 5FTKA 3M4YA 4QQ6A 4JS4A 1UUEA 3ZL7C 3FPRA 4XU0A 2AT1B 2YXYA 2RHUA 2FZCB 1WFWA 2LQNA 4HVVA 4J83A 3G71T 3SWNA 2PQWA 1D1AA 4J9BA 5GAMf 3PMTA 3J7AF 1JJ2A 4X9CA 5EQJB 2F5TX 4IUTA 1I0CA 3RERA 1X6GA 1O9SA 1PWTA 2YLCA 3UDCA 1Y71A 3V7RA 2JTFA 4C92D 2RM4A 3HRTA 4CC2A 1KD1U 2VC8A 2EYWA 2FVUA 1S72A 4EMHA 3E19A 1ABOA 2RK2A 1QWEA 1PCXA 1BCMA 2G6FX 1RAEB 4KULA 4JRIA 3TEEA 2P0PA 4BUGA 4PJOC 2BTTA 1I1JA 2HSEB 4C8QE 3JB9D 1W1FA 3NFCA 1M3BA 4XTZA 1YIJT 2L3QA 3JCMd 3C4SA 1UGRB 3HFNA 2KEAA 2CP5A 2Q1CX 1OULA 1KFZA 4CC4B 2LX9A 4OVAA 3TSWA 3CCRQ 4A4GA 3G71Q 2EWNA 2QG9B 1Q82C 2CREA 1VQ6Q 2V8IA 3C0CA 3MP1A 3CCMT 1X6BA 1VQ4T 2I0NA 1VQ7T 3VS3A 1M1KR 5GMKj 2F69A 4BI3A 4MMKA 3LW5E 4E7JA 3DLMA 3FIFA 4N0AA 1VIEA 2YUOA 1WHKA 2AKLA 1CSKA 4J8OA 1VQ8T 5GAMh 1WXBA 2QQRA 1NJIU 2Q1DX 2QDLA 2YUPA 5FU6C 1I5LA 1UEBA 2RI3A 2CSQA 2JS0A 4OP0A 2B8AA 2HBWA 2JS2A 1FX7A 2KSSA 4X1VA 5HCKA 2KXDA 4EMKB 2P4TA 4F14A 2COWA 2EVRA 4KGVB 3OMCA 4A4EA 2RF0A 2G3RA 2EKHA 3LH0A 4F7UF 2LCLA 1G3WA 2KMTA 3ZGZA 1D09B 4M7AD 5IHIA 5GAN5 5FTNA 1AWWA 3TSZA 4NL3A 1QW1A 5LJ3f 1WA7A 1NJIC 5EC7A 2VGMA 1HSQA 2E3IA 5HK0A 3MO8A 3MKDA 2KVQG 3R6NA 2CP6A 3CBOA 3RBBB 3HPWA 3CMET 2D9TA 1KQSA 3UATA 2QA4T 3VYHB 1M2OA 1XTDA 3V7SA 2HMAA 5GAN6 1NJIR 5FU6B 1O75A 2RJEA 5J3BA 3CXCS 1JXMA 4IKFA 1VQ7Q 1G3TA 3X24B 5GAN4 1PNJA 5CVIA 1KHIA 1BKBA 3NGPA 2ENMA 1JXOA 4KT0E 4PFOA 1ZSZC 4C92F 1VQ6T 6AT1B 4PFPA 1UGPB 2RMOA 5I11A 3SHWA 3MPUB 1WI7A 2X35A 5LJ5j 1B07A 1M5Q1 4RCCA 1VQ9Q 1YHQQ 2VASA 3VRZA 5FRNA 4HVUA 4K11A 2K5IA 3RUXA 2HEQA 3EG9A 1RI0A 1KSWA 3LWIA 1NYGA 2QA4Q 5C0MA 1RAHB 2HNIA 1H3HA 2EQIA 1I9GA 3I35A 5I2MA 1PM3A 1YJ9T 4KDIA 5KYUB 4M75C 1VQOA 3I55Q 1NEBA 2A36A 7AT1B 5GAOr 2DJZA 1YHQA 3M55A 3FRNA 3UA6A 2PWYA 1VQ5Q 1ZLMA 2OTLA 1N6AA 4BI4A 2EYYA 2RK1A 1AZGB 5CCXA 2GBQA 2ECZA 4GBQA 2P84A 2D8HA 1AOJA 3DB4A 2DBKA 1K8AC 4J5YA 5I21A 1YBYA 1K73C 1QCSA 2CZ6B 1Q86R 2KROA 2DD5A 2EGAA 3CMAA 2ATCB 4XTWA 2YSQA 1VQKA 2DL3A 2DBMA 3GBQA 1G3SA 1VQLT 4M75G 4R0KA 5DLQE 1YITT 1M3CA 3JRZA 1I07A 4PJMA 3U23A 3OYMA 1YJWA 4XU2A 4ZGEB 4ZN1A 1JO8A 3OY9A 4C5EA 2HDAA 5GAN8 1SHFA 2YUQA 3P8HA 1D1BA 3ZJUA 5CKDA 3JCMc 5GMKl 4JJCA 5EG2A 2PVDB 2EYQA 4ATOA 1VYTA 2E41A 1VQPT 4M78G 3F70A 1WQWA 2DLPA 2CZ7B 3BY7A 4OMLA 3VS1A 3X26B 3LWHA 1EX4A 2EYZA 4EDUA 1YITA 1M4ZA 3HU1A 4L6V5 4RTXA 4M7DG 4AMCA 1MGQA 1Q81U 3EFSA 4EMKA 1MUZA 1OX9A 4AS1A 1KHCA 5GJWB 2XD0A 4AFQC 2J05A 2VKNA 1ZX6A 1HJDA 3JV3A 3MEWA 2RHXA 2X4WA 5M9OA 3THKA 5IN1A 1JJ2P 3HP9A 1NBEB 4BY6C 3OS2A 5D6WA 2B25A 2K6DA 3CCQT 4J9HA 2DRMA 2O31A 3M0QA 1YHQT 5LJ5g 4XTVA 2COYA 2VUBA 1K9MC 3MB5A 1D0YA 5IHKA 2X3XD 5D7UA 4M77F 4F17A 1IXDA 4PJOB 3CC4T 3JCMQ 3E9FA 5GAMg 2RHIA 2ZPBB 3ASKA 3PIPA 2CP3A 2A0FB 3OW2A 4GLMA 5DM7R 3QWZA 1V29B 2JM9A 2OTJA 3OYEA 3OW2S 5KYNA 2C0TA 2MYSA 4C92E 4RG8A 2QQAA 2ZPFB 9ATCB 1HK9A 2FYKA 3OYCA 1TOVA 4M7AG 2HZYA 1WZOA 4FSSA 2QDYB 4BE1A 2RQUA 1PKSA 4M78A 4AG1C 4JS5A 4X9DA
chains in the Genus database with same CATH topology
3UWNA 2EQJA 3UT1A 1OI1A 1OZ2A 2VXEA 3MCAB 1BIAA 3HL8A 3NTHA 3QJYA 5GANd 5GAOp 3LLRA 4J7FA 3HU3A 3QYGB 4Q5WA 3RKYA 5DYIA 2FL7A 4RMOA 1S3SA 1M8VA 3GOXA 4MZTA 3RMQA 4C92B 3CC7A 1ZC1A 4M77D 1QVFA 4PJOD 3MEVA 1H3ZA 1E32A 3HHTB 4J7IA 3VV0A 2MAMA 4HKEA 4XTUA 4C0ZA 4C5HA 1LOJA 1KQ2A 2EFIA 4PJOG 2DAQA 2QEXA 2OTJT 5DY9A 5LJ3h 4MDWA 2K5FA 5C1BA 1I8FA 5GAOl 2K2VA 3FDRA 2XDDA 1NE8A 4IUQA 1RL2A 2ZCFB 4M77G 2EQKA 4DA4A 2D0QB 2R58A 5CKEA 3OYLA 1VQOT 4D6WA 3CCSA 3BDUA 3QJ6A 1Q82U 5B6CA 2P0QA 4LDVA 5C18A 3CCVT 3OB9A 3CCRT 3L2VA 4DOWA 4KUIA 1G3YA 2QXFA 5LJ3g 3M4YA 1PSFA 4QQ6A 4DQ2A 3OYGA 4JS4A 1W2BA 4PJOE 3FPRA 4XU0A 4A4HA 2K57A 4OGEA 5FTLA 1ZBXA 3HRSA 4IUPA 5GAOq 5CIUA 2XDPA 1Q7YC 2OTLT 1G5VA 2RHUA 4A53A 1X75C 3OSSC 3PTAA 3C12A 4BI8B 3G71T 4J83A 3SWNA 2PQWA 5GANg 1QVFS 2EIFA 1O54A 4KODA 4XTYA 2DO3A 5GAMf 3PMTA 3J7AF 1YJNT 2E1HA 2MWPA 1I4K1 1JJ2A 4X9CA 5LJ3d 5EQJB 3DB3A 2F5TX 1AHJB 2RHZA 4PLLA 3RERA 2YRVA 1O9SA 3P8BB 2YLCA 4M78E 1I81A 3CCET 3UDCA 2PVOB 1B34B 1Y71A 1YJ9A 2IG0A 3M57A 2L3RA 2JNGA 1Y07A 3OQ5A 3V7RA 3M59A 5LJ5e 1W4SA 2JTFA 4C92D 1YI2A 1VQ5T 2RM4A 5A0LA 3HRTA 1KD1U 2VC8A 4FT4A 2FVUA 1Q7YU 1S72A 4B9XA 2GQVA 4EMHA 3E19A 2DTIA 3QQ8A 2RK2A 3FPTA 4QVDA 1Q86C 5ERGB 3FB9A 1NPRA 3CPWA 4KULA 4JRIA 3TEEA 2DXCA 2P0PA 4JDSA 4M7AC 4BUGA 4PJOC 2E5QA 2WSCE 3RESA 2LRQA 1X6OA 5GAN2 4V2SA 3OS1A 2HQEA 4ARIA 2DEQA 3ME9A 3G6ET 3LX7A 1BI1A 3SD4A 4C8QE 2MWOA 5J26A 1VQ9A 1XNIA 3CMAT 3JB9D 4F7UA 4QVZA 3GP8A 4BACA 5CQXA 4ELZC 3NFCA 4C0DC 1N9SA 5KCHA 3KBGA 4LDUA 4X34A 4XTZA 1JRIA 2FB7A 2LQKA 4N4GA 3CCJT 4BDZA 1YIJT 4XQ3A 2JV2A 2WSEE 3JCMd 2LCCA 4EPCA 3C4SA 3A8HB 1UGRB 4J6XA 2FHDA 3HFNA 4M77E 2V8KA 1K9MU 2PUKB 1CR5A 2RI2A 2Q1CX 1EIFA 3WXMB 5J39A 5A0DA 4P5NA 5AYFA 1FWZA 4HCBA 1U1TA 3JCMP 3L2RA 3RKXA 3QQ7A 3URGA 4A54A 2IVWA 2LX9A 3FPUA 4E7HA 4OVAA 3QYHB 4A4GA 2EWNA 2DXTA 5CQYA 1Q82C 3E1SA 4GY5A 4MZPA 4Z02A 4M7DD 2V8JA 4ATOA 5EPPA 2V8IA 1KD1C 4M7DE 2Y4XA 4FSXA 1LNXA 3MP1A 4ZN3A 3ZJTA 3FC3A 3OYKA 3CCMT 2LC4A 4M7AB 1VQ4T 1VQ7T 2RJFA 3V8KA 5GMKj 2F69A 3I55T 2PVGB 5KCOA 1H641 4BI3A 4MMKA 3CBPA 4C8QG 3VYGA 4CI0C 2XI9A 2ZGWA 5FTMA 3LW5E 3RMSA 4PKCC 3JCMe 5GAOm 3CCJA 4ZTFA 4E7JA 3C95A 2ZPGB 3MHXA 3DLMA 4M75A 2DIGA 2R57A 2YLBA 1X01A 2DKGA 3FIFA 4N0AA 5A2QE 1VIEA 4M75F 5KE2A 3A8GB 4HCCA 4J8OA 1VQ8T 3TREA 5GAMh 4IURA 2QQRA 3JCMW 3PFSA 3OYDA 1NJIU 4XTXA 4C8QD 3JB9I 1NPPA 2XDBA 2Q1DX 1WJRA 3KUFA 3S3NA 5FU6C 4C8QA 1UEBA 2MF2A 4BE0A 1U8RA 