2GFAA

Double tudor domain complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
107
Chain Sequence
ALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 107
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gfaA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gfaA02
4A4HA 3ZEHA 4IUPA 5FRNA 4BE1A 2P0KA 4RG2A 2RJEA 4CRIA 3NTKA 2DIGA 3PNWC 3MO8A 2M0OA 4UC4A 4C5IA 4C5GA 2PQWA 3QBYA 3F70A 4IUVA 3E9GA 4X34A 5FRMA 2G3RA 2EQJA 2K3XA 2EQUA 2RHIA 3BDLA 3SD4A 4BACA 3S3NA 5M9OA 3FC3A 3MEVA 4Q5WA 4ZTJA 2RJCA 3PMTA 3LGFA 2RO0A 4IUQA 3OYGA 3M9QA 3OYHA 5CIUA 4OVAA 3OS0A 2DAQA 3OS2A 3P8DA 2JTFA 2RI5A 3C4SA 2YRVA 3S3MA 1MHNA 2HQXA 4L59A 2EFIA 2K3YA 4BE2A 4EDUA 2QQRA 2R58A 2M16A 1SSFA 3DB4A 2IG0A 3GOXA 3EAEA 5IN1A 5KE3A 3OYFA 3MP6A 3QKJA 2LTOA 3ASKA 3LX7A 1WJSA 3UWNA 3OYJA 4E7HA 2L89A 2RHUA 5FROA 1OYXA 2F5KA 2XK0A 3Q1JA 5KCOA 3MEUA 4GY5A 3NTIA 4QQDA 3OYEA 2X4YA 4IKFA 3UT1A 5C6SA 4QVZA 3MP8A 4BDZA 3KUFA 2XDPA 3LYIA 2NLUA 3QIIA 5J26A 4C5HA 4BDYA 2RI2A 4E7KA 4A4EA 2QQSA 2GF7A 3OQ5A 2RI3A 3FLGA 3MEAA 4FL6A 5KCHA 2RHZA 3H8ZA 2X4XA 3PFSA 2MWPA 2B8AA 2WACA 3CEYA 4IUTA 2R57A 4NS5A 2FHDA 2M1HA 1N27A 2LRQA 4Z02A 3OS1A 2RJFA 3S3OA 2BKDN 2RJDA 4FU6A 5D6WA 1KHCA 2RHXA 3H6ZA 3L2QA 1WJQA 3E9FA 3PMIA 4HCZA 3OYIA 3OA6A 2EQMA 1OI1A 4IURA 5KE2A 3OYAA 4E7LA 4B9WA 5D6XA 5KH6A 3OYCA 2O4XA 3L2UA 4QW2A 2LDMA 3MP1A 4N4IA 3OYNA 3DB3A 3S6WA 3NTHA 3FEOA 3L42A 4QQ6A 2JZ2A 2BUDA 2CKKA 3L2RA 4BD3A 3LGLA 3O8VA 3DLMA 2X35A 3LLRA 4N4GA 2E6NA 4E7JA 2VYTA 1OZ3A 3OY9A 3L2VA 3P8HA 4C5EA 3OYMA 4ZTFA 1G5VA 2L8DA 2R5MA 3MEWA 4LD6A 3OYDA 2R5AA 4N4HA 5D6YA 4PL6A 5C0MA 4QQGA 4A4FA 2BIVA 3LH0A 2E5QA 3OYLA 3OB9A 4II1A 3FDRA 2MWOA 1WJRA 3QJ6A 5J39A 2O4XB 4BE0A 1WGSA 2DIQA 4B9XA 2GFUA 4PLIA 2D9TA 3OYBA 2EQKA 3L2WA 1XNIA 3OMCA 2LVMA 2EKOA 3META 3OYKA 2HQEA 1OZ2A 5IAYA 3ME9A 4E7IA 3OMGA 2GFAA 2L3RA 2X4WA 1H3ZA 4IUUA 2LCCA 1RI0A 2RHYA 4PLLA 4A4GA
chains in the Genus database with same CATH superfamily
1CKAA 2DZ9A 1WHHA 1OU9A 1FXXA 1H8KA 3SFMA 5HK0A 4MMLA 2XKOC 4A63B 1KD1R 5FRMA 1E32A 1I5OB 1K73R 3VS4A 4D8KA 3CCUQ 3VYHB 3GNFB 2PVOB 1M3BA 3OS0A 3EFSA 1N8RU 1M30A 2ED0A 4C92E 4BE2A 1ABQA 3M0SA 1ZHIA 1SSFA 5KE3A 1YJNQ 1BBZA 4J9DA 2LC4A 1W70A 4ZGEB 4KT0E 1Q82U 1JJ2A 4KO8A 2JMAA 3ULRB 2QEXA 5KCOA 5GJWB 4HVWA 4KODA 1QW1A 2MPXC 2VC8A 2KGTA 2LT4A 4DBQA 3QYGB 4ARCA 4X9CA 2KROA 3M5AA 4CC2A 2CP0A 1KD1C 4C92A 2AHJB 1X43A 2A7YA 5FLXE 1K73C 1WHLA 4PJJA 1JXOA 2J06A 1ACMB 1RL2A 2X4XA 3OYIA 2WACA 5FTNA 5FW9A 5KYUA 1R0BG 2O2OA 1YITA 4JRQA 3U23A 3OA6A 2EQMA 4LUEA 1UJ0A 4ZGDB 2DE0X 3I56Q 4M7AG 2DEQA 4C92B 4J8OA 1C0MA 3CCUT 1X69A 1K9AA 5C18A 3GNGA 2EKHA 4ZN1A 5KYUB 3G6EA 2DPPB 2YVLA 4RTZA 3J81E 3CMET 2VB6A 1Q86U 4R56A 2HZYA 3LH5A 1OU8A 1UHCA 3TSWA 5EQJB 2LVMA 1Y96A 2V1QA 3JCMh 3ER0A 4Y28E 2LJ3A 1JBMA 1N6AA 2O9VA 1PNJA 2F5TX 1TWBA 4E7LA 1SEMA 2VXFA 1KQSA 4E7SA 4JRPA 3HP9A 1KC8R 3L1AA 3RERA 4OMFB 1BIAA 4XTXA 4DEXA 1VQ9Q 1Y71A 3S3NA 5M9OA 3OBWA 2RO0A 3CCLQ 3QQ8A 1X2KA 2DETA 1TUGB 1TG0A 2QXFA 4J5YA 5GANh 3RMQA 5LJ3d 3OW2A 2CUDA 1H3HA 5IH2A 1QWEA 1VQPQ 3O5ZA 2CS7A 2LQKA 4C92F 1R7RA 2E3IA 5CKDA 1G83A 4RTWA 1JJ2P 1KC8C 4M7DE 3RKWA 1SPKA 2EYQA 3G71T 1HK9A 2YT6A 2RH2A 3OQ5A 2RHZA 2A28A 1H92A 1HJDA 5KYXB 4BI3A 2CYZB 5D6WA 1K8AR 2BE7D 2RHXA 1WX6A 4AG1C 4ATOA 2V26A 3VUBA 3G4ST 4M7DA 5FU7C 4QW2A 2L3QA 3VS1A 4FYVB 3NTHA 4M78G 1WXTA 2RK1A 2V8IA 3A8HB 4KUDK 1NEGA 5AYFA 2E6NA 4E7JA 1AWWA 1OZ3A 3L2VA 1VQ6A 1VQ5T 2L8DA 4AFQC 3M0UA 1I9GA 5CR2A 2BIVA 3CD6T 3HRUA 4M7DB 2YUNA 2DIQA 4HVVA 4JDSA 1QQJA 4M77B 1XNIA 1NJIR 1YJWQ 3META 3CMAA 1K8AC 4C8QC 2GFAA 2L3RA 4Z89A 1YCYA 2QQBA 4JJNK 2VXEA 1UE9A 5C1BA 5GAMj 2RJEA 4LDWA 1KQSP 4C5IA 4IUVA 2BZYA 2GBQA 1NEBA 4X9DA 1Q7YR 4IUQA 1VQ8Q 2DL4A 4J7FA 2MM0A 4D8DA 5GMKh 3FPTA 1D1AA 5LJ5j 1C1AA 2CZ1B 3CCMQ 3OW2P 4XU2A 3CCQA 1KD1U 1JJ2S 4XU0A 4BY6C 3VS3A 2M02A 4FYXB 3CF2A 2Q1CX 3MEUA 1M8VA 4LUDA 3UT1A 4QVZA 4KLNA 4AQ7A 3M57A 1TUCA 4PJNA 2DNUA 1Q7YC 2RQRA 4M7DF 1MMNA 2R57A 4Z88A 1PD0A 2KEAA 2JXBA 3CCJT 4XTUA 1UECA 4M77F 2FVUA 4ZNXA 2FZCB 1TOVA 2DMOA 2FZGB 5GAOp 2DEUA 2E64A 1B3QA 2P4TA 1W6XA 4JRKA 3PT9A 3VV0A 3I55A 2LCSA 1DJ7B 1ZSZC 4EMKB 4NOYA 4E47A 2MF2A 3OY9A 3CCRQ 5C0MA 2JW4A 4J9HA 1I5LA 3OB9A 4II1A 2CSIA 1VQ4A 1IRXA 2DLPA 1PKTA 2YUPA 1BI3A 1YJ9Q 4BI8B 5IHIA 4PJMA 1WLFA 1KQSS 2J7IA 1GCQA 3E1SA 1JU5C 3I35A 4PFOA 2YUQA 1UG1A 4UC4A 3MO8A 1WHMA 1AD5A 4MZTA 1P92A 1WZOA 4J83A 3WXMB 3FIFA 4M75C 1S72Q 3AT1B 4KH0B 4CC3A 2EYYA 4RCCA 2Y90A 1FWZA 3A5ZB 1N8RR 4O6JA 1VQ7T 3OW2S 3X24B 4A54A 3VJPA 2EJGA 2ZPGB 1KC8U 2P84A 4E7HA 2KI7A 1YIJQ 1OPLA 2WSCE 3X26B 1D09B 1ZA1B 2RQVA 2ABLA 4JPBW 1M1FA 3KUFA 1LJOA 1YCSB 4C0ZA 4BDYA 1CSKA 1RUWA 3JCMe 2MK5A 4ZN3A 4FSSA 2XG8D 1R8OB 2E65A 1AWXA 1GXIE 2DBKA 1KHIA 4L5GA 2M1HA 1Y0MA 3C12A 4FU6A 4JLIA 1N8RC 3HRTA 1IGQA 1QKXA 4QKUA 1AZEA 1GCPA 1K0XA 5KH6A 5FTLA 4FT4A 2NUTA 2RF0A 4M7AE 4XQ3A 4AFSC 1O54A 4M77G 1Q82C 3JRZA 3C95A 5B6CA 2PVGB 2RB6A 3A8GB 3P8HA 1EZZB 3FRNA 2X9HA 2F2WA 4CI0C 1TUDA 1Q86R 2H8HA 1JRIA 1TU0B 2W0ZA 4BE0A 2NUTB 2E70A 4M7AA 3CCUA 1YIJT 1FYNA 3HPWA 2RN8A 2L3PA 4E7IA 3CC4Q 2HKQB 3X28B 2QAZA 2IIMA 1CKBA 4BI4A 2YXYA 5GANd 3NFCA 1YJNA 4P5NA 3BDUA 2CP7A 2L0AA 4M7AB 2RQWA 3RMSA 1BK2A 1NJIU 2RI5A 3C4SA 2DF6A 4NL2A 1AT1B 1Q86C 2M16A 2O01E 3GOXA 2FPEA 3THKA 3PVQA 1WJSA 5CKHA 3X20B 5IXBA 2Z0WA 1Y57A 1RAFB 1M90U 4GY5A 2K6DA 2ED1A 4C92D 1UGRB 2FZKB 5EC7A 5I21A 3M0QA 2XDPA 4HCCA 2NUPB 1QP3A 2QK0A 1OX9A 3I56A 2X3WD 4PJOG 4A4EA 1FX7A 3FLGA 2FYKA 1U3OA 4E2FB 1X6GA 3HU1A 2E41A 2K7AA 3CC4T 5GAMf 4QVCA 3LGAA 2A0FB 2D8JA 3SWNC 1VQLQ 3E2UA 2KT8A 5KE2A 3CCSQ 3FJ5A 3QUIA 3M4YA 3H0IA 4OP0A 2E5KA 2KYMA 4M78E 1KFZA 2JZ2A 2CZ7B 2ZPIB 3HTRA 1M5Q1 5DLQE 4J6WA 2BZ8A 1CR5A 3VS0A 5FU7B 2RQUA 5GMKe 4M7AF 5LJ5f 2E4HA 5CAIA 3EFOB 4N4HA 4OMOA 2XU8A 4F14A 5CKFA 2MWOA 1WJRA 1I8FA 1QKWA 1VQ9A 1QLYA 4B9XA 2CZ0B 1RAHB 2J6KA 2I2LA 4M78A 2JJ9A 3CCLA 3MHXA 3EHQA 4RG8A 2JTMA 3EG2A 1NG2A 3H0HA 1SSHA 3QPHA 3QZ5B 1B34A 3M56A 4X1VA 1VQPA 2RHIA 1PC0A 2XI9A 3INZA 3FC3A 4M78B 3CBOA 1MV3A 3H0FA 2QQRA 1VOMA 1ZA2B 2JV2A 2KDSA 5LJ3j 1O75A 2DVJA 1KSWA 3UWNA 1B34B 3TEEA 2HAXA 2QA4T 2HD0A 2HSEB 4OB0B 1UGPB 2FEIA 3QWZA 4IKFA 3C94A 1Z9QA 4FW2A 4BDZA 4XU3A 1E6GA 1VUBA 3JAME 3CMEQ 4R55A 2GF7A 1SG5A 2ZPFB 2DKGA 1MNDA 1YHQT 2DILA 3H8ZA 4NS5A 2HSPA 1VQNT 1Q95G 4OB1B 2K3BA 1CZ4A 5FTJA 4LDUA 1GL5A 1PM3A 4M7DD 2K79A 5L8RE 1PSFA 1OI1A 2AIRB 4RTYA 3EHRA 1WQWA 1AWOA 2FPFA 3AHUA 4F16A 3BFMA 7AT1B 2K2VA 4HT8A 2PJHB 2JUFA 1YJWA 4C8QF 2D8HA 4A4KA 5GAOl 2OTJT 4JS4A 1UUEA 2R5MA 2IPOB 4M78F 1OEBA 2DTOA 3RDVA 5FWCA 1SRLA 1ZSZB 4JUVA 2E3HA 1CZ5A 1EFNA 1HYOA 2NWMA 3FJPA 5GAMh 1VQ8A 2KK4A 1LVKA 3OS5A 1TXQA 3ZEHA 4IUPA 5FRNA 2LQWA 1G3WA 4PFPA 1NYFA 2SEMA 3CCMA 1U06A 1AVZC 2G3RA 3G71Q 2O9SA 1BI2A 2BZXA 1ZLMA 2MI6A 3SD4A 3X25B 3JCMc 2P4RA 1YFNA 5LJ3g 3JV3A 1K9MR 5LJ5h 1RABB 3C0CA 1VIEA 5CIUA 3UATA 2DAQA 1UGSB 1UHFA 1M1GA 2V1RA 2EYZA 2F69A 1MNEA 2ZCFB 2DL3A 1ZUYA 3VS5A 2IG0A 4RTTA 2AT1B 3G4SQ 2KE9A 3JCMX 3QWYA 2XK0A 3TREA 3CC2T 4M4ZA 2X4YA 2DRMA 3CCVQ 3A8MB 2LQNA 2ROLA 4FYWB 1W2BA 2DJZA 2X3XD 1YBYA 1VQ5Q 4C0DC 4AS1A 1LNXA 1M3AA 1X2QA 4WTOB 2ZAEA 3CD6Q 2JM8A 3HRSA 1KG1A 2DXBA 4LDXA 1T3SA 1O9SA 3CCRA 3R6NA 1MMAA 5KYXA 1BB9A 2OAWA 2V8KA 4XTZA 4ELZC 1WLPB 3JB9I 3CCET 2O88A 1W4SA 3CPFA 4M77E 1Y7XA 1YJ9A 3M53A 3LLRA 3JB9D 2ZPEB 3OYDA 1MV0B 2JM9A 3TQ7P 2DYIA 5LL6S 5J39A 3SB2A 3CPWA 4C8QG 1J3TA 4M75F 2EQKA 2L3SA 2LQ8A 1S72A 2QDLA 4M77A 1JXMA 1V76A 1VQOT 4HA8A 1QVGP 2FB7A 3CCVT 4F7UG 3EG3A 1R0CB 2DXCA 4C5GA 1GRIA 3QDRB 1WYXA 2EW3A 2YWWA 1YIJA 1PHTA 3TSZA 5FTKA 2D0QB 3TU4K 1RAAB 2GQVA 3QG1A 1BU1A 2ZZDA 3P8BB 3CCJQ 2RK2A 2NYSA 3N5BB 3RR6A 3GP8A 3V8JA 2LTOA 3JCMJ 1SHFA 1JEGA 2QQ9A 4N0AC 1M90R 2DX1A 1AEYA 2CP5A 2NLUA 5GAN5 4PJOE 1W2BP 1V1CA 1IHWA 2XICA 2DXUA 1I1JA 1PWTA 2LZ6B 3QZ9B 2B8AA 6AT1B 2CP3A 1NJIC 3M0PA 2RJFA 4D6WA 2BKDN 3V8LA 2QGGA 3LW5E 2KQWA 5GJVB 5GMKl 3J80E 4MMKA 2EAYA 3OYAA 3JCMV 5D6XA 4N4IA 1YI2Q 1M27C 4PJOA 4RTVA 2AKLA 1Q81U 2VV5A 1M90C 2B86A 3CC4A 4EMKA 4ZTFA 2ROTA 5IHNA 5LJ3f 2R5AA 5D6YA 2FRYA 1XQHA 4M7AD 4JLGA 4JZ3A 2XIDA 4E6RA 1VQ7Q 2GNCA 4PLIA 3V8KA 3OYBA 2QEXT 8AT1B 3DKMA 4ANJA 3CPWP 4PJOB 1T0JA 2EJ9A 3CC7Q 2ZPBB 4MZPA 1H3ZA 4KDIA 1PCXA 3FPRA 4XK8E 2HL5C 3UPUA 4OMQA 3OYYA 2ZGWA 5I2SA 4HCKA 2MOXA 4M75G 3E9GA 4KGXB 3QO3A 4XTYA 4BACA 2KNBB 1YITT 1FMWA 3MEVA 3L2ZA 1N5ZA 2RMOA 3OS2A 2YRVA 4MZMA 3S3MA 3NPFA 1D0XA 2K3YA 1WA7A 1X27A 1YI2T 3MP6A 4RKUE 4OGEA 4C92C 4VUBA 1FMKA 2DFUA 5IT9E 3G6ET 1UTIA 3T9NA 1JO8A 3VU3C 3KFVA 3RKYA 2VGNA 1K9MU 4DOWA 1VQLA 2JMCA 3CCSA 1W2BS 2WSEE 3MP8A 4KGZB 1E6HA 2YSQA 5GAN4 4RCBA 4AG2C 2EQIA 1A0NB 1SKUB 5GAMe 2RI3A 2JS2A 4FL6A 2WSFE 3M54A 1G8XA 3HU2A 3EGUA 2HBWA 1PKSA 2MM2A 2QASA 3CC7T 1OV3A 4PJOF 4BUGA 1V29B 3E9FA 2OX7A 3VYGA 2HKNA 3VRZA 3JCMg 3S6WA 4JJBA 4HXJA 3MCAB 5CQXA 5LJ5e 4KBMB 2KBTA 2MIOA 1WDXA 5CVIA 4LD6A 1VQKQ 3GPLA 3UA6A 2QG9B 3CPWS 1BIBA 1VIFA 2KRSA 4F04B 2DO3A 3M55A 3CBPA 2OTLQ 2EKOA 1OZ2A 5GANg 2XDDA 1VYUA 2KVQG 1YN8A 2DERA 1WHKA 2J6OA 2LCCA 2Q1AX 5EPPA 2YHTA 5KYWA 1YNZA 2EGEA 2LJ0A 3JCMd 2E10A 2L2PA 4PNOA 1W1FA 1NE8A 1UDLA 2DXTA 2EQUA 1BI1A 2YLBA 4ZTJA 2PNIA 5CKBA 2LX7A 5LJ3h 2RQTA 3M9QA 3OYHA 4DBRA 3CXCP 1S1NA 3DLLA 4L59A 2JNGA 3EGXB 1M8MA 1OX8A 2R58A 5KYWB 3CMEA 3JCMP 3LX7A 2K5FA 1VQ6T 5DYGA 2F5KA 3RNJA 1FMVA 3HHTB 1BCMA 2D6FA 1RI9A 2B25A 2H3JA 1VQKT 4HCBA 2LCLA 4MDXA 1NBEB 1ARKA 1QVPA 3LYIA 5J26A 2CDTA 2NUPA 2HQHA 5CD1A 4M7DC 2A36A 3CMAT 5IHKA 3MEAA 3OYEA 2OTLT 5GAN7 3OS1A 4FYYB 4PJLA 1TH7A 1E7OA 3ZFJA 1IHVA 4J6XA 3RESA 1T0HA 3HFOA 4B9WA 3FB9A 4RTXA 2LDMA 4J9GA 1NPPA 2RNAA 3KBGA 3MP1A 3RKXA 3I5RA 2JTEA 1YWPA 3JCMQ 2HL3A 2KMTA 2VWFA 1B7TA 1IREB 2X35A 1U1SA 4KUIA 2A37A 1PG5B 4IIMA 3QQ7A 2FG0A 1PD1A 1LPLA 2YUJA 2GTOA 4FW1A 2A3LA 3EFOA 3BE3A 1QP2A 1ZBXA 4C8QE 3G71A 4YTLA 4GLMA 4J7IA 5I11A 3L2WA 2ENMA 2DL7A 1NLOC 4J9CA 3GBQA 5IAYA 3TCJA 2X4WA 4QVDA 2QA4Q 4A4GA 4F7UE 1D1BA 4J9IA 9ATCB 1EIFA 3PNWC 3G4SA 2IVWA 1QCFA 4C8QA 4DBFA 2DD5A 1X6OA 2AK5A 1QCSA 3M59A 5FTMA 1JB0E 1GFDA 1D3BA 1GBQA 1YHQQ 5J3BA 2GGRA 3PGGA 3SDZA 1VQNQ 3CCVA 4OF1A 1VQ5A 2M0YA 4EDUA 4F7UA 3I55T 1WFWA 5IN1A 4HT9A 3CD6A 2X51A 3QKJA 1M3CA 4EMHA 4CC4B 2L89A 2RHUA 2OJ2A 4JZ4A 4C8QB 3PIPA 3QWXX 3Q1JA 2MCNA 1D3BB 1VQ4T 4JJCA 2OTJQ 3FPUA 2DJQA 5KYYB 3OSSC 4C5HA 4F7UB 3NMZC 4E7KA 4OB3B 1U8RA 2DL8A 1VQMQ 2KY9A 4IUTA 3CEYA 3OBYA 4XAXB 4TVRA 2GCXA 2LRQA 4AT1B 3S3OA 1NZ9A 1RAEB 1HSQA 4LDYA 5GANf 4DBHA 4AMCA 4ME7A 1BCOA 2CZ6B 2DTHA 3V7CA 4BY6B 2M9UA 3M58A 2HDAA 3O8VA 4ARIA 2E1HA 3EG0A 3VS2A 1Q81R 2KXCA 4LN2A 4K11A 1K0SA 4J9FA 4JRIA 4OMPA 2DL5A 1WQ7A 3CQTA 2HNIA 4LE9A 2X4JA 3FDRA 4WF2A 1QCOA 2QTXA 2CSQA 1WHJA 2LNVA 1GCQC 3ZJTA 1WGSA 1ZSZA 4M77D 4LD9K 1PRMC 1D0ZA 3H41A 3EH1A 