1I5LA 2QQBA 2RI3A 2R5AA 3JCMJ 4C5IA 4M78C 4OP0A 2B8AA 5FU7B 1VQ8A 3RKWA 4C8QB 5CAIA 1FX7A 1IREB 2DXBA 2KSSA 2M9UA 4FT2A 4M75D 3GIBA 2EQMA 4J6WA 3VKIA 4EMKB 2P4TA 3QO3A 5A0GA 4KUDK 2YHTA 1KG1A 5GANj 4N4HA 3A5ZB 4GLKA 4BD3A 4RKUE 3JSCA 3OMCA 2ZZDA 4A4EA 3SWNB 2G3RA 3QBYA 3LH0A 4JRKA 3A8LB 5DLOA 1SSFA 1VQ6A 1BYMA 1BI2A 4F7UF 4M77B 1WJQA 1G3WA 2KMTA 2LCLA 2CYZB 3GF5A 5CK9A 1VQ4A 4M7AD 5CD1A 5GAN3 5GAOn 3ZGZA 4YTLA 2BIVA 1K73U 1NZ9A 2LVMA 5GAMd 5GAN5 3G71A 2QQ9A 4NL2A 1QDNA 4PJOF 5FTNA 4QQDA 1QW1A 5GMKe 4NL3A 5L8RE 2K3XA 5LJ3f 4JRPA 2E65A 4M77C 5CKHA 1ZQ1A 4IUVA 1NJIC 4M7DF 3DKMA 1M90U 3BDLA 3MEUA 2VGMA 2K5LA 3I56A 4M7AA 5HK0A 4M7DB 4E7KA 4J6YA 4N4IA 2PUOB 3SB2A 2AHJB 3MO8A 1D3BB 2QA4A 3LGFA 2KVQG 1XQHA 3CMEA 3CBOA 4XK8E 5GMKm 3OYHA 3HSBA 1DJ7B 2EJFA 3QIIA 3HPWA 3PNWC 3CMET 2D9TA 2F5KA 3QZ5B 1KQSA 1D3BA 1QP3A 2VV5A 3I55A 3VYHB 4M78B 2QA4T 3OS0A 2KY9A 1XTDA 3JB9F 3V7SA 3MP6A 5GAN6 4F7UB 4B9WA 5FU6B 1O75A 2LT1A 3H8ZA 2RJEA 3L2QA 4KBMB 4BB7A 1WPYA 2KQWA 5J3BA 3CXCS 4FU6A 2P0KA 2RJDA 3FJPA 3I56T 3QC8A 4BDYA 5LJ5d 4IKFA 2DD4A 4II1A 3CPWS 3JCMh 3JB9J 4M7AE 3OBYA 1TH7A 5GAN7 1G3TA 2VGNA 3X24B 5GAN4 5CVIA 1KHIA 4C92A 4FIBA 1BKBA 1KQ1A 4RCBA 4KT0E 2Q1AX 2X4JA 4C92F 3QXEB 4C92G 1VQ5A 1M90C 1VQ6T 1R7RA 4OB1B 4WF2A 3UPUA 3PMIA 4LD6A 3CCEA 2XHCA 1UGPB 1JBMA 2A7YA 2HD0A 2X35A 5LJ5j 1Y7XA 4F7UE 1M5Q1 2NLUA 4RCCA 2X4XA 3SWNC 2JZ2A 3OYFA 1JJ2S 5FLXE 5FRMA 3CXCA 4O5VA 4DOVA 3AHUA 4OMFB 3N5BB 2R5MA 1BIBA 2E12A 3WVDB 5FRNA 1Y96A 2XIDA 4M77A 2K5IA 4QVCA 3GNGA 1Q86U 1GXIE 3JB9H 3JB9G 3RUXA 2EQUA 4ZTJA 1WLFA 4PL6A 3L1AA 3JCMg 3JAME 5D6XA 1RI0A 2RB6A 1S72T 3EAEA 4HCZA 3LWIA 4F7UG 3X25B 5C0MA 4A4FA 2HNIA 3CCRA 1I9GA 5I2MA 1UB4A 4M7DA 1YJ9T 4KDIA 3CCST 2BKDN 4M75C 1VQOA 1OZ3A 2RD1A 5C6SA 4ARCA 1KQSS 4N0AC 2E6ZA 4BE2A 3QSUA 1LJOA 3TCJA 4KDLA 4OF1A 2YVLA 4CRIA 4EMGA 4OB2B 5GAOr 1PSEA 1WQ7A 2MM2A 2DPPB 4XU1A 4E47A 3NTKA 5HY6A 1VQ7A 1JB0E 3ER0A 4EMKC 1VQNA 2GF7A 3CCMA 4E7IA 4KO8A 2DJZA 2QI2A 1M1FA 3CF2A 2C06A 4C8QC 1YHQA 3M55A 4PNOA 3FRNA 2PWYA 4L5GA 4MZMA 2CGHA 2PU9B 2OTLA 1N6AA 2I2LA 2CZ0B 4FM4B 4ZGDB 2PJHB 2HBPA 4BI4A 4HT9A 3P8DA 3S3MA 1N8RU 4M7AF 3OYAA 2RK1A 3E9GA 5CCXA 4IUUA 3G4ST 1VQPT 4Y91A 2HQXA 3L42A 5GANf 1N9RA 2WACA 1Q81C 5LL6S 3H6ZA 2RA2A 3DB4A 3FEOA 4PLIA 3CC2T 2Y4YA 2MI6A 1YIJA 1K8AC 2L8DA 4J5YA 3KXTA 5I21A 1YBYA 5GMKi 1K73C 2QTXA 3VU3C 1QCSA 2CZ6B 3OYIA 2DD5A 3CMAA 4Y28E 5GMKh 1B34A 1QP2A 2LQ8A 2CKKA 3VJPA 4XTWA 1VQ9T 3CCLA 3G6EA 3CC7T 1VQKA 5FTJA 1VQLT 1G3SA 2YUJA 3BFMA 1U1SA 4M75G 5LJ5h 4AQ7A 2E64A 3HFOA 5DLQE 4XAXB 5CCAA 2ZPHB 2RH2A 1Y96B 2XU8A 4R56A 1YITT 3RIRA 3JRZA 4LD9K 5FTKA 1YCYA 3QZ9B 1BI3A 4QW2A 2X4YA 4UC4A 3OYMA 3OA6A 4VUBA 3ZFJA 4XU2A 4ZGEB 1YJWA 5CCBA 4RG2A 3OYBA 2MMPA 3NTIA 3OS5A 3QG1A 3V8LA 4ZN1A 3OY9A 1YI2T 4C5EA 1QVGA 3CD6T 5GAN8 2XICA 3C94A 3DLLA 3P8HA 2LDMA 4HA8A 3A8OB 2LTOA 2ZPEB 1KC8C 3GLXA 3QHSA 4OGCA 4TVRA 3M9QA 3ZJUA 5CKDA 5LJ5f 2E6NA 1UGQB 3MEAA 3JCMc 2KDSA 3OYYA 4C5GA 5GMKl 3BQBA 3VUZA 1UGSB 5EG2A 2DVEA 1YJNA 1W2BS 3LGAA 2PVDB 2EYQA 2VXFA 1OYXA 2VYTA 5HK3A 2XK0A 3JCMb 2E41A 3OSVA 3M4GA 4FL6A 3F70A 2E10A 3EFRA 3Q1JA 2EJ9A 4M78G 1VQMT 2Q18X 3OMGA 1WQWA 3QUIA 4M75E 5GANh 5IT9E 2CZ7B 3BY7A 2LW6A 5D6YA 1HXDA 3X26B 3LWHA 1M1KC 2EAYA 3L2WA 2GFAA 3M5AA 3MP8A 2JVVA 4C92C 3SDZA 1BI0A 1QVPA 4EDUA 1M4ZA 2H3JA 1YITA 3HU1A 4ELYC 4L6V5 3V7CA 3CC4A 1ZHIA 2EKOA 2CZ1B 5KH6A 3X28B 4M7DG 4HT8A 3ZBDA 4OB3B 3PIOA 3CCVA 1VUBA 1MHNA 1QVGS 1MGQA 1Q81U 5DYGA 4NOYA 3EFSA 3CCLT 4EMKA 3TIWA 3QDRB 3JCMV 4AS1A 1KHCA 2DZ9A 4LDWA 2GFUA 4M78F 4MDXA 3GNFB 2XD0A 2DZCA 2RO0A 2LT4A 3BW1A 3OBWA 4ZGJB 2M16A 2QEXT 3M58A 3GPLA 3CC2A 4OB0B 1WGSA 1M1GA 3QPHA 1XOVA 5FROA 3ZJVA 5GLFA 3SFMA 3MEWA 4O6JA 2DXUA 2RHXA 2X4WA 3G4SA 3LGLA 2QQSA 4C0FA 5M9OA 3ZEHA 1CZ4A 2CS7A 5IN1A 2OAUA 3HP9A 4BY6C 2DK3A 3HRUA 2WSFE 2O4XA 5HKCA 5CR2A 3OS2A 2MM0A 5D6WA 3L2UA 3CPFA 5LJ3j 2B25A 3CCQT 4LDYA 4XU3A 3S6WA 2K3YA 1YHQT 3R6OA 4C8QF 1KC8U 1M1KU 2D6FA 1VQMA 5LJ5g 3WVEB 4XTVA 2RHYA 2A3LA 2O4XB 3M54A 1VQPA 1VQNT 2Q19X 2GCXA 2VUBA 5CKFA 1K9MC 5IAYA 3FLGA 3MB5A 4CQNA 3A8MB 3META 3CCUT 4JLGA 3VUBA 5GAMe 2RI5A 4M77F 4M7DC 3INZA 3LYIA 3PGGA 2ZPIB 3OYJA 4RV0A 2JTMA 3CEYA 2KK4A 5GANe 3CD6A 3S3OA 5I2SA 5CO7A 4PJOB 3X20B 4M75B 3JCMX 3CC4T 1YJWT 3JCMQ 4C0GA 3E9FA 2K4YA 5FU7C 4C0DB 2M0OA 2JUFA 5GAMg 1N27A 3G7ZA 3OYNA 2RHIA 2O01E 2ZPBB 3M56A 1VIFA 3ASKA 2L89A 3PIPA 4NS5A 3PT9A 4PJOA 1P92A 1R8OB 3T9NA 3OW2A 2M1HA 3TU4K 2DIQA 4MMLA 5LJ3e 2EJGA 5DM7R 4JUVA 1VQLA 2BUDA 2HAXA 4BY6B 1M9SA 4A4KA 3QWZA 2LNVA 1VQKT 1V29B 3V8JA 2OTJA 3OYEA 2DTHA 4KLNA 3OW2S 3M53A 3JCMf 4C92E 4RG8A 5CKBA 1IZ6A 2QQAA 3O8VA 4QQGA 3J80E 2ZPFB 3CCUA 3J81E 2RJCA 5KE3A 2JOYA 1HK9A 1WJSA 2XG8D 3QKJA 1N8RC 4M78D 2FYKA 4L59A 4JJNK 4LDXA 3OYCA 1FXXA 2XKOC 4M7AG 4ME7A 4E7LA 2Y90A 3HKSA 2QDYB 5GAMj 4BE1A 1WNLA 1K8AU 3HU2A 1CZ5A 3CBMA 2E70A 2L5QA 4JRQA 2JN0A 4JLIA 2KAFA 4M78A 4R55A 3LHDA 4X9DA 3CCQA 4JS5A 3L2ZA 4IUTA 2DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP1 A;  4LD6 A;  2VYT A;  1OYX A;  3UWN A;  2EQJ A;  2XK0 A;  3FC3 A;  4FL6 A;  3UT1 A;  3OYK A;  3F70 A;  1OI1 A;  1OZ2 A;  3Q1J A;  2X35 A;  3NTH A;  3OMG A;  2RJF A;  3LLR A;  2NLU A;  4Q5W A;  5D6Y A;  5KCO A;  2X4X A;  2JZ2 A;  3OYF A;  5FRM A;  3L2W A;  2GFA A;  3GOX A;  3MP8 A;  4ZTF A;  1H3Z A;  3MEV A;  2R5M A;  5FRN A;  4E7J A;  4EDU A;  3DLM A;  2DIG A;  2R57 A;  4C5H A;  2EFI A;  