4JJDA 1VA7A 2C06A 3OMGA 3SEMA 3UA7A 4CQNA 2A08A 3CCJA 5HY6A 3CC2Q 1UGVA 2ECZA 4HKEA 4RG2A 4ELYC 1M1KR 2DYBA 2YLCA 2DIGA 2HCKA 2VVKA 4M75E 4OGCA 5FWBA 2XDBA 1U5SA 3QBYA 4X34A 4KDLA 1VQMT 2V8JA 3PVLA 5CCBA 4F7UF 1Q81C 3WVEB 1RAIB 3REAB 5CO7A 1SRMA 2PUOB 1LCKA 2G6FX 3JCMb 1QMCA 1RADB 1QVGA 4JS5A 2QGFB 3MKDA 4LXCA 1QCNA 4M75A 4PK4A 2YRDA 3CCEQ 5FROA 1M4ZA 1AOJA 1ZUKA 2D0NA 3NTIA 3RUXA 5CK9A 3VS7A 1M1KC 5C6SA 3QYHB 1MGQA 1YI2A 1UJYA 3EG1A 3VKIA 1BKBA 4M75B 2MWPA 4GBQA 1WXUA 1NLPC 1Y07A 5CCXA 1C6VX 2KYBA 2M51A 4HCZA 4RTUA 1YJNT 5DY9A 1VQOQ 1UGQB 2FO0A 1RLQC 4PJOD 3OYCA 1VQ7A 3FEOA 4KULA 5LJ3e 2JOYA 1X6BA 5A0GA 1MUZA 3CC7A 2L5QA 4M7AC 4N4GA 3I9QA 1K9MC 5DYIA 1WHGA 4C5EA 3OYMA 4MDWA 3JB9H 2DBMA 2F2VA 2KRNA 1KK7A 2CP6A 1Y96B 2D9TA 4AFUC 5IXFA 4XTWA 3ZL7C 2D1XA 2KAFA 4IUUA 2VASA 5GAOq 2HEQA 3I56T 2COYA 3D7SB 4BE1A 4B6MA 3NTKA 3G7ZA 3F70A 4LNPA 2EQJA 4EMGA 4PFZA 3NHNA 1YP5A 4C0GA 2I0NA 4J9BA 4WCIA 3BW1A 2C0IA 4KH1B 5A2QE 3P8DA 2EJFA 2HQXA 3MJXA 1G2BA 3JCMW 2EFIA 1EX4A 1AWJA 3DB4A 4Z8AA 5CKEA 5L23A 1WI7A 1XOVA 2C0OA 5FU6C 4KGVB 3ZJUA 2EPDA 1OYXA 3V7SA 2BE9B 4DQ2A 2PVDB 2O31A 3SHWA 2GTJA 1TTHB 1QVFA 2XD0A 3WVDB 4OB2B 3HSBA 5CCAA 1VQ9T 2K2MA 2MYSA 3ZGZA 2CT4A 5GLFA 2RI2A 3CCLT 1K76A 3JSCA 1U1TA 1RACB 2CP2A 4DA4A 2QEXQ 1VQKA 1WJQA 2LP5A 2ZPHB 1ZQ1A 1HD3A 2DK3A 2E12A 2P0QA 3JB9J 1UEBA 2ATCB 1VQPT 2CT3A 2LW6A 2Y4XA 2BUDA 3VRYA 2OTLA 1WPYA 4BD3A 3SWNA 2JN0A 4OMMA 4M78C 1YITQ 3LWIA 2C0TA 2ESWA 1BI0A 1F1BB 1GFCA 3LH0A 2LNHB 1M2OA 1LOJA 2PTKA 3GIBA 5GAN6 2MMPA 3VUZA 3A1PA 2QQAA 4XU1A 2PUKB 3QC8A 3OMCA 3ZBDA 3I5SA 2FPDA 3ME9A 1OOTA 1QDNA 3SWNB 2RHYA 3G6EQ 4PLLA 2HMAA 5ECAA 4A4HA 5HCKA 4CRIA 3PIOA 4FIBA 2Q18X 2PQWA 2YDLA 3TVTA 1K73U 1WNLA 2P0PA 4F17A 3MB5A 2RJCA 3OYGA 4RV0A 1R77A 8ATCB 2PU9B 2DM1A 3QHSA 1M2VA 1UB4A 5I22A 1QVGS 4AFZC 2E6ZA 4C92G 1TSFA 3TIWA 1AHJB 1YJWT 1M1KU 2W10A 3EAEA 2DD4A 3ASKA 3M0RA 5GAOm 4J9EA 5GANj 4ZGJB 1SF9A 2DTIA 1WXBA 3CXCA 1HXDA 1IGUA 1M2VB 3QXEB 3BY7A 1S3SA 5A0DA 1QVFP 5GAOn 4FM4B 3QIIA 1X75C 1GBRA 2QQSA 1VQ8T 2FHDA 1G3SA 1N27A 4Z02A 3CBMA 1RAGB 2COWA 1T3LA 3UF4A 2EWNA 3L2QA 4EIKA 2CREA 2RA2A 4IURA 3CCMT 3EGDA 2F1LA 2O4XA 2EIFA 5GAMg 2LT1A 2FRWA 3A8OB 4QQ6A 2Q19X 2K57A 3REBB 2AKKA 1PSEA 2RPNA 2CUBA 1D0YA 3DLMA 2GQIA 2QDYB 2AZSA 1QWFA 5GAN2 2VYTA 2QA4A 1ZC1A 2EGCA 3A8LB 4EPCA 2YUOA 3HKSA 2K4YA 2H3EB 5A0LA 1Z9ZA 4Y91A 3IQLA 3EGDB 5LJ5g 3BQBA 2O4XB 4DOVA 2GFUA 2VKNA 3G1JA 2VGMA 3UDCA 3GLXA 1ZX6A 1I07A 1YHQA 3PTAA 2VUBA 1VQNA 1NPRA 1VQ6Q 3V7RA 1NYGA 4ESRA 2Q1DX 1OPKA 5GAMd 2EYXA 2LX9A 4C8QD 2M0OA 2HBPA 2XHCA 2K3XA 3QSUA 3BDLA 2Y4YA 3CCRT 1Q82R 5HKCA 1UFFA 4M78D 3PMTA 3LGFA 3CMAQ 2JVVA 4ORZA 2BTTA 1H641 3EG9A 2EGAA 1KJWA 1N9RA 5DLOA 2JS0A 4GLKA 4HVUA 2OTJA 1ZBJA 3OSVA 5LJ5d 2KRMA 1AZGB 2CH4W 3EGXA 1YJ9T 3OYFA 1K4US 1VQMA 5GMKj 1KIKA 1M9SA 3RIRA 1QVFS 3R6OA 1ABOA 4M7DG 3EG9B 3LWHA 3A98A 4RUGA 3HFNA 1X01A 5CQYA 4R0KA 3JB9F 2AZVA 5AT1B 2KSSA 1S72T 5KCHA 5GMKi 3CCQQ 3ZJVA 5GANe 1K8AU 2EBPA 1I0CA 1KHCA 1SHGA 3PMIA 4LDVA 1G3TA 4KRTA 1I81A 2PZ1A 3L2UA 2J05A 3OYNA 2QTVA 2K9GA 3DB3A 1MMGA 4CC7A 4BB7A 5DM7R 1WIEA 3HL8A 1OQKA 2RD1A 3H9NA 2CKKA 5EG2A 2FL7A 4IIOA 2K5IA 1TS9A 5I2MA 1KQ2A 3MEWA 2NUZA 4J6YA 4M77C 4C0FA 2J6FA 3CC2A 4A4FA 2E5QA 4C0DB 2KT1A 3QJ6A 1IO6A 3J7AF 1N9SA 2LJ1A 4FSXA 3I55Q 4RMOA 3VS6A 1VYTA 2JT4A 2HQEA 2MAMA 2OI3A 1JQQA 5ERGB 1XJWB 2RM4A 5HK3A 2P0KA 1NM7A 5KYNA 1VQ4Q 2KXDA 1Q7YU 3CCEA 3CCQT 2EYWA 1B07A 1VYVA 2DVEA 3M4GA 4Q5WA 5GMKm 3HU3A 2QYZA 3URGA 1ZUUA 1I4K1 4OVAA 4E7ZA 2JTFA 1IXDA 1MHNA 1G3YA 4M75D 2DZCA 2SRCA 2OAUA 3RBBB 2PWYA 1PRLC 3OYJA 2QI2A 2LMJA 3EH2A 1IB8A 4QQDA 3CXCS 1BYMA 5GAOr 1XTDA 1VQOA 4L6V5 5FU6B 4A53A 3GF5A 2EVRA 2COZA 3PE0A 5KYYA 2YRCA 2K5LA 1OULA 3PFSA 4N0AA 2CGHA 2CH4A 4QT7A 4PJOC 3E19A 2RJDA 3JCMf 3H6ZA 4V2SA 1K1ZA 4OMNA 3QJYA 1D1CA 2F2XA 3JB9G 2DA9A 1KQ1A 2KR3A 3M0TA 4EMKC 4OMLA 1ZSGA 3L42A 2DRKA 1YWOA 3L2RA 3NGPA 3LGLA 3EFRA 5D7UA 1G5VA 5GAN3 4PL6A 4DEYA 4FT2A 4QQGA 4NL3A 3OYLA 1IZ6A 4FCYA 3MPUB 5GAN8 3KXTA 4Y92A 1RLPC 2XMFA 3OYKA 1VQLT 4PKCC 3CCST 1MMDA 3LHDA 1RI0A 4O5VA 4XTVA 3QDFA
chains in the Genus database with same CATH topology
3OYYA 2DZ9A 2ZGWA 5I2SA 4BE1A 4BI4A 1FXXA 3SFMA 5HK0A 4MMLA 3NTKA 5GANd 2XKOC 3G7ZA 3NFCA 1YJNA 4M75G 4P5NA 3F70A 3BDUA 3E9GA 5FRMA 2EQJA 1E32A 4EMGA 3QO3A 4XTYA 4BACA 1YITT 4M7AB 3MEVA 3L2ZA 4C0GA 3RMSA 3VYHB 3GNFB 2PVOB 1NJIU 3BW1A 5A2QE 3OS0A 3EFSA 3OS2A 3P8DA 1N8RU 2EJFA 2RI5A 3C4SA 2YRVA 4MZMA 3S3MA 2HQXA 4NL2A 3JCMW 4C92E 2EFIA 2K3YA 4BE2A 1Q86C 1ZHIA 1SSFA 2M16A 3DB4A 2O01E 3GOXA 5KE3A 1YI2T 3MP6A 5CKEA 4RKUE 4OGEA 1WJSA 1XOVA 4C92C 4VUBA 5FU6C 3ZJUA 2LC4A 5CKHA 3X20B 5IT9E 3G6ET 1OYXA 3T9NA 3VU3C 4KT0E 3V7SA 4ZGEB 1Q82U 1JJ2A 4KO8A 1M90U 4DQ2A 2PVDB 3RKYA 5KCOA 2QEXA 2VGNA 4KODA 4GY5A 1K9MU 1QW1A 1QVFA 2VC8A 4DOWA 3WVDB 1VQLA 2LT4A 4C92D 2XD0A 1UGRB 3QYGB 3CCSA 5I21A 1W2BS 2WSEE 3MP8A 4ARCA 4OB2B 4X9CA 3HSBA 2XDPA 3M5AA 5CCAA 1VQ9T 5GAN4 4HCCA 1QP3A 1KD1C 4C92A 2AHJB 3I56A 4RCBA 2A7YA 5FLXE 3ZGZA 5GLFA 2RI2A 4PJOG 4A4EA 1K73C 3CCLT 3JSCA 5GAMe 1U1TA 1FX7A 2RI3A 3FLGA 4FL6A 2WSFE 3M54A 2FYKA 3HU2A 1RL2A 2X4XA 3OYIA 2WACA 2MM2A 3HU1A 5FTNA 2E41A 3CC7T 4DA4A 3CC4T 1YITA 4PJOF 4JRQA 5GAMf 1VQKA 4BUGA 4QVCA 3LGAA 1V29B 1WJQA 3E9FA 3SWNC 3OA6A 2EQMA 2ZPHB 3VYGA 1ZQ1A 5KE2A 2DK3A 2E12A 2P0QA 3JB9J 1UEBA 3QUIA 3M4YA 