2DAQ A;  2EKO A;  2EQU A;  5KE2 A;  4PL6 A;  5KH6 A;  4ZTJ A;  1MHN A;  3FDR A;  5D6X A;  1RI0 A;  4IUQ A;  4IUR A;  2QQR A;  3PFS A;  3OYD A;  2EQK A;  2R58 A;  3OYL A;  3EAE A;  4HCZ A;  1KHC A;  3QJ6 A;  2GFU A;  1WJR A;  3KUF A;  3OB9 A;  5C0M A;  4A4F A;  3S3N A;  4BE0 A;  3L2V A;  2RO0 A;  2RI3 A;  2M16 A;  2R5A A;  4QQ6 A;  4C5I A;  3OYG A;  2BKD N;  1WGS A;  1OZ3 A;  4A4H A;  5C6S A;  2B8A A;  5FRO A;  4BE2 A;  4IUP A;  5CIU A;  3MEW A;  2XDP A;  1G5V A;  2RHX A;  2RHU A;  2X4W A;  4CRI A;  2EQM A;  3LGL A;  2QQS A;  5M9O A;  3NTK A;  3ZEH A;  5IN1 A;  2GF7 A;  4N4H A;  4E7I A;  2PQW A;  3OS2 A;  2O4X A;  4BD3 A;  3OMC A;  4A4E A;  5D6W A;  3L2U A;  3PMT A;  2G3R A;  2MWP A;  3LH0 A;  3QBY A;  1SSF A;  3S6W A;  2K3Y A;  3DB3 A;  4IUT A;  2RHZ A;  1WJQ A;  4PLL A;  2YRV A;  2RHY A;  2BIV A;  2O4X B;  3P8D A;  2LVM A;  3S3M A;  3OYA A;  3E9G A;  2IG0 A;  4QQD A;  2L3R A;  2K3X A;  4IUU A;  3OQ5 A;  2JTF A;  5IAY A;  2HQX A;  4IUV A;  3FLG A;  3BDL A;  3L42 A;  3MET A;  3MEU A;  2WAC A;  4B9X A;  3H6Z A;  2RI5 A;  3DB4 A;  3FEO A;  3LYI A;  4PLI A;  3OYJ A;  4N4I A;  4E7K A;  2L8D A;  3CEY A;  3S3O A;  3MO8 A;  2E5Q A;  3LGF A;  2LRQ A;  3E9F A;  3OS1 A;  2HQE A;  2M0O A;  1N27 A;  2CKK A;  3OYN A;  2RHI A;  3OYH A;  3ME9 A;  3LX7 A;  3SD4 A;  2MWO A;  3ASK A;  2L89 A;  3PNW C;  3QII A;  5J26 A;  2F5K A;  2D9T A;  1XNI A;  4NS5 A;  4QVZ A;  2M1H A;  2DIQ A;  3OS0 A;  4BAC A;  2BUD A;  3MP6 A;  5KCH A;  3OYI A;  4X34 A;  4BDZ A;  4B9W A;  4N4G A;  3H8Z A;  2RJE A;  3OYE A;  3L2Q A;  2LCC A;  3C4S A;  2FHD A;  2X4Y A;  4FU6 A;  4QW2 A;  2P0K A;  2RJD A;  3O8V A;  4QQG A;  4UC4 A;  3OYM A;  3OA6 A;  4BDY A;  2RJC A;  4RG2 A;  5KE3 A;  1WJS A;  2RI2 A;  3NTI A;  4II1 A;  3QKJ A;  3OY9 A;  3OYB A;  4IKF A;  4C5E A;  5J39 A;  4L59 A;  3OYC A;  3P8H A;  2LDM A;  3L2R A;  2LTO A;  4E7L A;  4BE1 A;  4E7H A;  4OVA A;  3M9Q A;  4A4G A;  2E6N A;  3MEA A;  4GY5 A;  4Z02 A;  4C5G A;  3PMI A; 
#chains in the Genus database with same CATH topology
 2CSI A;  3G1J A;  1YWP A;  3MCA B;  3QJY A;  5IHN A;  1X2K A;  3RKY A;  5DYI A;  4RMO A;  2D0N A;  4MZT A;  3RMQ A;  3CC7 A;  1QVF A;  1NLO C;  4HKE A;  1ZUK A;  4XTU A;  4C0Z A;  2GQI A;  1E6G A;  2QEX A;  5C1B A;  3FDR A;  1WHJ A;  1SHG A;  1RL2 A;  4M77 G;  2ABL A;  5B6C A;  5C18 A;  1RLQ C;  4CC3 A;  1VQL Q;  1G3Y A;  4DQ2 A;  3OYG A;  1ABQ A;  1Y0M A;  3BE3 A;  3I56 Q;  4A53 A;  1AEY A;  1X75 C;  1ZBJ A;  3OSS C;  3PTA A;  2F2V A;  1I4K 1;  1QVF P;  1WHM A;  4RTV A;  1S1N A;  2F1L A;  1D1C A;  4M78 E;  3CCE T;  3CC2 Q;  1B34 B;  5LJ5 e;  1VQ5 T;  1W4S A;  1W2B P;  2RQW A;  1IRX A;  4B9X A;  3QQ8 A;  4QVD A;  4LUE A;  2WSC E;  1BBZ A;  3RES A;  4V2S A;  3ME9 A;  3G6E T;  5J26 A;  1VQ9 A;  4QVZ A;  1WHH A;  4BAC A;  1Z9Q A;  5KCH A;  4X34 A;  4BDZ A;  2WSE E;  4EPC A;  3A8H B;  2FHD A;  1QCO A;  5A0D A;  1U1T A;  3JCM P;  3L2R A;  1OU8 A;  4A54 A;  2A37 A;  3QYH B;  5CQY A;  2DXT A;  2V8J A;  2Y4X A;  4QT7 A;  1LNX A;  3OW2 P;  2LC4 A;  2RJF A;  3D7S B;  1E7O A;  2FPE A;  3VYG A;  5FTM A;  2XI9 A;  4JZ3 A;  4PKC C;  3MHX A;  3EG9 B;  2DKG A;  4FW2 A;  5A2Q E;  2V1R A;  4FYY B;  1S72 Q;  3A8G B;  4HCC A;  4IUR A;  3JCM W;  3OYD A;  1QCN A;  4LUD A;  3JB9 I;  3S3N A;  4C8Q A;  1U8R A;  4BE0 A;  2L3P A;  2YWW A;  1D0Z A;  2KGT A;  4C5I A;  4M78 C;  5CAI A;  2CP0 A;  4FT2 A;  1WXU A;  4J6W A;  3A5Z B;  4GLK A;  2QGG A;  2MOX A;  2SEM A;  1BI2 A;  5CK9 A;  2BIV A;  4HCK A;  1K73 U;  1NZ9 A;  2LVM A;  5GAM d;  3G71 A;  4PJL A;  2QQ9 A;  1YJW Q;  2FRY A;  4HXJ A;  5L8R E;  5L23 A;  2E65 A;  5CKH A;  1ZQ1 A;  3DKM A;  3MEU A;  2K5L A;  1N5Z A;  3VS6 A;  2DEU A;  1H8K A;  1Q81 R;  2BE7 D;  2GTJ A;  2NYS A;  1Q95 G;  1D3B B;  1IGU A;  2A08 A;  3LGF A;  3OYH A;  2HKN A;  1MMN A;  2F5K A;  1R0C B;  3JB9 F;  4B9W A;  1YIT Q;  2LT1 A;  1VQ8 Q;  4KBM B;  2CT3 A;  2KQW A;  3I56 T;  3LH5 A;  4BDY A;  5LJ5 d;  3EGX A;  2DD4 A;  3CPW S;  3JB9 J;  3OBY A;  1KJW A;  1CKB A;  4C92 A;  3EGD B;  4C92 G;  1VQ5 A;  1M90 C;  1R7R A;  4OB1 B;  1K0X A;  3PMI A;  3M0T A;  3CCE A;  1JBM A;  1WXT A;  1RAF B;  1VQN Q;  2X4X A;  1U3O A;  2JZ2 A;  3OYF A;  5ECA A;  4Z8A A;  2R5M A;  2E12 A;  3H0F A;  1Q86 U;  3GNG A;  1GXI E;  3JB9 G;  4ZTJ A;  2M0Y A;  1WLF A;  2L2P A;  3L1A A;  1RI9 A;  3UF4 A;  2RB6 A;  5KYW A;  3X25 B;  4M7D A;  2BKD N;  1OZ3 A;  1KQS S;  4N0A C;  2E6Z A;  1LJO A;  4JZ4 A;  4OF1 A;  2YVL A;  3HTR A;  4CRI A;  4OB2 B;  4XU1 A;  5HY6 A;  2KR3 A;  1JB0 E;  4EMK C;  1VQN A;  4KO8 A;  1K8A R;  2QI2 A;  2QAZ A;  3CF2 A;  2C06 A;  1MMA A;  1OOT A;  4MZM A;  4ZNX A;  2CGH A;  2PU9 B;  1RAC B;  4FM4 B;  1JQQ A;  2PJH B;  3P8D A;  3S3M A;  1N8R U;  4M7A F;  4IUU A;  2CP2 A;  2DYB A;  2VWF A;  2HQX A;  5GAN f;  3QWX X;  1QVG P;  3FEO A;  4PLI A;  3CC2 T;  2L8D A;  2LCS A;  1NLP C;  1RAI B;  3VU3 C;  5IH2 A;  2J6K A;  4RTZ A;  1TWB A;  3CC7 T;  2DA9 A;  2YUJ A;  3UA7 A;  2OX7 A;  5CCA A;  4LD9 K;  1TUC A;  1UTI A;  1BI3 A;  4QW2 A;  2X4Y A;  1FMW A;  2DET A;  3OA6 A;  3ZFJ A;  2MMP A;  3OS5 A;  1WDX A;  3V8L A;  1YI2 T;  1QVG A;  3DLL A;  2LTO A;  1AT1 B;  2KRN A;  1KC8 C;  4Z88 A;  3QHS A;  2X51 A;  3RNJ A;  4KDL A;  1PKT A;  4C5G A;  3BQB A;  1UGS B;  1YJN A;  2VXF A;  1TS9 A;  2VYT A;  5HK3 A;  3JCM b;  3OSV A;  4FL6 A;  2OTJ T;  3AT1 B;  2Q18 X;  2EJ9 A;  1XJW B;  3NMZ C;  2NUT B;  2EAY A;  3M5A A;  2JVV A;  1WHL A;  3CCL Q;  3EHQ A;  4ELY C;  3V7C A;  3CC4 A;  1ZHI A;  1GBQ A;  2EKO A;  2KNB B;  3X28 B;  4HT8 A;  3ZBD A;  1QVG S;  3CCV A;  4NOY A;  3CCL T;  1G8X A;  3QDR B;  3QWY A;  3JCM V;  4LDW A;  2GFU A;  4M78 F;  2RO0 A;  2LT4 A;  3BW1 A;  3OBW A;  3M58 A;  1M1G A;  1YJN Q;  1XOV A;  5FRO A;  2DIL A;  3G4S A;  2QQS A;  1CZ4 A;  4CC7 A;  3ZEH A;  4QKU A;  2HL5 C;  3HRU A;  1C0M A;  1SRM A;  4D8D A;  1M1K U;  2A3L A;  2O4X B;  2RPN A;  1VQP A;  2BZY A;  2GCX A;  1JU5 C;  3M0S A;  3FLG A;  4CQN A;  3MET A;  3CCU T;  2ED1 A;  4M7D C;  3EHR A;  2LX7 A;  3OYJ A;  2KK4 A;  3S3O A;  3JCM X;  2LJ1 A;  3TVT A;  1YJW T;  2KRS A;  1N27 A;  1OQK A;  2GGR A;  1NG2 A;  3RDV A;  1R77 A;  3PT9 A;  2KYM A;  1AD5 A;  1VQL A;  2BUD A;  3E2U A;  1M9S A;  1VQK T;  2BZX A;  3V8J A;  3I5R A;  5CKB A;  2ESW A;  1IZ6 A;  3CCU A;  1PC0 A;  3J81 E;  2RJC A;  5KE3 A;  2XG8 D;  2QGF B;  1K9A A;  1CZ5 A;  1AVZ C;  2HL3 A;  2JN0 A;  4R55 A;  3L2Z A;  4M7A A;  3UWN A;  1OEB A;  2EQJ A;  3UT1 A;  1OZ2 A;  3EG0 A;  2F2X A;  5GAN d;  3HU3 A;  4Q5W A;  2O88 A;  2FL7 A;  3QDF A;  1S3S A;  1M8V A;  4C92 B;  4M77 D;  4PJO D;  3MEV A;  3HHT B;  4J7I A;  3VV0 A;  1KQ2 A;  1LOJ A;  1GL5 A;  2EFI A;  2DAQ A;  5LJ3 h;  4MDW A;  1UHC A;  2K5F A;  3CCU Q;  1I8F A;  1T0J A;  2OJ2 A;  1SRL A;  5GAO l;  2EW3 A;  2ZCF B;  4DA4 A;  2D0Q B;  1VQO T;  3I5S A;  4D6W A;  3QJ6 A;  1H92 A;  4LDV A;  3CCV T;  1X69 A;  2DRK A;  3CXC P;  1W6X A;  2QXF A;  1IB8 A;  4AT1 B;  4A4H A;  2EYX A;  4OGE A;  5FTL A;  1ZBX A;  3HRS A;  4IUP A;  2J7I A;  5CIU A;  1SKU B;  1D0X A;  1Q7Y C;  2OTL T;  1AWJ A;  4OMM A;  1QLY A;  2OTJ Q;  1O54 A;  4XTY A;  2DO3 A;  4DEY A;  1YJN T;  1X27 A;  2E1H A;  5LJ3 d;  1AHJ B;  1N8R R;  4PLL A;  2FPF A;  3G6E Q;  2D8J A;  4A63 B;  5KYU A;  3P8B B;  4J9F A;  1YJ9 A;  2IG0 A;  1V76 A;  2L3R A;  2JNG A;  1Y07 A;  3M59 A;  1YI2 A;  4PJJ A;  5I22 A;  4RTT A;  2E3H A;  3FB9 A;  3CPW A;  2KBT A;  4JDS A;  1MMD A;  4ARI A;  1X6O A;  1TU0 B;  1WLP B;  3LX7 A;  1BI1 A;  1QMC A;  3EFO A;  1SF9 A;  3GP8 A;  4ELZ C;  2GTO A;  2LW6 A;  1N9S A;  3KBG A;  1T0H A;  4LDU A;  8AT1 B;  3CCJ T;  1M27 C;  4J6X A;  2AZV A;  2PUK B;  2RI2 A;  1UDL A;  5AYF A;  1FWZ A;  2NUP A;  3QQ7 A;  3RKX A;  2IVW A;  4E7H A;  1OPL A;  3E1S A;  4GY5 A;  4MZP A;  4M7D D;  1KD1 C;  1PD1 A;  4M7D E;  4FSX A;  2JW4 A;  3FC3 A;  1WIE A;  3I9Q A;  4M7A B;  1UHF A;  2PVG B;  5KCO A;  1H64 1;  2KXC A;  3ULR B;  3REA B;  4C8Q G;  1NYF A;  2ZGW A;  4ZTF A;  5GAO m;  4IIO A;  2FZG B;  2ZAE A;  2MPX C;  4M75 A;  1TG0 A;  2R57 A;  2YLB A;  4LXC A;  2JTE A;  4M75 F;  5KE2 A;  3CCM Q;  3TRE A;  1SG5 A;  4HVW A;  3PFS A;  4RTW A;  4XTX A;  4C8Q D;  1NPP A;  8ATC B;  4DBQ A;  5KYX B;  3EG1 A;  1LPL A;  2AK5 A;  2KYB A;  2QQB A;  2R5A A;  3JCM J;  1VQ8 A;  1KC8 R;  5FWB A;  3RKW A;  4C8Q B;  1IRE B;  2M9U A;  3VKI A;  2ROT A;  3QO3 A;  4J9D A;  5A0G A;  1KG1 A;  4N4H A;  2V1Q A;  4RKU E;  3JSC A;  1K0S A;  1VYV A;  3A8L B;  3H0H A;  1SSF A;  1WJQ A;  2CYZ B;  1VQ4 A;  5GAO n;  4YTL A;  5GMK e;  2DFU A;  2K3X A;  1LVK A;  4M7D F;  3I56 A;  2YDL A;  2PTK A;  3G4S Q;  4M7D B;  4J6Y A;  4N4I A;  2LZ6 B;  2AHJ B;  2NUT A;  2OAW A;  3NHN A;  1RAG B;  1XQH A;  2H8H A;  1GCP A;  1DJ7 B;  2EJF A;  3HSB A;  1MV3 A;  3PNW C;  2O9V A;  3QZ5 B;  1VQP Q;  1D3B A;  4M78 B;  1GCQ A;  3SEM A;  2LNH B;  2RNA A;  3L2Q A;  1RUW A;  3KFV A;  4FU6 A;  2DL5 A;  3RR6 A;  2P4R A;  4PK4 A;  1TH7 A;  4M7A E;  2VGN A;  2AKK A;  4FIB A;  1KQ1 A;  3EH2 A;  4RCB A;  3QXE B;  4WF2 A;  3UPU A;  2K9G A;  2XHC A;  2HD0 A;  4KRT A;  4F7U E;  2NLU A;  1K73 R;  2DVJ A;  3AHU A;  5FLX E;  1YWO A;  5FRM A;  4O5V A;  4DOV A;  2X9H A;  1G83 A;  1BIB A;  4JPB W;  3WVD B;  2NUZ A;  4M77 A;  3JB9 H;  2EQU A;  3IQL A;  1VOM A;  3JCM g;  3JAM E;  3EFO B;  5D6X A;  2DX1 A;  4PJN A;  2CDT A;  1S72 T;  3EAE A;  1GRI A;  4HCZ A;  2EPD A;  4F7U G;  4A4F A;  1UB4 A;  2V26 A;  2RD1 A;  1YN8 A;  1IHV A;  3TCJ A;  2DL4 A;  1OX8 A;  2LMJ A;  1WQ7 A;  2QTV A;  2MM2 A;  1M3A A;  4E47 A;  5AT1 B;  1FMV A;  3ER0 A;  1PG5 B;  2GF7 A;  4E7I A;  1M1F A;  4C8Q C;  4WCI A;  2I2L A;  2CH4 W;  2HBP A;  4IIM A;  2JJ9 A;  1ZA1 B;  5KYW B;  1FMK A;  4OMN A;  4DBF A;  2CT4 A;  4Y91 A;  1B7T A;  2M51 A;  3MJX A;  4Y92 A;  4D8K A;  1N9R A;  5LL6 S;  3H6Z A;  1YP5 A;  1ZUU A;  2FZK B;  2MK5 A;  3KXT A;  1V1C A;  3CQT A;  2QTX A;  3CC4 Q;  4E6R A;  4Y28 E;  3EG3 A;  5GMK h;  2LQ8 A;  3EH1 A;  3VJP A;  1VQ9 T;  3G6E A;  4KH1 B;  1F1B B;  1U1S A;  4AQ7 A;  5LJ5 h;  2E64 A;  3HFO A;  2RH2 A;  1Y96 B;  3QZ9 B;  4M4Z A;  4VUB A;  3QG1 A;  1Y57 A;  3CD6 T;  1ZUY A;  2L3S A;  2XIC A;  3H0I A;  2LDM A;  4HA8 A;  2ZPE B;  4F04 B;  4OGC A;  3M9Q A;  1GFC A;  3LHD A;  1UGQ B;  3MEA A;  2KDS A;  4FYW B;  3M0U A;  1W2B S;  1NEG A;  2L0A A;  2FRW A;  4M75 E;  3QUI A;  5IT9 E;  5GAN h;  4Z89 A;  3CD6 Q;  5D6Y A;  1HXD A;  1M2V B;  2A28 A;  2QK0 A;  1M1K C;  2GFA A;  3MP8 A;  4C92 C;  3SDZ A;  1QVP A;  2NUP B;  1WYX A;  1BU1 A;  4RTU A;  1UE9 A;  2CZ1 B;  5FW9 A;  5KH6 A;  2J6F A;  4OB3 B;  2IPO B;  1M8M A;  5DYG A;  1WX6 A;  2DZ9 A;  4MDX A;  3GNF B;  3PVL A;  1OU9 A;  4ZGJ B;  2QEX T;  2M16 A;  4OB0 B;  1WGS A;  1KIK A;  2JMC A;  1QKW A;  3ZJV