4OP0A 1VQPT 3JCMg 3S6WA 4ZGDB 2LW6A 4M7AG 2DEQA 3MCAB 4J8OA 4M78E 4C92B 2JZ2A 2CZ7B 2Y4XA 2BUDA 5CQXA 4KBMB 5LJ5e 2ZPIB 2OTLA 1M5Q1 1WPYA 5DLQE 4BD3A 4J6WA 3CCUT 1CR5A 5CVIA 3SWNA 5C18A 5FU7B 2JN0A 3GNGA 4ZN1A 4M78C 5GMKe 4M7AF 3G6EA 3LWIA 2DPPB 5LJ5f 2YVLA 4LD6A 1BI0A 5CAIA 4N4HA 3J81E 3GPLA 3CMET 3LH0A 1Q86U 2XU8A 1LOJA 5CKFA 2MWOA 1WJRA 3CPWS 1I8FA 4R56A 1BIBA 1VIFA 1VQ9A 4B9XA 2DO3A 2MMPA 2CZ0B 5GAN6 3VUZA 3GIBA 2QQAA 3M55A 4XU1A 2I2LA 2PUKB 4M78A 3CBPA 3QC8A 3OMCA 5EQJB 3ZBDA 2LVMA 1Y96A 2EKOA 3JCMh 3CCLA 3MHXA 1OZ2A 3ER0A 5GANg 2XDDA 2KVQG 4Y28E 3ME9A 1JBMA 1N6AA 1QDNA 2LCCA 4RG8A 3SWNB 2Q1AX 2JTMA 5EPPA 2F5TX 2RHYA 4PLLA 4E7LA 1KQSA 2VXFA 2YHTA 4A4HA 4JRPA 3JCMd 3HP9A 2E10A 3L1AA 3RERA 4CRIA 4OMFB 4PNOA 3PIOA 3QPHA 3QZ5B 1NE8A 4FIBA 2Q18X 1B34A 2PQWA 1BIAA 2DXTA 3M56A 4XTXA 1K73U 1WNLA 2P0PA 1VQPA 1Y71A 2EQUA 2RHIA 3S3NA 1BI1A 2XI9A 5M9OA 2YLBA 3INZA 3FC3A 3MB5A 3OBWA 4ZTJA 2RJCA 4M78B 5CKBA 3CBOA 2RO0A 3OYGA 4RV0A 5LJ3h 3QQ8A 3M9QA 3OYHA 2PU9B 3QHSA 1UB4A 2QXFA 1QVGS 3DLLA 4J5YA 4L59A 2JNGA 2E6ZA 4C92G 5GANh 2QQRA 3RMQA 2R58A 5LJ3d 3TIWA 3OW2A 2KDSA 2JV2A 5LJ3j 1O75A 3CMEA 1AHJB 1YJWT 1M1KU 3EAEA 3JCMP 2DD4A 3ASKA 3LX7A 3UWNA 1B34B 3TEEA 2K5FA 5GAOm 2HAXA 2CS7A 2LQKA 4C92F 2QA4T 5GANj 1VQ6T 1R7RA 2HD0A 2F5KA 5DYGA 4ZGJB 2DTIA 3HHTB 4OB0B 5CKDA 2D6FA 2B25A 1UGPB 2H3JA 3QWZA 1KC8C 1VQKT 3RKWA 3CXCA 1HXDA 4IKFA 3C94A 4M7DE 3QXEB 3BY7A 4BDZA 4HCBA 1S3SA 5A0DA 2EYQA 2LCLA 5GAOn 3G71T 1HK9A 3QSUA 4MDXA 4XU3A 4FM4B 1QVPA 1VUBA 3LYIA 3QIIA 5J26A 5CD1A 1X75C 3JAME 2RH2A 4R55A 2QQSA 2GF7A 3OQ5A 3CMAT 3MEAA 4M7DC 1VQ8T 2ZPFB 2RHZA 2DKGA 1YHQT 3H8ZA 3OYEA 4NS5A 2OTLT 1VQNT 4OB1B 5GAN7 2FHDA 1CZ4A 1G3SA 1N27A 4BI3A 4Z02A 3OS1A 2CYZB 3CBMA 5FTJA 4LDUA 4M7DD 5D6WA 2RHXA 2EWNA 5L8RE 3L2QA 1TH7A 4ATOA 1PSFA 3ZFJA 3VUBA 4J6XA 1OI1A 3RESA 2RA2A 4IURA 3G4ST 3CCMT 4M7DA 3HFOA 4B9WA 3FB9A 5FU7C 2O4XA 1WQWA 2EIFA 4QW2A 2LDMA 3MP1A 1NPPA 2LT1A 3KBGA 3BFMA 5GAMg 3AHUA 2K2VA 3NTHA 3RKXA 4HT8A 3A8OB 2PJHB 4QQ6A 2Q19X 4M78G 2JUFA 2RK1A 2K57A 1PSEA 2V8IA 1YJWA 3A8HB 4C8QF 3JCMQ 2KMTA 4KUDK 4A4KA 3DLMA 1IREB 2QDYB 2X35A 5AYFA 1U1SA 2E6NA 4KUIA 2VYTA 1OZ3A 5GAN2 5GAOl 3L2VA 2QA4A 4E7JA 1VQ6A 4JS4A 1VQ5T 2L8DA 2R5MA 1ZC1A 3QQ7A 4M78F 1I9GA 5CR2A 3A8LB 2YUJA 2DTOA 4EPCA 2BIVA 2A3LA 3CD6T 3HKSA 2K4YA 5A0LA 4Y91A 4JUVA 3HRUA 4M7DB 1QP2A 1ZBXA 4C8QE 5LJ5g 3BQBA 2O4XB 3G71A 2DIQA 4YTLA 4DOVA 2GFUA 4JDSA 1CZ5A 4J7IA 4M77B 3L2WA 1XNIA 2VGMA 3UDCA 3GLXA 3META 3CMAA 5GAMh 3FJPA 1K8AC 1VQ8A 5IAYA 4C8QC 1YHQA 3TCJA 2GFAA 2L3RA 2KK4A 2VUBA 2X4WA 3PTAA 1VQNA 1YCYA 2QQBA 3OS5A 1NPRA 4QVDA 4JJNK 2VXEA 3V7RA 4A4GA 4F7UE 3ZEHA 4IUPA 5FRNA 2Q1DX 5C1BA 5GAMd 1G3WA 2LX9A 2RJEA 1EIFA 4LDWA 5GAMj 4C8QD 4C5IA 3PNWC 2M0OA 3G4SA 2IVWA 3CCMA 2HBPA 2XHCA 4IUVA 2G3RA 2K3XA 1BI2A 4C8QA 3BDLA 2Y4YA 2MI6A 3SD4A 2DD5A 3X25B 3JCMc 5HKCA 4X9DA 3CCRT 1X6OA 4M78D 1QCSA 3M59A 5LJ3g 3PMTA 1JB0E 3LGFA 4IUQA 5LJ5h 5FTMA 1D3BA 2JVVA 1VIEA 5CIUA 4J7FA 1H641 2DAQA 1UGSB 5J3BA 1M1GA 3PGGA 1N9RA 3SDZA 3CCVA 5DLOA 2MM0A 4OF1A 4GLKA 2F69A 2OTJA 3OSVA 5GMKh 2ZCFB 3FPTA 1VQ5A 4EDUA 5LJ5d 4F7UA 3I55T 5LJ5j 2IG0A 5IN1A 1YJ9T 4HT9A 3OYFA 3CD6A 2CZ1B 1VQMA 3QKJA 4XU2A 3CCQA 4EMHA 2L89A 1KD1U 2RHUA 4XU0A 4BY6C 5GMKj 3JCMX 1JJ2S 4C8QB 3PIPA 1M9SA 2XK0A 3TREA 3CF2A 3Q1JA 3RIRA 3CC2T 1QVFS 2Q1CX 3MEUA 1M8VA 2X4YA 1D3BB 1VQ4T 3R6OA 3UT1A 4M7DG 4QVZA 3LWHA 3A8MB 4KLNA 1W2BA 3HFNA 3FPUA 1X01A 5CQYA 2DJZA 4AQ7A 1YBYA 3M57A 3JB9F 4C0DC 3OSSC 4AS1A 4C5HA 4F7UB 1LNXA 4OB3B 4E7KA 1U8RA 1Q7YC 2KSSA 1S72T 5KCHA 4M7DF 2KY9A 3HRSA 5GMKi 3ZJVA 4IUTA 5GANe 1KG1A 2DXBA 3CEYA 3OBYA 4XAXB 2R57A 4LDXA 4TVRA 3CCJT 1O9SA 2GCXA 2LRQA 4XTUA 4M77F 3CCRA 3S3OA 1K8AU 2FVUA 1NZ9A 1KHCA 5GAOp 3PMIA 2E64A 1G3TA 4LDVA 4LDYA 5GANf 2V8KA 4XTZA 1I81A 4ELZC 4ME7A 3L2UA 3JB9I 2P4TA 3OYNA 3DB3A 3CCET 4JRKA 4BB7A 3PT9A 2CZ6B 1W4SA 3VV0A 2DTHA 3HL8A 3V7CA 5DM7R 3I55A 4BY6B 2RD1A 3CPFA 2CKKA 2M9UA 5EG2A 4M77E 1Y7XA 1DJ7B 3M58A 1YJ9A 2FL7A 3O8VA 4ARIA 2E1HA 4EMKB 4NOYA 3M53A 2K5IA 3LLRA 5I2MA 4E47A 1KQ2A 2MF2A 3OY9A 3JB9D 3MEWA 2ZPEB 4J6YA 4JRIA 3OYDA 4M77C 4C0FA 5C0MA 3CC2A 4A4FA 1I5LA 1WQ7A 2E5QA 4C0DB 3OB9A 2HNIA 4II1A 2X4JA 5LL6S 1VQ4A 3FDRA 4WF2A 2QTXA 3QJ6A 2LNVA 5J39A 3SB2A 3J7AF 1N9SA 1WGSA 3CPWA 4C8QG 3ZJTA 4M77D 4FSXA 4M75F 4LD9K 2EQKA 4RMOA 1BI3A 2LQ8A 1S72A 2HQEA 2MAMA 4M77A 4BI8B 1VQOT 2C06A 3OMGA 5ERGB 4HA8A 1WLFA 1KQSS 4CQNA 3CCJA 2RM4A 5HK3A 2FB7A 5HY6A 3E1SA 3CCVT 4F7UG 2P0KA 4HKEA 4RG2A 4ELYC 2DXCA 2YLCA 2DIGA 4M75E 3MO8A 4OGCA 4UC4A 4C5GA 2XDBA 3QBYA 3QDRB 4MZTA 4X34A 1Q7YU 4KDLA 1P92A 4J83A 1VQMT 1YIJA 2V8JA 3CCEA 3CCQT 5CCBA 4F7UF 1Q81C 5FTKA 2DVEA 3M4GA 2D0QB 4Q5WA 3WVEB 3WXMB 5GMKm 3TU4K 3HU3A 3FIFA 4M75C 3URGA 1I4K1 4OVAA 5CO7A 2GQVA 3QG1A 4RCCA 2JTFA 2Y90A 2PUOB 1MHNA 1FWZA 2ZZDA 3A5ZB 3P8BB 4O6JA 1VQ7T 3JCMb 3OW2S 2RK2A 3X24B 4A54A 1G3YA 3VJPA 2EJGA 4M75D 1QVGA 3N5BB 3GP8A 2DZCA 3V8JA 4JS5A 2ZPGB 1KC8U 2OAUA 4M75A 2PWYA 2LTOA 3OYJA 3JCMJ 4E7HA 2QI2A 5FROA 2WSCE 1M4ZA 2QQ9A 3X26B 4QQDA 5CK9A 3NTIA 4N0AC 3RUXA 3CXCS 5GAOr 1BYMA 1XTDA 1M1KC 1VQOA 5C6SA 1M1FA 3KUFA 3QYHB 4L6V5 3GF5A 5FU6B 4A53A 1MGQA 2NLUA 1LJOA 4C0ZA 5GAN5 4BDYA 1YI2A 4PJOE 2XICA 2DXUA 3VKIA 4ZN3A 3JCMe 1BKBA 2K5LA 2XG8D 1R8OB 3QZ9B 4M75B 3PFSA 2E65A 2MWPA 2B8AA 4N0AA 1GXIE 2CGHA 1KHIA 4L5GA 2M1HA 1NJIC 