A;  5GLF A;  2RQR A;  2DXU A;  3LGL A;  2DK3 A;  5CR2 A;  2WSF E;  2MIO A;  2O4X A;  5HKC A;  3L2U A;  4XU3 A;  2HQH A;  2JMA A;  3CME Q;  3S6W A;  2K3Y A;  3R6O A;  4KGX B;  5KYY A;  2D6F A;  1VQM A;  2RHY A;  2AIR B;  4LN2 A;  1MV0 B;  5IAY A;  2O9S A;  3A8M B;  4JLG A;  3VUB A;  1X2Q A;  5GAM e;  2RI5 A;  1YCS B;  3INZ A;  3LYI A;  2QAS A;  2ZPI B;  3PGG A;  4ANJ A;  4FYV B;  4RV0 A;  5GAN e;  2EGE A;  2VB6 A;  5I2S A;  2PNI A;  5CO7 A;  4M75 B;  2C0O A;  2MCN A;  3CC7 Q;  4C0G A;  2K4Y A;  4C0D B;  2M0O A;  4NS5 A;  2X3W D;  4WTO B;  1KQS P;  4PJO A;  1R8O B;  2K7A A;  4JJD A;  4LNP A;  4MML A;  2JT4 A;  2EJG A;  2M1H A;  5LJ3 e;  1X43 A;  2DTH A;  4KLN A;  3M53 A;  3JCM f;  3O8V A;  4QQG A;  2XMF A;  1WJS A;  1UJ0 A;  3QKJ A;  4L59 A;  4JJN K;  2DL7 A;  4LDX A;  1FXX A;  1I5O B;  4E7L A;  2SRC A;  2Y90 A;  1WNL A;  1OV3 A;  1NM7 A;  4DBH A;  4KGZ B;  2FEI A;  3HU2 A;  2L5Q A;  4JRQ A;  3FJ5 A;  1SSH A;  3PE0 A;  4JLI A;  2DL8 A;  3PVQ A;  3CCQ A;  2KT1 A;  2DTO A;  1M90 R;  1AWX A;  2F2W A;  1OI1 A;  2VXE A;  2YRC A;  1BIA A;  3NTH A;  5GAO p;  3LLR A;  2RQT A;  4J9E A;  1FYN A;  3QYG B;  1MND A;  3VS2 A;  2ED0 A;  3GOX A;  1T3S A;  1H3Z A;  1E32 A;  1U5S A;  2MAM A;  4C5H A;  1B3Q A;  2E5K A;  2FG0 A;  1VQ4 Q;  5DY9 A;  1RLP C;  2LP5 A;  1G2B A;  1GBR A;  4IUQ A;  5KYX A;  2EQK A;  3CCS A;  1Q82 U;  3TQ7 P;  2CH4 A;  5IXF A;  3CCR T;  1IHW A;  2K3B A;  4DOW A;  4KUI A;  5LJ3 g;  1Z9Z A;  1PSF A;  4PJO E;  1W2B A;  2K57 A;  3CCQ Q;  1EZZ B;  1VA7 A;  5GAO q;  4ESR A;  2FPD A;  2XDP A;  1G5V A;  4AFU C;  3C12 A;  4BI8 B;  5GAN g;  1QVF S;  4KOD A;  2EIF A;  3M0P A;  1YFN A;  2EBP A;  2K2M A;  4E7Z A;  1HYO A;  2RN8 A;  1T3L A;  2MWP A;  1OPK A;  3DB3 A;  2DM1 A;  2J06 A;  4EIK A;  2RHZ A;  2KRM A;  2YRV A;  2J6O A;  1U06 A;  1I81 A;  3EGD A;  2PVO B;  3M57 A;  3OQ5 A;  5A0L A;  1TSF A;  4FT4 A;  1Q7Y U;  2GQV A;  2DTI A;  2QYZ A;  3FPT A;  2OI3 A;  1Q86 C;  2BE9 B;  3VRY A;  1NPR A;  4OMQ A;  2DXC A;  4M7A C;  2E5Q A;  2LRQ A;  5GAN 2;  3OS1 A;  2HQE A;  2DEQ A;  3SD4 A;  2MWO A;  1XNI A;  4OMO A;  3CMA T;  4F7U A;  5CQX A;  4C0D C;  3OYI A;  2YRD A;  1JRI A;  1TUD A;  2FB7 A;  2JM8 A;  2LQK A;  4N4G A;  4PFZ A;  4XQ3 A;  2JV2 A;  1QKX A;  2LCC A;  3VS0 A;  4M77 E;  2V8K A;  1K9M U;  4AFZ C;  1CR5 A;  1EIF A;  2COZ A;  3WXM B;  5J39 A;  4P5N A;  4HCB A;  2LJ0 A;  2IIM A;  2KI7 A;  3URG A;  3FPU A;  4Z02 A;  5EPP A;  4AFS C;  4ZN3 A;  3ZJT A;  2DER A;  3OYK A;  1CKA A;  3V8K A;  3I55 T;  3CBP A;  4CI0 C;  1EFN A;  3M0R A;  3RMS A;  2DF6 A;  3JCM e;  3CCJ A;  3C95 A;  2ZPG B;  2DIG A;  1X01 A;  1WHG A;  3EG2 A;  1BB9 A;  1Q7Y R;  4J9G A;  2XDB A;  1WJR A;  3KUF A;  4KH0 B;  2MF2 A;  4OMP A;  3A1P A;  2DNU A;  5FU7 B;  4B6M A;  1GCQ C;  2DXB A;  4M75 D;  3GIB A;  2EQM A;  4RTY A;  4KUD K;  2YHT A;  5GAN j;  2H3E B;  4BD3 A;  1SPK A;  2ZZD A;  3SWN B;  4JRK A;  3QBY A;  5DLO A;  1VQ6 A;  4M77 B;  5CD1 A;  3GF5 A;  5GAN 3;  1QDN A;  4NL2 A;  3A98 A;  4PJO F;  4QQD A;  1Q82 R;  2D1X A;  4JRP A;  4M77 C;  4IUV A;  1C1A A;  1M90 U;  3BDL A;  4E7K A;  2PUO B;  3SB2 A;  2W10 A;  1RAB B;  1AWO A;  3O5Z A;  2QA4 A;  1IGQ A;  3CME A;  1J3T A;  3CCV Q;  5GMK m;  4XK8 E;  1VQO Q;  3QII A;  2PZ1 A;  1QP3 A;  2VV5 A;  3I55 A;  3OS0 A;  2DYI A;  2KY9 A;  3MP6 A;  4F7U B;  3H8Z A;  4BB7 A;  1WPY A;  2P0K A;  2RJD A;  3FJP A;  3REB B;  3QC8 A;  2ROL A;  4II1 A;  3JCM h;  5GAN 7;  2NWM A;  3VS5 A;  2Q1A X;  2X4J A;  2DJQ A;  1TXQ A;  4LD6 A;  1MNE A;  2A7Y A;  1M2V A;  1Y7X A;  3SWN C;  1JJ2 S;  3CXC A;  4OMF B;  3N5B B;  1Y96 A;  1ZSZ A;  2XID A;  4QVC A;  2RQV A;  1VQK Q;  1VQM Q;  4PL6 A;  2VVK A;  1IO6 A;  2YUN A;  1E6H A;  1M30 A;  1TTH B;  4DEX A;  2LJ3 A;  3CCR A;  3CCS T;  4ARC A;  5C6S A;  4BE2 A;  4DBR A;  4F16 A;  4J9C A;  1KK7 A;  3VS4 A;  4EMG A;  1PSE A;  2DPP B;  2AZS A;  3NTK A;  1VQ7 A;  3CCM A;  3CCE Q;  3H9N A;  2DMO A;  4PNO A;  4L5G A;  3CCS Q;  2CZ0 B;  2M02 A;  4ZGD B;  4HT9 A;  3OYA A;  3E9G A;  1K1Z A;  1K4U S;  3G4S T;  3L42 A;  1BK2 A;  2WAC A;  1Q81 C;  1YNZ A;  2RA2 A;  2Y4Y A;  2MI6 A;  1YIJ A;  1HD3 A;  2DE0 X;  5GMK i;  2CP7 A;  1B34 A;  1QP2 A;  3CCL A;  2CKK A;  3H41 A;  1UEC A;  1K9M R;  1A0N B;  1JEG A;  5FTJ A;  2W0Z A;  5GJV B;  3BFM A;  2BZ8 A;  4XAX B;  2ZPH B;  1MMG A;  1UG1 A;  2XU8 A;  4R56 A;  3RIR A;  1K76 A;  1YCY A;  2KE9 A;  4UC4 A;  1PRM C;  5CCB A;  4RG2 A;  3OYB A;  3NTI A;  3C94 A;  2O2O A;  2JXB A;  2KT8 A;  3A8O B;  2QEX Q;  3GLX A;  4TVR A;  5LJ5 f;  2E6N A;  1YIJ Q;  3OYY A;  3VUZ A;  1UGV A;  2DVE A;  3LGA A;  1OYX A;  2XK0 A;  1KD1 R;  3M4G A;  2E10 A;  3EFR A;  3Q1J A;  1VQM T;  3OMG A;  1ZA2 B;  1QWF A;  3L2W A;  1C6V X;  1BI0 A;  2H3J A;  1RAA B;  1GFD A;  3PIO A;  1VUB A;  1MHN A;  1UJY A;  1PRL C;  3CPW P;  4RUG A;  3TIW A;  2GNC A;  4AG2 C;  3VS7 A;  1R0B G;  2DZC A;  2EGC A;  2HCK A;  3CC2 A;  4E2F B;  3GPL A;  3QPH A;  3NPF A;  3SFM A;  2LQW A;  3CCJ Q;  4O6J A;  5IXB A;  4C0F A;  2CS7 A;  2HKQ B;  1ZSG A;  2OAU A;  2Z0W A;  2MM0 A;  3CPF A;  5LJ3 j;  4E7S A;  4LDY A;  1PHT A;  1KC8 U;  4C8Q F;  1BCO A;  3WVE B;  3M54 A;  2Q19 X;  1VQN T;  5CKF A;  1QQJ A;  1ZSZ B;  2JTM A;  3CEY A;  3CD6 A;  2YT6 A;  3X20 B;  5FWC A;  4FCY A;  5FU7 C;  2CUD A;  2JUF A;  3OYN A;  3G7Z A;  2O01 E;  3M56 A;  1VIF A;  2L89 A;  1P92 A;  1QCF A;  3T9N A;  3TU4 K;  2DIQ A;  2HAX A;  1RAD B;  4JUV A;  2E4H A;  4BY6 B;  4A4K A;  2LNV A;  2OTL Q;  4LE9 A;  4FW1 A;  2C0I A;  1VYU A;  5ERG B;  3J80 E;  2JOY A;  1W70 A;  1N8R C;  4M78 D;  2XKO C;  4ME7 A;  3HKS A;  5GAM j;  1K8A U;  1SEM A;  4FYX B;  3CBM A;  2E70 A;  2KAF A;  1ACM B;  3CMA Q;  1ARK A;  3EGX B;  3HL8 A;  1LCK A;  2HSP A;  1PD0 A;  4J7F A;  2FO0 A;  1ZC1 A;  2CUB A;  2K79 A;  4JJB A;  1YJ9 Q;  4ORZ A;  1YI2 Q;  3EGU A;  4PJO G;  5KYY B;  2B86 A;  1AZE A;  2XDD A;  2K2V A;  1UFF A;  1NE8 A;  1BYM A;  3QSU A;  2R58 A;  4J9I A;  5CKE A;  3OYL A;  3BDU A;  2P0Q A;  3OB9 A;  3L2V A;  1TUG B;  5FTK A;  3M4Y A;  4QQ6 A;  4JS4 A;  1UUE A;  3ZL7 C;  3FPR A;  4XU0 A;  2AT1 B;  2YXY A;  2RHU A;  2FZC B;  1WFW A;  2LQN A;  4HVV A;  4J83 A;  3G71 T;  3SWN A;  2PQW A;  1D1A A;  4J9B A;  5GAM f;  3PMT A;  3J7A F;  1JJ2 A;  4X9C A;  5EQJ B;  2F5T X;  4IUT A;  1I0C A;  3RER A;  1X6G A;  1O9S A;  1PWT A;  2YLC A;  3UDC A;  1Y71 A;  3V7R A;  2JTF A;  4C92 D;  2RM4 A;  3HRT A;  4CC2 A;  1KD1 U;  2VC8 A;  2EYW A;  2FVU A;  1S72 A;  4EMH A;  3E19 A;  1ABO A;  2RK2 A;  1QWE A;  1PCX A;  1BCM A;  2G6F X;  1RAE B;  4KUL A;  4JRI A;  3TEE A;  2P0P A;  4BUG A;  4PJO C;  2BTT A;  1I1J A;  2HSE B;  4C8Q E;  3JB9 D;  1W1F A;  3NFC A;  1M3B A;  4XTZ A;  1YIJ T;  2L3Q A;  3JCM d;  3C4S A;  1UGR B;  3HFN A;  2KEA A;  2CP5 A;  2Q1C X;  1OUL A;  1KFZ A;  4CC4 B;  2LX9 A;  4OVA A;  3TSW A;  3CCR Q;  4A4G A;  3G71 Q;  2EWN A;  2QG9 B;  1Q82 C;  2CRE A;  1VQ6 Q;  2V8I A;  3C0C A;  3MP1 A;  3CCM T;  1X6B A;  1VQ4 T;  2I0N A;  1VQ7 T;  3VS3 A;  1M1K R;  5GMK j;  2F69 A;  4BI3 A;  4MMK A;  3LW5 E;  4E7J A;  3DLM A;  3FIF A;  4N0A A;  1VIE A;  2YUO A;  1WHK A;  2AKL A;  1CSK A;  4J8O A;  1VQ8 T;  5GAM h;  1WXB A;  2QQR A;  1NJI U;  2Q1D X;  2QDL A;  2YUP A;  5FU6 C;  1I5L A;  1UEB A;  2RI3 A;  2CSQ A;  2JS0 A;  4OP0 A;  2B8A A;  2HBW A;  2JS2 A;  1FX7 A;  2KSS A;  4X1V A;  5HCK A;  2KXD A;  4EMK B;  2P4T A;  4F14 A;  2COW A;  2EVR A;  4KGV B;  3OMC A;  4A4E A;  2RF0 A;  2G3R A;  2EKH A;  3LH0 A;  4F7U F;  2LCL A;  1G3W A;  2KMT A;  3ZGZ A;  1D09 B;  4M7A D;  5IHI A;  5GAN 5;  5FTN A;  1AWW A;  3TSZ A;  4NL3 A;  1QW1 A;  5LJ3 f;  1WA7 A;  1NJI C;  5EC7 A;  2VGM A;  1HSQ A;  2E3I A;  5HK0 A;  3MO8 A;  3MKD A;  2KVQ G;  3R6N A;  2CP6 A;  3CBO A;  3RBB B;  3HPW A;  3CME T;  2D9T A;  1KQS A;  3UAT A;  2QA4 T;  3VYH B;  1M2O A;  1XTD A;  3V7S A;  2HMA A;  5GAN 6;  1NJI R;  5FU6 B;  1O75 A;  2RJE A;  5J3B A;  3CXC S;  1JXM A;  4IKF A;  1VQ7 Q;  1G3T A;  3X24 B;  5GAN 4;  1PNJ A;  5CVI A;  1KHI A;  1BKB A;  3NGP A;  2ENM A;  1JXO A;  4KT0 E;  4PFO A;  1ZSZ C;  4C92 F;  1VQ6 T;  6AT1 B;  4PFP A;  1UGP B;  2RMO A;  5I11 A;  3SHW A;  3MPU B;  1WI7 A;  2X35 A;  5LJ5 j;  1B07 A;  1M5Q 1;  4RCC A;  1VQ9 Q;  1YHQ Q;  2VAS A;  3VRZ A;  5FRN A;  4HVU A;  4K11 A;  2K5I A;  3RUX A;  2HEQ A;  3EG9 A;  1RI0 A;  1KSW A;  3LWI A;  1NYG A;  2QA4 Q;  5C0M A;  1RAH B;  2HNI A;  1H3H A;  2EQI A;  1I9G A;  3I35 A;  5I2M A;  1PM3 A;  1YJ9 T;  4KDI A;  5KYU B;  4M75 C;  1VQO A;  3I55 Q;  1NEB A;  2A36 A;  7AT1 B;  5GAO r;  2DJZ A;  1YHQ A;  3M55 A;  3FRN A;  3UA6 A;  2PWY A;  1VQ5 Q;  1ZLM A;  2OTL A;  1N6A A;  4BI4 A;  2EYY A;  2RK1 A;  1AZG B;  5CCX A;  2GBQ A;  2ECZ A;  4GBQ A;  2P84 A;  2D8H A;  1AOJ A;  3DB4 A;  2DBK A;  1K8A C;  4J5Y A;  5I21 A;  1YBY A;  1K73 C;  1QCS A;  2CZ6 B;  1Q86 R;  2KRO A;  2DD5 A;  2EGA A;  3CMA A;  2ATC B;  4XTW A;  2YSQ A;  1VQK A;  2DL3 A;  2DBM A;  3GBQ A;  1G3S A;  1VQL T;  4M75 G;  4R0K A;  5DLQ E;  1YIT T;  1M3C A;  3JRZ A;  1I07 A;  4PJM A;  3U23 A;  3OYM A;  1YJW A;  4XU2 A;  4ZGE B;  4ZN1 A;  1JO8 A;  3OY9 A;  4C5E A;  2HDA A;  5GAN 8;  1SHF A;  2YUQ A;  3P8H A;  1D1B A;  3ZJU A;  5CKD A;  3JCM c;  5GMK l;  4JJC A;  5EG2 A;  2PVD B;  2EYQ A;  4ATO A;  1VYT A;  2E41 A;  1VQP T;  4M78 G;  3F70 A;  1WQW A;  2DLP A;  2CZ7 B;  3BY7 A;  4OML A;  3VS1 A;  3X26 B;  3LWH A;  1EX4 A;  2EYZ A;  4EDU A;  1YIT A;  1M4Z A;  3HU1 A;  4L6V 5;  4RTX A;  4M7D G;  4AMC A;  1MGQ A;  1Q81 U;  3EFS A;  4EMK A;  1MUZ A;  1OX9 A;  4AS1 A;  1KHC A;  5GJW B;  2XD0 A;  4AFQ C;  2J05 A;  2VKN A;  1ZX6 A;  1HJD A;  3JV3 A;  3MEW A;  2RHX A;  2X4W A;  5M9O A;  3THK A;  5IN1 A;  1JJ2 P;  3HP9 A;  1NBE B;  4BY6 C;  3OS2 A;  5D6W A;  2B25 A;  2K6D A;  3CCQ T;  4J9H A;  2DRM A;  2O31 A;  3M0Q A;  1YHQ T;  5LJ5 g;  4XTV A;  2COY A;  2VUB A;  1K9M C;  3MB5 A;  1D0Y A;  5IHK A;  2X3X D;  5D7U A;  4M77 F;  4F17 A;  1IXD A;  4PJO B;  3CC4 T;  3JCM Q;  3E9F A;  5GAM g;  2RHI A;  2ZPB B;  3ASK A;  3PIP A;  2CP3 A;  2A0F B;  3OW2 A;  4GLM A;  5DM7 R;  3QWZ A;  1V29 B;  2JM9 A;  2OTJ A;  3OYE A;  3OW2 S;  5KYN A;  2C0T A;  2MYS A;  4C92 E;  4RG8 A;  2QQA A;  2ZPF B;  9ATC B;  1HK9 A;  2FYK A;  3OYC A;  1TOV A;  4M7A G;  2HZY A;  1WZO A;  4FSS A;  2QDY B;  4BE1 A;  2RQU A;  1PKS A;  4M78 A;  4AG1 C;  4JS5 A;  4X9D A; 
#chains in the Genus database with same CATH homology