4PJOC 1Y07A 2RJFA 4D6WA 2BKDN 3E19A 2RJDA 3C12A 3V8LA 4FU6A 3LW5E 4JLIA 3JCMf 2KQWA 3H6ZA 3HRTA 1N8RC 5CCXA 5GMKl 4HCZA 4V2SA 3QJYA 3JB9G 3J80E 4MMKA 5DY9A 1YJNT 2EAYA 1UGQB 3OYAA 1KQ1A 3JCMV 5D6XA 4EMKC 5KH6A 4PJOD 3OYCA 5FTLA 4FT4A 4N4IA 4M7AE 4XQ3A 1VQ7A 3FEOA 3L42A 1O54A 4PJOA 4KULA 5LJ3e 3L2RA 2JOYA 4M77G 1Q81U 3LGLA 5A0GA 3CC7A 1Q82C 2L5QA 2VV5A 3JRZA 1M90C 4M7AC 3C95A 4N4GA 3CC4A 5B6CA 2PVGB 3EFRA 1K9MC 5DYIA 2RB6A 3A8GB 3P8HA 4C5EA 4EMKA 4MDWA 3OYMA 4ZTFA 1G5VA 5LJ3f 5GAN3 2R5AA 5D6YA 3FRNA 4PL6A 3JB9H 4FT2A 4QQGA 4NL3A 4CI0C 3OYLA 1IZ6A 1XQHA 4M7AD 4JLGA 1JRIA 2XIDA 5GAN8 4BE0A 3KXTA 2E70A 4M7AA 1Y96B 4PLIA 3V8KA 2D9TA 3OYBA 2QEXT 3DKMA 4XTWA 3CCUA 1YIJT 4PJOB 3OYKA 1VQLT 4PKCC 2EJ9A 3HPWA 2ZPBB 4MZPA 3CCST 2KAFA 4E7IA 1H3ZA 4KDIA 3LHDA 3FPRA 4IUUA 4XK8E 1RI0A 5GAOq 3X28B 3UPUA 4O5VA 4XTVA 2OTJT 3I56T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4H A;  3ZEH A;  4IUP A;  5FRN A;  4BE1 A;  2P0K A;  4RG2 A;  2RJE A;  4CRI A;  3NTK A;  2DIG A;  3PNW C;  3MO8 A;  2M0O A;  4UC4 A;  4C5I A;  4C5G A;  2PQW A;  3QBY A;  3F70 A;  4IUV A;  3E9G A;  4X34 A;  5FRM A;  2G3R A;  2EQJ A;  2K3X A;  2EQU A;  2RHI A;  3BDL A;  3SD4 A;  4BAC A;  3S3N A;  5M9O A;  3FC3 A;  3MEV A;  4Q5W A;  4ZTJ A;  2RJC A;  3PMT A;  3LGF A;  2RO0 A;  4IUQ A;  3OYG A;  3M9Q A;  3OYH A;  5CIU A;  4OVA A;  3OS0 A;  2DAQ A;  3OS2 A;  3P8D A;  2JTF A;  2RI5 A;  3C4S A;  2YRV A;  3S3M A;  1MHN A;  2HQX A;  4L59 A;  2EFI A;  2K3Y A;  4BE2 A;  4EDU A;  2QQR A;  2R58 A;  2M16 A;  1SSF A;  3DB4 A;  2IG0 A;  3GOX A;  3EAE A;  5IN1 A;  5KE3 A;  3OYF A;  3MP6 A;  3QKJ A;  2LTO A;  3ASK A;  3LX7 A;  1WJS A;  3UWN A;  3OYJ A;  4E7H A;  2L89 A;  2RHU A;  5FRO A;  1OYX A;  2F5K A;  2XK0 A;  3Q1J A;  5KCO A;  3MEU A;  4GY5 A;  3NTI A;  4QQD A;  3OYE A;  2X4Y A;  4IKF A;  3UT1 A;  5C6S A;  4QVZ A;  3MP8 A;  4BDZ A;  3KUF A;  2XDP A;  3LYI A;  2NLU A;  3QII A;  5J26 A;  4C5H A;  4BDY A;  2RI2 A;  4E7K A;  4A4E A;  2QQS A;  2GF7 A;  3OQ5 A;  2RI3 A;  3FLG A;  3MEA A;  4FL6 A;  5KCH A;  2RHZ A;  3H8Z A;  2X4X A;  3PFS A;  2MWP A;  2B8A A;  2WAC A;  3CEY A;  4IUT A;  2R57 A;  4NS5 A;  2FHD A;  2M1H A;  1N27 A;  2LRQ A;  4Z02 A;  3OS1 A;  2RJF A;  3S3O A;  2BKD N;  2RJD A;  4FU6 A;  5D6W A;  1KHC A;  2RHX A;  3H6Z A;  3L2Q A;  1WJQ A;  3E9F A;  3PMI A;  4HCZ A;  3OYI A;  3OA6 A;  2EQM A;  1OI1 A;  4IUR A;  5KE2 A;  3OYA A;  4E7L A;  4B9W A;  5D6X A;  5KH6 A;  3OYC A;  2O4X A;  3L2U A;  4QW2 A;  2LDM A;  3MP1 A;  4N4I A;  3OYN A;  3DB3 A;  3S6W A;  3NTH A;  3FEO A;  3L42 A;  4QQ6 A;  2JZ2 A;  2BUD A;  2CKK A;  3L2R A;  4BD3 A;  3LGL A;  3O8V A;  3DLM A;  2X35 A;  3LLR A;  4N4G A;  2E6N A;  4E7J A;  2VYT A;  1OZ3 A;  3OY9 A;  3L2V A;  3P8H A;  4C5E A;  3OYM A;  4ZTF A;  1G5V A;  2L8D A;  2R5M A;  3MEW A;  4LD6 A;  3OYD A;  2R5A A;  4N4H A;  5D6Y A;  4PL6 A;  5C0M A;  4QQG A;  4A4F A;  2BIV A;  3LH0 A;  2E5Q A;  3OYL A;  3OB9 A;  4II1 A;  3FDR A;  2MWO A;  1WJR A;  3QJ6 A;  5J39 A;  2O4X B;  4BE0 A;  1WGS A;  2DIQ A;  4B9X A;  2GFU A;  4PLI A;  2D9T A;  3OYB A;  2EQK A;  3L2W A;  1XNI A;  3OMC A;  2LVM A;  2EKO A;  3MET A;  3OYK A;  2HQE A;  1OZ2 A;  5IAY A;  3ME9 A;  4E7I A;  3OMG A;  2GFA A;  2L3R A;  2X4W A;  1H3Z A;  4IUU A;  2LCC A;  1RI0 A;  2RHY A;  4PLL A;  4A4G A; 
#chains in the Genus database with same CATH topology
 1CKA A;  2DZ9 A;  1WHH A;  1OU9 A;  1FXX A;  1H8K A;  3SFM A;  5HK0 A;  4MML A;  2XKO C;  4A63 B;  1KD1 R;  5FRM A;  1E32 A;  1I5O B;  1K73 R;  3VS4 A;  4D8K A;  3CCU Q;  3VYH B;  3GNF B;  2PVO B;  1M3B A;  3OS0 A;  3EFS A;  1N8R U;  1M30 A;  2ED0 A;  4C92 E;  4BE2 A;  1ABQ A;  3M0S A;  1ZHI A;  1SSF A;  5KE3 A;  1YJN Q;  1BBZ A;  4J9D A;  2LC4 A;  1W70 A;  4ZGE B;  4KT0 E;  1Q82 U;  1JJ2 A;  4KO8 A;  2JMA A;  3ULR B;  2QEX A;  5KCO A;  5GJW B;  4HVW A;  4KOD A;  1QW1 A;  2MPX C;  2VC8 A;  2KGT A;  2LT4 A;  4DBQ A;  3QYG B;  4ARC A;  4X9C A;  2KRO A;  3M5A A;  4CC2 A;  2CP0 A;  1KD1 C;  4C92 A;  2AHJ B;  1X43 A;  2A7Y A;  5FLX E;  1K73 C;  1WHL A;  4PJJ A;  1JXO A;  2J06 A;  1ACM B;  1RL2 A;  2X4X A;  3OYI A;  2WAC A;  5FTN A;  5FW9 A;  5KYU A;  1R0B G;  2O2O A;  1YIT A;  4JRQ A;  3U23 A;  3OA6 A;  2EQM A;  4LUE A;  1UJ0 A;  4ZGD B;  2DE0 X;  3I56 Q;  4M7A G;  2DEQ A;  4C92 B;  4J8O A;  1C0M A;  3CCU T;  1X69 A;  1K9A A;  5C18 A;  3GNG A;  2EKH A;  4ZN1 A;  5KYU B;  3G6E A;  2DPP B;  2YVL A;  4RTZ A;  3J81 E;  3CME T;  2VB6 A;  1Q86 U;  4R56 A;  2HZY A;  3LH5 A;  1OU8 A;  1UHC A;  3TSW A;  5EQJ B;  2LVM A;  1Y96 A;  2V1Q A;  3JCM h;  3ER0 A;  4Y28 E;  2LJ3 A;  1JBM A;  1N6A A;  2O9V A;  1PNJ A;  2F5T X;  1TWB A;  4E7L A;  1SEM A;  2VXF A;  1KQS A;  4E7S A;  4JRP A;  3HP9 A;  1KC8 R;  3L1A A;  3RER A;  4OMF B;  1BIA A;  4XTX A;  4DEX A;  1VQ9 Q;  1Y71 A;  3S3N A;  5M9O A;  3OBW A;  2RO0 A;  3CCL Q;  3QQ8 A;  1X2K A;  2DET A;  1TUG B;  1TG0 A;  2QXF A;  4J5Y A;  5GAN h;  3RMQ A;  5LJ3 d;  3OW2 A;  2CUD A;  1H3H A;  5IH2 A;  1QWE A;  1VQP Q;  3O5Z A;  2CS7 A;  2LQK A;  4C92 F;  1R7R A;  2E3I A;  5CKD A;  1G83 A;  4RTW A;  1JJ2 P;  1KC8 C;  4M7D E;  3RKW A;  1SPK A;  2EYQ A;  3G71 T;  1HK9 A;  2YT6 A;  2RH2 A;  3OQ5 A;  2RHZ A;  2A28 A;  1H92 A;  1HJD A;  5KYX B;  4BI3 A;  2CYZ B;  5D6W A;  1K8A R;  2BE7 D;  