 3UWN A;  2EQJ A;  3UT1 A;  1OI1 A;  1OZ2 A;  2VXE A;  3MCA B;  1BIA A;  3HL8 A;  3NTH A;  3QJY A;  5GAN d;  5GAO p;  3LLR A;  4J7F A;  3HU3 A;  3QYG B;  4Q5W A;  3RKY A;  5DYI A;  2FL7 A;  4RMO A;  1S3S A;  1M8V A;  3GOX A;  4MZT A;  3RMQ A;  4C92 B;  3CC7 A;  1ZC1 A;  4M77 D;  1QVF A;  4PJO D;  3MEV A;  1H3Z A;  1E32 A;  3HHT B;  4J7I A;  3VV0 A;  2MAM A;  4HKE A;  4XTU A;  4C0Z A;  4C5H A;  1LOJ A;  1KQ2 A;  2EFI A;  4PJO G;  2DAQ A;  2QEX A;  2OTJ T;  5DY9 A;  5LJ3 h;  4MDW A;  2K5F A;  5C1B A;  1I8F A;  5GAO l;  2K2V A;  3FDR A;  2XDD A;  1NE8 A;  4IUQ A;  1RL2 A;  2ZCF B;  4M77 G;  2EQK A;  4DA4 A;  2D0Q B;  2R58 A;  5CKE A;  3OYL A;  1VQO T;  4D6W A;  3CCS A;  3BDU A;  3QJ6 A;  1Q82 U;  5B6C A;  2P0Q A;  4LDV A;  5C18 A;  3CCV T;  3OB9 A;  3CCR T;  3L2V A;  4DOW A;  4KUI A;  1G3Y A;  2QXF A;  5LJ3 g;  3M4Y A;  1PSF A;  4QQ6 A;  4DQ2 A;  3OYG A;  4JS4 A;  1W2B A;  4PJO E;  3FPR A;  4XU0 A;  4A4H A;  2K57 A;  4OGE A;  5FTL A;  1ZBX A;  3HRS A;  4IUP A;  5GAO q;  5CIU A;  2XDP A;  1Q7Y C;  2OTL T;  1G5V A;  2RHU A;  4A53 A;  1X75 C;  3OSS C;  3PTA A;  3C12 A;  4BI8 B;  3G71 T;  4J83 A;  3SWN A;  2PQW A;  5GAN g;  1QVF S;  2EIF A;  1O54 A;  4KOD A;  4XTY A;  2DO3 A;  5GAM f;  3PMT A;  3J7A F;  1YJN T;  2E1H A;  2MWP A;  1I4K 1;  1JJ2 A;  4X9C A;  5LJ3 d;  5EQJ B;  3DB3 A;  2F5T X;  1AHJ B;  2RHZ A;  4PLL A;  3RER A;  2YRV A;  1O9S A;  3P8B B;  2YLC A;  4M78 E;  1I81 A;  3CCE T;  3UDC A;  2PVO B;  1B34 B;  1Y71 A;  1YJ9 A;  2IG0 A;  3M57 A;  2L3R A;  2JNG A;  1Y07 A;  3OQ5 A;  3V7R A;  3M59 A;  5LJ5 e;  1W4S A;  2JTF A;  4C92 D;  1YI2 A;  1VQ5 T;  2RM4 A;  5A0L A;  3HRT A;  1KD1 U;  2VC8 A;  4FT4 A;  2FVU A;  1Q7Y U;  1S72 A;  4B9X A;  2GQV A;  4EMH A;  3E19 A;  2DTI A;  3QQ8 A;  2RK2 A;  3FPT A;  4QVD A;  1Q86 C;  5ERG B;  3FB9 A;  1NPR A;  3CPW A;  4KUL A;  4JRI A;  3TEE A;  2DXC A;  2P0P A;  4JDS A;  4M7A C;  4BUG A;  4PJO C;  2E5Q A;  2WSC E;  3RES A;  2LRQ A;  1X6O A;  5GAN 2;  4V2S A;  3OS1 A;  2HQE A;  4ARI A;  2DEQ A;  3ME9 A;  3G6E T;  3LX7 A;  1BI1 A;  3SD4 A;  4C8Q E;  2MWO A;  5J26 A;  1VQ9 A;  1XNI A;  3CMA T;  3JB9 D;  4F7U A;  4QVZ A;  3GP8 A;  4BAC A;  5CQX A;  4ELZ C;  3NFC A;  4C0D C;  1N9S A;  5KCH A;  3KBG A;  4LDU A;  4X34 A;  4XTZ A;  1JRI A;  2FB7 A;  2LQK A;  4N4G A;  3CCJ T;  4BDZ A;  1YIJ T;  4XQ3 A;  2JV2 A;  2WSE E;  3JCM d;  2LCC A;  4EPC A;  3C4S A;  3A8H B;  1UGR B;  4J6X A;  2FHD A;  3HFN A;  4M77 E;  2V8K A;  1K9M U;  2PUK B;  1CR5 A;  2RI2 A;  2Q1C X;  1EIF A;  3WXM B;  5J39 A;  5A0D A;  4P5N A;  5AYF A;  1FWZ A;  4HCB A;  1U1T A;  3JCM P;  3L2R A;  3RKX A;  3QQ7 A;  3URG A;  4A54 A;  2IVW A;  2LX9 A;  3FPU A;  4E7H A;  4OVA A;  3QYH B;  4A4G A;  2EWN A;  2DXT A;  5CQY A;  1Q82 C;  3E1S A;  4GY5 A;  4MZP A;  4Z02 A;  4M7D D;  2V8J A;  4ATO A;  5EPP A;  2V8I A;  1KD1 C;  4M7D E;  2Y4X A;  4FSX A;  1LNX A;  3MP1 A;  4ZN3 A;  3ZJT A;  3FC3 A;  3OYK A;  3CCM T;  2LC4 A;  4M7A B;  1VQ4 T;  1VQ7 T;  2RJF A;  3V8K A;  5GMK j;  2F69 A;  3I55 T;  2PVG B;  5KCO A;  1H64 1;  4BI3 A;  4MMK A;  3CBP A;  4C8Q G;  3VYG A;  4CI0 C;  2XI9 A;  2ZGW A;  5FTM A;  3LW5 E;  3RMS A;  4PKC C;  3JCM e;  5GAO m;  3CCJ A;  4ZTF A;  4E7J A;  3C95 A;  2ZPG B;  3MHX A;  3DLM A;  4M75 A;  2DIG A;  2R57 A;  2YLB A;  1X01 A;  2DKG A;  3FIF A;  4N0A A;  5A2Q E;  1VIE A;  4M75 F;  5KE2 A;  3A8G B;  4HCC A;  4J8O A;  1VQ8 T;  3TRE A;  5GAM h;  4IUR A;  2QQR A;  3JCM W;  3PFS A;  3OYD A;  1NJI U;  4XTX A;  4C8Q D;  3JB9 I;  1NPP A;  2XDB A;  2Q1D X;  1WJR A;  3KUF A;  3S3N A;  5FU6 C;  4C8Q A;  1UEB A;  2MF2 A;  4BE0 A;  1U8R A;  1I5L A;  2QQB A;  2RI3 A;  2R5A A;  3JCM J;  4C5I A;  4M78 C;  4OP0 A;  2B8A A;  5FU7 B;  1VQ8 A;  3RKW A;  4C8Q B;  5CAI A;  1FX7 A;  1IRE B;  2DXB A;  2KSS A;  2M9U A;  4FT2 A;  4M75 D;  3GIB A;  2EQM A;  4J6W A;  3VKI A;  4EMK B;  2P4T A;  3QO3 A;  5A0G A;  4KUD K;  2YHT A;  1KG1 A;  5GAN j;  4N4H A;  3A5Z B;  4GLK A;  4BD3 A;  4RKU E;  3JSC A;  3OMC A;  2ZZD A;  4A4E A;  3SWN B;  2G3R A;  3QBY A;  3LH0 A;  4JRK A;  3A8L B;  5DLO A;  1SSF A;  1VQ6 A;  1BYM A;  1BI2 A;  4F7U F;  4M77 B;  1WJQ A;  1G3W A;  2KMT A;  2LCL A;  2CYZ B;  3GF5 A;  5CK9 A;  1VQ4 A;  4M7A D;  5CD1 A;  5GAN 3;  5GAO n;  3ZGZ A;  4YTL A;  2BIV A;  1K73 U;  1NZ9 A;  2LVM A;  5GAM d;  5GAN 5;  3G71 A;  2QQ9 A;  4NL2 A;  1QDN A;  4PJO F;  5FTN A;  4QQD A;  1QW1 A;  5GMK e;  4NL3 A;  5L8R E;  2K3X A;  5LJ3 f;  4JRP A;  2E65 A;  4M77 C;  5CKH A;  1ZQ1 A;  4IUV A;  1NJI C;  4M7D F;  3DKM A;  1M90 U;  3BDL A;  3MEU A;  2VGM A;  2K5L A;  3I56 A;  4M7A A;  5HK0 A;  4M7D B;  4E7K A;  4J6Y A;  4N4I A;  2PUO B;  3SB2 A;  2AHJ B;  3MO8 A;  1D3B B;  2QA4 A;  3LGF A;  2KVQ G;  1XQH A;  3CME A;  3CBO A;  4XK8 E;  5GMK m;  3OYH A;  3HSB A;  1DJ7 B;  2EJF A;  3QII A;  3HPW A;  3PNW C;  3CME T;  2D9T A;  2F5K A;  3QZ5 B;  1KQS A;  1D3B A;  1QP3 A;  2VV5 A;  3I55 A;  3VYH B;  4M78 B;  2QA4 T;  3OS0 A;  2KY9 A;  1XTD A;  3JB9 F;  3V7S A;  3MP6 A;  5GAN 6;  4F7U B;  4B9W A;  5FU6 B;  1O75 A;  2LT1 A;  3H8Z A;  2RJE A;  3L2Q A;  4KBM B;  4BB7 A;  1WPY A;  2KQW A;  5J3B A;  3CXC S;  4FU6 A;  2P0K A;  2RJD A;  3FJP A;  3I56 T;  3QC8 A;  4BDY A;  5LJ5 d;  4IKF A;  2DD4 A;  4II1 A;  3CPW S;  3JCM h;  3JB9 J;  4M7A E;  3OBY A;  1TH7 A;  5GAN 7;  1G3T A;  2VGN A;  3X24 B;  5GAN 4;  5CVI A;  1KHI A;  4C92 A;  4FIB A;  1BKB A;  1KQ1 A;  4RCB A;  4KT0 E;  2Q1A X;  2X4J A;  4C92 F;  3QXE B;  4C92 G;  1VQ5 A;  1M90 C;  1VQ6 T;  1R7R A;  4OB1 B;  4WF2 A;  3UPU A;  3PMI A;  4LD6 A;  3CCE A;  2XHC A;  1UGP B;  1JBM A;  2A7Y A;  2HD0 A;  2X35 A;  5LJ5 j;  1Y7X A;  4F7U E;  1M5Q 1;  