2RHX A;  1WX6 A;  4AG1 C;  4ATO A;  2V26 A;  3VUB A;  3G4S T;  4M7D A;  5FU7 C;  4QW2 A;  2L3Q A;  3VS1 A;  4FYV B;  3NTH A;  4M78 G;  1WXT A;  2RK1 A;  2V8I A;  3A8H B;  4KUD K;  1NEG A;  5AYF A;  2E6N A;  4E7J A;  1AWW A;  1OZ3 A;  3L2V A;  1VQ6 A;  1VQ5 T;  2L8D A;  4AFQ C;  3M0U A;  1I9G A;  5CR2 A;  2BIV A;  3CD6 T;  3HRU A;  4M7D B;  2YUN A;  2DIQ A;  4HVV A;  4JDS A;  1QQJ A;  4M77 B;  1XNI A;  1NJI R;  1YJW Q;  3MET A;  3CMA A;  1K8A C;  4C8Q C;  2GFA A;  2L3R A;  4Z89 A;  1YCY A;  2QQB A;  4JJN K;  2VXE A;  1UE9 A;  5C1B A;  5GAM j;  2RJE A;  4LDW A;  1KQS P;  4C5I A;  4IUV A;  2BZY A;  2GBQ A;  1NEB A;  4X9D A;  1Q7Y R;  4IUQ A;  1VQ8 Q;  2DL4 A;  4J7F A;  2MM0 A;  4D8D A;  5GMK h;  3FPT A;  1D1A A;  5LJ5 j;  1C1A A;  2CZ1 B;  3CCM Q;  3OW2 P;  4XU2 A;  3CCQ A;  1KD1 U;  1JJ2 S;  4XU0 A;  4BY6 C;  3VS3 A;  2M02 A;  4FYX B;  3CF2 A;  2Q1C X;  3MEU A;  1M8V A;  4LUD A;  3UT1 A;  4QVZ A;  4KLN A;  4AQ7 A;  3M57 A;  1TUC A;  4PJN A;  2DNU A;  1Q7Y C;  2RQR A;  4M7D F;  1MMN A;  2R57 A;  4Z88 A;  1PD0 A;  2KEA A;  2JXB A;  3CCJ T;  4XTU A;  1UEC A;  4M77 F;  2FVU A;  4ZNX A;  2FZC B;  1TOV A;  2DMO A;  2FZG B;  5GAO p;  2DEU A;  2E64 A;  1B3Q A;  2P4T A;  1W6X A;  4JRK A;  3PT9 A;  3VV0 A;  3I55 A;  2LCS A;  1DJ7 B;  1ZSZ C;  4EMK B;  4NOY A;  4E47 A;  2MF2 A;  3OY9 A;  3CCR Q;  5C0M A;  2JW4 A;  4J9H A;  1I5L A;  3OB9 A;  4II1 A;  2CSI A;  1VQ4 A;  1IRX A;  2DLP A;  1PKT A;  2YUP A;  1BI3 A;  1YJ9 Q;  4BI8 B;  5IHI A;  4PJM A;  1WLF A;  1KQS S;  2J7I A;  1GCQ A;  3E1S A;  1JU5 C;  3I35 A;  4PFO A;  2YUQ A;  1UG1 A;  4UC4 A;  3MO8 A;  1WHM A;  1AD5 A;  4MZT A;  1P92 A;  1WZO A;  4J83 A;  3WXM B;  3FIF A;  4M75 C;  1S72 Q;  3AT1 B;  4KH0 B;  4CC3 A;  2EYY A;  4RCC A;  2Y90 A;  1FWZ A;  3A5Z B;  1N8R R;  4O6J A;  1VQ7 T;  3OW2 S;  3X24 B;  4A54 A;  3VJP A;  2EJG A;  2ZPG B;  1KC8 U;  2P84 A;  4E7H A;  2KI7 A;  1YIJ Q;  1OPL A;  2WSC E;  3X26 B;  1D09 B;  1ZA1 B;  2RQV A;  2ABL A;  4JPB W;  1M1F A;  3KUF A;  1LJO A;  1YCS B;  4C0Z A;  4BDY A;  1CSK A;  1RUW A;  3JCM e;  2MK5 A;  4ZN3 A;  4FSS A;  2XG8 D;  1R8O B;  2E65 A;  1AWX A;  1GXI E;  2DBK A;  1KHI A;  4L5G A;  2M1H A;  1Y0M A;  3C12 A;  4FU6 A;  4JLI A;  1N8R C;  3HRT A;  1IGQ A;  1QKX A;  4QKU A;  1AZE A;  1GCP A;  1K0X A;  5KH6 A;  5FTL A;  4FT4 A;  2NUT A;  2RF0 A;  4M7A E;  4XQ3 A;  4AFS C;  1O54 A;  4M77 G;  1Q82 C;  3JRZ A;  3C95 A;  5B6C A;  2PVG B;  2RB6 A;  3A8G B;  3P8H A;  1EZZ B;  3FRN A;  2X9H A;  2F2W A;  4CI0 C;  1TUD A;  1Q86 R;  2H8H A;  1JRI A;  1TU0 B;  2W0Z A;  4BE0 A;  2NUT B;  2E70 A;  4M7A A;  3CCU A;  1YIJ T;  1FYN A;  3HPW A;  2RN8 A;  2L3P A;  4E7I A;  3CC4 Q;  2HKQ B;  3X28 B;  2QAZ A;  2IIM A;  1CKB A;  4BI4 A;  2YXY A;  5GAN d;  3NFC A;  1YJN A;  4P5N A;  3BDU A;  2CP7 A;  2L0A A;  4M7A B;  2RQW A;  3RMS A;  1BK2 A;  1NJI U;  2RI5 A;  3C4S A;  2DF6 A;  4NL2 A;  1AT1 B;  1Q86 C;  2M16 A;  2O01 E;  3GOX A;  2FPE A;  3THK A;  3PVQ A;  1WJS A;  5CKH A;  3X20 B;  5IXB A;  2Z0W A;  1Y57 A;  1RAF B;  1M90 U;  4GY5 A;  2K6D A;  2ED1 A;  4C92 D;  1UGR B;  2FZK B;  5EC7 A;  5I21 A;  3M0Q A;  2XDP A;  4HCC A;  2NUP B;  1QP3 A;  2QK0 A;  1OX9 A;  3I56 A;  2X3W D;  4PJO G;  4A4E A;  1FX7 A;  3FLG A;  2FYK A;  1U3O A;  4E2F B;  1X6G A;  3HU1 A;  2E41 A;  2K7A A;  3CC4 T;  5GAM f;  4QVC A;  3LGA A;  2A0F B;  2D8J A;  3SWN C;  1VQL Q;  3E2U A;  2KT8 A;  5KE2 A;  3CCS Q;  3FJ5 A;  3QUI A;  3M4Y A;  3H0I A;  4OP0 A;  2E5K A;  2KYM A;  4M78 E;  1KFZ A;  2JZ2 A;  2CZ7 B;  2ZPI B;  3HTR A;  1M5Q 1;  5DLQ E;  4J6W A;  2BZ8 A;  1CR5 A;  3VS0 A;  5FU7 B;  2RQU A;  5GMK e;  4M7A F;  5LJ5 f;  2E4H A;  5CAI A;  3EFO B;  4N4H A;  4OMO A;  2XU8 A;  4F14 A;  5CKF A;  2MWO A;  1WJR A;  1I8F A;  1QKW A;  1VQ9 A;  1QLY A;  4B9X A;  2CZ0 B;  1RAH B;  2J6K A;  2I2L A;  4M78 A;  2JJ9 A;  3CCL A;  3MHX A;  3EHQ A;  4RG8 A;  2JTM A;  3EG2 A;  1NG2 A;  3H0H A;  1SSH A;  3QPH A;  3QZ5 B;  1B34 A;  3M56 A;  4X1V A;  1VQP A;  2RHI A;  1PC0 A;  2XI9 A;  3INZ A;  3FC3 A;  4M78 B;  3CBO A;  1MV3 A;  3H0F A;  2QQR A;  1VOM A;  1ZA2 B;  2JV2 A;  2KDS A;  5LJ3 j;  1O75 A;  2DVJ A;  1KSW A;  3UWN A;  1B34 B;  3TEE A;  2HAX A;  2QA4 T;  2HD0 A;  2HSE B;  4OB0 B;  1UGP B;  2FEI A;  3QWZ A;  4IKF A;  3C94 A;  1Z9Q A;  4FW2 A;  4BDZ A;  4XU3 A;  1E6G A;  1VUB A;  3JAM E;  3CME Q;  4R55 A;  2GF7 A;  1SG5 A;  2ZPF B;  2DKG A;  1MND A;  1YHQ T;  2DIL A;  3H8Z A;  4NS5 A;  2HSP A;  1VQN T;  1Q95 G;  4OB1 B;  2K3B A;  1CZ4 A;  5FTJ A;  4LDU A;  1GL5 A;  1PM3 A;  4M7D D;  2K79 A;  5L8R E;  1PSF A;  1OI1 A;  2AIR B;  4RTY A;  3EHR A;  1WQW A;  1AWO A;  2FPF A;  3AHU A;  4F16 A;  3BFM A;  7AT1 B;  2K2V A;  4HT8 A;  2PJH B;  2JUF A;  1YJW A;  4C8Q F;  2D8H A;  4A4K A;  5GAO l;  2OTJ T;  4JS4 A;  1UUE A;  2R5M A;  2IPO B;  4M78 F;  1OEB A;  2DTO A;  3RDV A;  5FWC A;  1SRL A;  1ZSZ B;  4JUV A;  2E3H A;  1CZ5 A;  1EFN A;  1HYO A;  2NWM A;  3FJP A;  5GAM h;  1VQ8 A;  2KK4 A;  1LVK A;  3OS5 A;  1TXQ A;  3ZEH A;  4IUP A;  5FRN A;  2LQW A;  1G3W A;  4PFP A;  1NYF A;  2SEM A;  3CCM A;  1U06 A;  1AVZ C;  2G3R A;  3G71 Q;  2O9S A;  1BI2 A;  2BZX A;  1ZLM A;  2MI6 A;  3SD4 A;  3X25 B;  3JCM c;  2P4R A;  1YFN A;  5LJ3 g;  3JV3 A;  1K9M R;  5LJ5 h;  1RAB B;  3C0C A;  1VIE A;  5CIU A;  3UAT A;  2DAQ A;  1UGS B;  1UHF A;  1M1G A;  2V1R A;  2EYZ A;  2F69 A;  1MNE A;  2ZCF B;  2DL3 A;  1ZUY A;  3VS5 A;  2IG0 A;  4RTT A;  2AT1 B;  3G4S Q;  2KE9 A;  3JCM X;  3QWY A;  2XK0 A;  3TRE A;  3CC2 T;  4M4Z A;  2X4Y A;  2DRM A;  3CCV Q;  3A8M B;  2LQN A;  2ROL A;  4FYW B;  1W2B A;  2DJZ A;  2X3X D;  1YBY A;  1VQ5 Q;  4C0D C;  4AS1 A;  1LNX A;  1M3A A;  1X2Q A;  4WTO B;  2ZAE A;  3CD6 Q;  2JM8 A;  3HRS A;  1KG1 A;  2DXB A;  4LDX A;  1T3S A;  1O9S A;  3CCR A;  3R6N A;  1MMA A;  5KYX A;  1BB9 A;  2OAW A;  2V8K A;  4XTZ A;  4ELZ C;  1WLP B;  3JB9 I;  3CCE T;  2O88 A;  1W4S A;  3CPF A;  4M77 E;  1Y7X A;  1YJ9 A;  3M53 A;  3LLR A;  3JB9 D;  2ZPE B;  3OYD A;  1MV0 B;  2JM9 A;  3TQ7 P;  2DYI A;  5LL6 S;  5J39 A;  3SB2 A;  3CPW A;  4C8Q G;  1J3T A;  4M75 F;  2EQK A;  2L3S A;  2LQ8 A;  1S72 A;  2QDL A;  4M77 A;  1JXM A;  1V76 A;  1VQO T;  4HA8 A;  1QVG P;  2FB7 A;  3CCV T;  4F7U G;  3EG3 A;  1R0C B;  2DXC A;  4C5G A;  1GRI A;  3QDR B;  1WYX A;  2EW3 A;  2YWW A;  1YIJ A;  1PHT A;  3TSZ A;  5FTK A;  2D0Q B;  3TU4 K;  1RAA B;  2GQV A;  3QG1 A;  1BU1 A;  2ZZD A;  3P8B B;  3CCJ Q;  2RK2 A;  2NYS A;  3N5B B;  3RR6 A;  3GP8 A;  3V8J A;  2LTO A;  3JCM J;  1SHF A;  1JEG A;  2QQ9 A;  4N0A C;  1M90 R;  2DX1 A;  1AEY A;  2CP5 A;  2NLU A;  5GAN 5;  4PJO E;  1W2B P;  1V1C A;  1IHW A;  2XIC A;  2DXU A;  1I1J A;  1PWT A;  2LZ6 B;  3QZ9 B;  2B8A A;  6AT1 B;  2CP3 A;  1NJI C;  3M0P A;  2RJF A;  4D6W A;  2BKD N;  3V8L A;  2QGG A;  3LW5 E;  2KQW A;  5GJV B;  5GMK l;  3J80 E;  4MMK A;  2EAY A;  3OYA A;  3JCM V;  5D6X A;  4N4I A;  1YI2 Q;  1M27 C;  4PJO A;  4RTV A;  2AKL A;  1Q81 U;  2VV5 A;  1M90 C;  2B86 A;  3CC4 A;  4EMK A;  4ZTF A;  2ROT A;  5IHN A;  5LJ3 f;  2R5A A;  5D6Y A;  2FRY A;  1XQH A;  4M7A D;  4JLG A;  4JZ3 A;  2XID A;  4E6R A;  1VQ7 Q;  2GNC A;  4PLI A;  3V8K A;  3OYB A;  2QEX T;  8AT1 B;  3DKM A;  4ANJ A;  3CPW P;  4PJO B;  1T0J A;  2EJ9 A;  3CC7 Q;  2ZPB B;  4MZP A;  1H3Z A;  4KDI A;  1PCX A;  3FPR A;  4XK8 E;  2HL5 C;  3UPU A;  4OMQ A;  3OYY A;  2ZGW A;  5I2S A;  4HCK A;  2MOX A;  4M75 G;  3E9G A;  4KGX B;  3QO3 A;  4XTY A;  4BAC A;  2KNB B;  1YIT T;  1FMW A;  3MEV A;  3L2Z A;  1N5Z A;  2RMO A;  3OS2 A;  2YRV A;  4MZM A;  3S3M A;  3NPF A;  1D0X A;  2K3Y A;  1WA7 A;  1X27 A;  1YI2 T;  3MP6 A;  4RKU E;  4OGE A;  4C92 C;  4VUB A;  1FMK A;  2DFU A;  5IT9 E;  3G6E T;  1UTI A;  3T9N A;  1JO8 A;  3VU3 C;  3KFV A;  3RKY A;  2VGN A;  1K9M U;  4DOW A;  1VQL A;  2JMC A;  3CCS A;  1W2B S;  2WSE E;  3MP8 A;  4KGZ B;  1E6H A;  2YSQ A;  5GAN 4;  4RCB A;  4AG2 C;  2EQI A;  1A0N B;  1SKU B;  5GAM e;  2RI3 A;  2JS2 A;  4FL6 A;  2WSF E;  3M54 A;  1G8X A;  3HU2 A;  3EGU A;  2HBW A;  1PKS A;  2MM2 A;  2QAS A;  3CC7 T;  1OV3 A;  4PJO F;  4BUG A;  1V29 B;  3E9F A;  2OX7 A;  3VYG A;  2HKN A;  3VRZ A;  3JCM g;  3S6W A;  4JJB A;  4HXJ A;  3MCA B;  5CQX A;  5LJ5 e;  4KBM B;  2KBT A;  2MIO A;  1WDX A;  5CVI A;  4LD6 A;  1VQK Q;  3GPL A;  3UA6 A;  2QG9 B;  3CPW S;  1BIB A;  1VIF A;  2KRS A;  4F04 B;  2DO3 A;  3M55 A;  3CBP A;  2OTL Q;  2EKO A;  1OZ2 A;  5GAN g;  2XDD A;  1VYU A;  2KVQ G;  1YN8 A;  2DER A;  1WHK A;  2J6O A;  2LCC A;  2Q1A X;  5EPP A;  2YHT A;  5KYW A;  1YNZ A;  2EGE A;  2LJ0 A;  3JCM d;  2E10 A;  2L2P A;  4PNO A;  1W1F A;  1NE8 A;  1UDL A;  2DXT A;  2EQU A;  1BI1 A;  2YLB A;  4ZTJ A;  2PNI A;  5CKB A;  2LX7 A;  5LJ3 h;  2RQT A;  3M9Q A;  3OYH A;  4DBR A;  3CXC P;  1S1N A;  3DLL A;  4L59 A;  2JNG A;  3EGX B;  1M8M A;  1OX8 A;  2R58 A;  5KYW B;  3CME A;  3JCM P;  3LX7 A;  2K5F A;  1VQ6 T;  5DYG A;  2F5K A;  3RNJ A;  1FMV A;  3HHT B;  1BCM A;  2D6F A;  1RI9 A;  2B25 A;  2H3J A;  1VQK T;  4HCB A;  2LCL A;  4MDX A;  1NBE B;  1ARK A;  1QVP A;  3LYI A;  5J26 A;  2CDT A;  2NUP A;  2HQH A;  5CD1 A;  4M7D C;  2A36 A;  3CMA T;  5IHK A;  3MEA A;  3OYE A;  2OTL T;  5GAN 7;  3OS1 A;  4FYY B;  4PJL A;  1TH7 A;  1E7O A;  3ZFJ A;  1IHV A;  4J6X A;  3RES A;  1T0H A;  3HFO A;  4B9W A;  3FB9 A;  4RTX A;  2LDM A;  4J9G A;  1NPP A;  2RNA A;  3KBG A;  3MP1 A;  3RKX A;  3I5R A;  2JTE A;  1YWP A;  3JCM Q;  2HL3 A;  2KMT A;  2VWF A;  1B7T A;  1IRE B;  2X35 A;  1U1S A;  4KUI A;  2A37 A;  1PG5 B;  4IIM A;  3QQ7 A;  2FG0 A;  1PD1 A;  1LPL A;  2YUJ A;  2GTO A;  4FW1 A;  2A3L A;  3EFO A;  3BE3 A;  1QP2 A;  1ZBX A;  4C8Q E;  3G71 A;  4YTL A;  4GLM A;  4J7I A;  5I11 A;  3L2W A;  2ENM A;  2DL7 A;  1NLO C;  4J9C A;  3GBQ A;  5IAY A;  3TCJ A;  2X4W A;  4QVD A;  2QA4 Q;  4A4G A;  4F7U E;  1D1B A;  4J9I A;  9ATC B;  1EIF A;  3PNW C;  3G4S A;  2IVW A;  1QCF A;  4C8Q A;  4DBF A;  2DD5 A;  1X6O A;  2AK5 A;  1QCS A;  3M59 A;  5FTM A;  1JB0 E;  1GFD A;  1D3B A;  1GBQ A;  1YHQ Q;  5J3B A;  2GGR A;  3PGG A;  3SDZ A;  1VQN Q;  3CCV A;  4OF1 A;  1VQ5 A;  2M0Y A;  4EDU A;  4F7U A;  3I55 T;  1WFW A;  5IN1 A;  4HT9 A;  3CD6 A;  2X51 A;  3QKJ A;  1M3C A;  4EMH A;  4CC4 B;  2L89 A;  2RHU A;  2OJ2 A;  4JZ4 A;  4C8Q B;  3PIP A;  3QWX X;  3Q1J A;  2MCN A;  1D3B B;  1VQ4 T;  4JJC A;  2OTJ Q;  3FPU A;  2DJQ A;  5KYY B;  3OSS C;  4C5H A;  4F7U B;  3NMZ C;  4E7K A;  4OB3 B;  1U8R A;  2DL8 A;  1VQM Q;  2KY9 A;  4IUT A;  3CEY A;  3OBY A;  4XAX B;  4TVR A;  2GCX A;  2LRQ A;  4AT1 B;  3S3O A;  1NZ9 A;  1RAE B;  1HSQ A;  4LDY A;  5GAN f;  4DBH