2NLU A;  4RCC A;  2X4X A;  3SWN C;  2JZ2 A;  3OYF A;  1JJ2 S;  5FLX E;  5FRM A;  3CXC A;  4O5V A;  4DOV A;  3AHU A;  4OMF B;  3N5B B;  2R5M A;  1BIB A;  2E12 A;  3WVD B;  5FRN A;  1Y96 A;  2XID A;  4M77 A;  2K5I A;  4QVC A;  3GNG A;  1Q86 U;  1GXI E;  3JB9 H;  3JB9 G;  3RUX A;  2EQU A;  4ZTJ A;  1WLF A;  4PL6 A;  3L1A A;  3JCM g;  3JAM E;  5D6X A;  1RI0 A;  2RB6 A;  1S72 T;  3EAE A;  4HCZ A;  3LWI A;  4F7U G;  3X25 B;  5C0M A;  4A4F A;  2HNI A;  3CCR A;  1I9G A;  5I2M A;  1UB4 A;  4M7D A;  1YJ9 T;  4KDI A;  3CCS T;  2BKD N;  4M75 C;  1VQO A;  1OZ3 A;  2RD1 A;  5C6S A;  4ARC A;  1KQS S;  4N0A C;  2E6Z A;  4BE2 A;  3QSU A;  1LJO A;  3TCJ A;  4KDL A;  4OF1 A;  2YVL A;  4CRI A;  4EMG A;  4OB2 B;  5GAO r;  1PSE A;  1WQ7 A;  2MM2 A;  2DPP B;  4XU1 A;  4E47 A;  3NTK A;  5HY6 A;  1VQ7 A;  1JB0 E;  3ER0 A;  4EMK C;  1VQN A;  2GF7 A;  3CCM A;  4E7I A;  4KO8 A;  2DJZ A;  2QI2 A;  1M1F A;  3CF2 A;  2C06 A;  4C8Q C;  1YHQ A;  3M55 A;  4PNO A;  3FRN A;  2PWY A;  4L5G A;  4MZM A;  2CGH A;  2PU9 B;  2OTL A;  1N6A A;  2I2L A;  2CZ0 B;  4FM4 B;  4ZGD B;  2PJH B;  2HBP A;  4BI4 A;  4HT9 A;  3P8D A;  3S3M A;  1N8R U;  4M7A F;  3OYA A;  2RK1 A;  3E9G A;  5CCX A;  4IUU A;  3G4S T;  1VQP T;  4Y91 A;  2HQX A;  3L42 A;  5GAN f;  1N9R A;  2WAC A;  1Q81 C;  5LL6 S;  3H6Z A;  2RA2 A;  3DB4 A;  3FEO A;  4PLI A;  3CC2 T;  2Y4Y A;  2MI6 A;  1YIJ A;  1K8A C;  2L8D A;  4J5Y A;  3KXT A;  5I21 A;  1YBY A;  5GMK i;  1K73 C;  2QTX A;  3VU3 C;  1QCS A;  2CZ6 B;  3OYI A;  2DD5 A;  3CMA A;  4Y28 E;  5GMK h;  1B34 A;  1QP2 A;  2LQ8 A;  2CKK A;  3VJP A;  4XTW A;  1VQ9 T;  3CCL A;  3G6E A;  3CC7 T;  1VQK A;  5FTJ A;  1VQL T;  1G3S A;  2YUJ A;  3BFM A;  1U1S A;  4M75 G;  5LJ5 h;  4AQ7 A;  2E64 A;  3HFO A;  5DLQ E;  4XAX B;  5CCA A;  2ZPH B;  2RH2 A;  1Y96 B;  2XU8 A;  4R56 A;  1YIT T;  3RIR A;  3JRZ A;  4LD9 K;  5FTK A;  1YCY A;  3QZ9 B;  1BI3 A;  4QW2 A;  2X4Y A;  4UC4 A;  3OYM A;  3OA6 A;  4VUB A;  3ZFJ A;  4XU2 A;  4ZGE B;  1YJW A;  5CCB A;  4RG2 A;  3OYB A;  2MMP A;  3NTI A;  3OS5 A;  3QG1 A;  3V8L A;  4ZN1 A;  3OY9 A;  1YI2 T;  4C5E A;  1QVG A;  3CD6 T;  5GAN 8;  2XIC A;  3C94 A;  3DLL A;  3P8H A;  2LDM A;  4HA8 A;  3A8O B;  2LTO A;  2ZPE B;  1KC8 C;  3GLX A;  3QHS A;  4OGC A;  4TVR A;  3M9Q A;  3ZJU A;  5CKD A;  5LJ5 f;  2E6N A;  1UGQ B;  3MEA A;  3JCM c;  2KDS A;  3OYY A;  4C5G A;  5GMK l;  3BQB A;  3VUZ A;  1UGS B;  5EG2 A;  2DVE A;  1YJN A;  1W2B S;  3LGA A;  2PVD B;  2EYQ A;  2VXF A;  1OYX A;  2VYT A;  5HK3 A;  2XK0 A;  3JCM b;  2E41 A;  3OSV A;  3M4G A;  4FL6 A;  3F70 A;  2E10 A;  3EFR A;  3Q1J A;  2EJ9 A;  4M78 G;  1VQM T;  2Q18 X;  3OMG A;  1WQW A;  3QUI A;  4M75 E;  5GAN h;  5IT9 E;  2CZ7 B;  3BY7 A;  2LW6 A;  5D6Y A;  1HXD A;  3X26 B;  3LWH A;  1M1K C;  2EAY A;  3L2W A;  2GFA A;  3M5A A;  3MP8 A;  2JVV A;  4C92 C;  3SDZ A;  1BI0 A;  1QVP A;  4EDU A;  1M4Z A;  2H3J A;  1YIT A;  3HU1 A;  4ELY C;  4L6V 5;  3V7C A;  3CC4 A;  1ZHI A;  2EKO A;  2CZ1 B;  5KH6 A;  3X28 B;  4M7D G;  4HT8 A;  3ZBD A;  4OB3 B;  3PIO A;  3CCV A;  1VUB A;  1MHN A;  1QVG S;  1MGQ A;  1Q81 U;  5DYG A;  4NOY A;  3EFS A;  3CCL T;  4EMK A;  3TIW A;  3QDR B;  3JCM V;  4AS1 A;  1KHC A;  2DZ9 A;  4LDW A;  2GFU A;  4M78 F;  4MDX A;  3GNF B;  2XD0 A;  2DZC A;  2RO0 A;  2LT4 A;  3BW1 A;  3OBW A;  4ZGJ B;  2M16 A;  2QEX T;  3M58 A;  3GPL A;  3CC2 A;  4OB0 B;  1WGS A;  1M1G A;  3QPH A;  1XOV A;  5FRO A;  3ZJV A;  5GLF A;  3SFM A;  3MEW A;  4O6J A;  2DXU A;  2RHX A;  2X4W A;  3G4S A;  3LGL A;  2QQS A;  4C0F A;  5M9O A;  3ZEH A;  1CZ4 A;  2CS7 A;  5IN1 A;  2OAU A;  3HP9 A;  4BY6 C;  2DK3 A;  3HRU A;  2WSF E;  2O4X A;  5HKC A;  5CR2 A;  3OS2 A;  2MM0 A;  5D6W A;  3L2U A;  3CPF A;  5LJ3 j;  2B25 A;  3CCQ T;  4LDY A;  4XU3 A;  3S6W A;  2K3Y A;  1YHQ T;  3R6O A;  4C8Q F;  1KC8 U;  1M1K U;  2D6F A;  1VQM A;  5LJ5 g;  3WVE B;  4XTV A;  2RHY A;  2A3L A;  2O4X B;  3M54 A;  1VQP A;  1VQN T;  2Q19 X;  2GCX A;  2VUB A;  5CKF A;  1K9M C;  5IAY A;  3FLG A;  3MB5 A;  4CQN A;  3A8M B;  3MET A;  3CCU T;  4JLG A;  3VUB A;  5GAM e;  2RI5 A;  4M77 F;  4M7D C;  3INZ A;  3LYI A;  3PGG A;  2ZPI B;  3OYJ A;  4RV0 A;  2JTM A;  3CEY A;  2KK4 A;  5GAN e;  3CD6 A;  3S3O A;  5I2S A;  5CO7 A;  4PJO B;  3X20 B;  4M75 B;  3JCM X;  3CC4 T;  1YJW T;  3JCM Q;  4C0G A;  3E9F A;  2K4Y A;  5FU7 C;  4C0D B;  2M0O A;  2JUF A;  5GAM g;  1N27 A;  3G7Z A;  3OYN A;  2RHI A;  2O01 E;  2ZPB B;  3M56 A;  1VIF A;  3ASK A;  2L89 A;  3PIP A;  4NS5 A;  3PT9 A;  4PJO A;  1P92 A;  1R8O B;  3T9N A;  3OW2 A;  2M1H A;  3TU4 K;  2DIQ A;  4MML A;  5LJ3 e;  2EJG A;  5DM7 R;  4JUV A;  1VQL A;  2BUD A;  2HAX A;  4BY6 B;  1M9S A;  4A4K A;  3QWZ A;  2LNV A;  1VQK T;  1V29 B;  3V8J A;  2OTJ A;  3OYE A;  2DTH A;  4KLN A;  3OW2 S;  3M53 A;  3JCM f;  4C92 E;  4RG8 A;  5CKB A;  1IZ6 A;  2QQA A;  3O8V A;  4QQG A;  3J80 E;  2ZPF B;  3CCU A;  3J81 E;  2RJC A;  5KE3 A;  2JOY A;  1HK9 A;  1WJS A;  2XG8 D;  3QKJ A;  1N8R C;  4M78 D;  2FYK A;  4L59 A;  4JJN K;  4LDX A;  3OYC A;  1FXX A;  2XKO C;  4M7A G;  4ME7 A;  4E7L A;  2Y90 A;  3HKS A;  2QDY B;  5GAM j;  4BE1 A;  1WNL A;  1K8A U;  3HU2 A;  1CZ5 A;  3CBM A;  2E70 A;  2L5Q A;  4JRQ A;  2JN0 A;  4JLI A;  2KAF A;  4M78 A;  4R55 A;  3LHD A;  4X9D A;  3CCQ A;  4JS5 A;  3L2Z A;  4IUT A;  2DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...