A;  4AMC A;  4ME7 A;  1BCO A;  2CZ6 B;  2DTH A;  3V7C A;  4BY6 B;  2M9U A;  3M58 A;  2HDA A;  3O8V A;  4ARI A;  2E1H A;  3EG0 A;  3VS2 A;  1Q81 R;  2KXC A;  4LN2 A;  4K11 A;  1K0S A;  4J9F A;  4JRI A;  4OMP A;  2DL5 A;  1WQ7 A;  3CQT A;  2HNI A;  4LE9 A;  2X4J A;  3FDR A;  4WF2 A;  1QCO A;  2QTX A;  2CSQ A;  1WHJ A;  2LNV A;  1GCQ C;  3ZJT A;  1WGS A;  1ZSZ A;  4M77 D;  4LD9 K;  1PRM C;  1D0Z A;  3H41 A;  3EH1 A;  4JJD A;  1VA7 A;  2C06 A;  3OMG A;  3SEM A;  3UA7 A;  4CQN A;  2A08 A;  3CCJ A;  5HY6 A;  3CC2 Q;  1UGV A;  2ECZ A;  4HKE A;  4RG2 A;  4ELY C;  1M1K R;  2DYB A;  2YLC A;  2DIG A;  2HCK A;  2VVK A;  4M75 E;  4OGC A;  5FWB A;  2XDB A;  1U5S A;  3QBY A;  4X34 A;  4KDL A;  1VQM T;  2V8J A;  3PVL A;  5CCB A;  4F7U F;  1Q81 C;  3WVE B;  1RAI B;  3REA B;  5CO7 A;  1SRM A;  2PUO B;  1LCK A;  2G6F X;  3JCM b;  1QMC A;  1RAD B;  1QVG A;  4JS5 A;  2QGF B;  3MKD A;  4LXC A;  1QCN A;  4M75 A;  4PK4 A;  2YRD A;  3CCE Q;  5FRO A;  1M4Z A;  1AOJ A;  1ZUK A;  2D0N A;  3NTI A;  3RUX A;  5CK9 A;  3VS7 A;  1M1K C;  5C6S A;  3QYH B;  1MGQ A;  1YI2 A;  1UJY A;  3EG1 A;  3VKI A;  1BKB A;  4M75 B;  2MWP A;  4GBQ A;  1WXU A;  1NLP C;  1Y07 A;  5CCX A;  1C6V X;  2KYB A;  2M51 A;  4HCZ A;  4RTU A;  1YJN T;  5DY9 A;  1VQO Q;  1UGQ B;  2FO0 A;  1RLQ C;  4PJO D;  3OYC A;  1VQ7 A;  3FEO A;  4KUL A;  5LJ3 e;  2JOY A;  1X6B A;  5A0G A;  1MUZ A;  3CC7 A;  2L5Q A;  4M7A C;  4N4G A;  3I9Q A;  1K9M C;  5DYI A;  1WHG A;  4C5E A;  3OYM A;  4MDW A;  3JB9 H;  2DBM A;  2F2V A;  2KRN A;  1KK7 A;  2CP6 A;  1Y96 B;  2D9T A;  4AFU C;  5IXF A;  4XTW A;  3ZL7 C;  2D1X A;  2KAF A;  4IUU A;  2VAS A;  5GAO q;  2HEQ A;  3I56 T;  2COY A;  3D7S B;  4BE1 A;  4B6M A;  3NTK A;  3G7Z A;  3F70 A;  4LNP A;  2EQJ A;  4EMG A;  4PFZ A;  3NHN A;  1YP5 A;  4C0G A;  2I0N A;  4J9B A;  4WCI A;  3BW1 A;  2C0I A;  4KH1 B;  5A2Q E;  3P8D A;  2EJF A;  2HQX A;  3MJX A;  1G2B A;  3JCM W;  2EFI A;  1EX4 A;  1AWJ A;  3DB4 A;  4Z8A A;  5CKE A;  5L23 A;  1WI7 A;  1XOV A;  2C0O A;  5FU6 C;  4KGV B;  3ZJU A;  2EPD A;  1OYX A;  3V7S A;  2BE9 B;  4DQ2 A;  2PVD B;  2O31 A;  3SHW A;  2GTJ A;  1TTH B;  1QVF A;  2XD0 A;  3WVD B;  4OB2 B;  3HSB A;  5CCA A;  1VQ9 T;  2K2M A;  2MYS A;  3ZGZ A;  2CT4 A;  5GLF A;  2RI2 A;  3CCL T;  1K76 A;  3JSC A;  1U1T A;  1RAC B;  2CP2 A;  4DA4 A;  2QEX Q;  1VQK A;  1WJQ A;  2LP5 A;  2ZPH B;  1ZQ1 A;  1HD3 A;  2DK3 A;  2E12 A;  2P0Q A;  3JB9 J;  1UEB A;  2ATC B;  1VQP T;  2CT3 A;  2LW6 A;  2Y4X A;  2BUD A;  3VRY A;  2OTL A;  1WPY A;  4BD3 A;  3SWN A;  2JN0 A;  4OMM A;  4M78 C;  1YIT Q;  3LWI A;  2C0T A;  2ESW A;  1BI0 A;  1F1B B;  1GFC A;  3LH0 A;  2LNH B;  1M2O A;  1LOJ A;  2PTK A;  3GIB A;  5GAN 6;  2MMP A;  3VUZ A;  3A1P A;  2QQA A;  4XU1 A;  2PUK B;  3QC8 A;  3OMC A;  3ZBD A;  3I5S A;  2FPD A;  3ME9 A;  1OOT A;  1QDN A;  3SWN B;  2RHY A;  3G6E Q;  4PLL A;  2HMA A;  5ECA A;  4A4H A;  5HCK A;  4CRI A;  3PIO A;  4FIB A;  2Q18 X;  2PQW A;  2YDL A;  3TVT A;  1K73 U;  1WNL A;  2P0P A;  4F17 A;  3MB5 A;  2RJC A;  3OYG A;  4RV0 A;  1R77 A;  8ATC B;  2PU9 B;  2DM1 A;  3QHS A;  1M2V A;  1UB4 A;  5I22 A;  1QVG S;  4AFZ C;  2E6Z A;  4C92 G;  1TSF A;  3TIW A;  1AHJ B;  1YJW T;  1M1K U;  2W10 A;  3EAE A;  2DD4 A;  3ASK A;  3M0R A;  5GAO m;  4J9E A;  5GAN j;  4ZGJ B;  1SF9 A;  2DTI A;  1WXB A;  3CXC A;  1HXD A;  1IGU A;  1M2V B;  3QXE B;  3BY7 A;  1S3S A;  5A0D A;  1QVF P;  5GAO n;  4FM4 B;  3QII A;  1X75 C;  1GBR A;  2QQS A;  1VQ8 T;  2FHD A;  1G3S A;  1N27 A;  4Z02 A;  3CBM A;  1RAG B;  2COW A;  1T3L A;  3UF4 A;  2EWN A;  3L2Q A;  4EIK A;  2CRE A;  2RA2 A;  4IUR A;  3CCM T;  3EGD A;  2F1L A;  2O4X A;  2EIF A;  5GAM g;  2LT1 A;  2FRW A;  3A8O B;  4QQ6 A;  2Q19 X;  2K57 A;  3REB B;  2AKK A;  1PSE A;  2RPN A;  2CUB A;  1D0Y A;  3DLM A;  2GQI A;  2QDY B;  2AZS A;  1QWF A;  5GAN 2;  2VYT A;  2QA4 A;  1ZC1 A;  2EGC A;  3A8L B;  4EPC A;  2YUO A;  3HKS A;  2K4Y A;  2H3E B;  5A0L A;  1Z9Z A;  4Y91 A;  3IQL A;  3EGD B;  5LJ5 g;  3BQB A;  2O4X B;  4DOV A;  2GFU A;  2VKN A;  3G1J A;  2VGM A;  3UDC A;  3GLX A;  1ZX6 A;  1I07 A;  1YHQ A;  3PTA A;  2VUB A;  1VQN A;  1NPR A;  1VQ6 Q;  3V7R A;  1NYG A;  4ESR A;  2Q1D X;  1OPK A;  5GAM d;  2EYX A;  2LX9 A;  4C8Q D;  2M0O A;  2HBP A;  2XHC A;  2K3X A;  3QSU A;  3BDL A;  2Y4Y A;  3CCR T;  1Q82 R;  5HKC A;  1UFF A;  4M78 D;  3PMT A;  3LGF A;  3CMA Q;  2JVV A;  4ORZ A;  2BTT A;  1H64 1;  3EG9 A;  2EGA A;  1KJW A;  1N9R A;  5DLO A;  2JS0 A;  4GLK A;  4HVU A;  2OTJ A;  1ZBJ A;  3OSV A;  5LJ5 d;  2KRM A;  1AZG B;  2CH4 W;  3EGX A;  1YJ9 T;  3OYF A;  1K4U S;  1VQM A;  5GMK j;  1KIK A;  1M9S A;  3RIR A;  1QVF S;  3R6O A;  1ABO A;  4M7D G;  3EG9 B;  3LWH A;  3A98 A;  4RUG A;  3HFN A;  1X01 A;  5CQY A;  4R0K A;  3JB9 F;  2AZV A;  5AT1 B;  2KSS A;  1S72 T;  5KCH A;  5GMK i;  3CCQ Q;  3ZJV A;  5GAN e;  1K8A U;  2EBP A;  1I0C A;  1KHC A;  1SHG A;  3PMI A;  4LDV A;  1G3T A;  4KRT A;  1I81 A;  2PZ1 A;  3L2U A;  2J05 A;  3OYN A;  2QTV A;  2K9G A;  3DB3 A;  1MMG A;  4CC7 A;  4BB7 A;  5DM7 R;  1WIE A;  3HL8 A;  1OQK A;  2RD1 A;  3H9N A;  2CKK A;  5EG2 A;  2FL7 A;  4IIO A;  2K5I A;  1TS9 A;  5I2M A;  1KQ2 A;  3MEW A;  2NUZ A;  4J6Y A;  4M77 C;  4C0F A;  2J6F A;  3CC2 A;  4A4F A;  2E5Q A;  4C0D B;  2KT1 A;  3QJ6 A;  1IO6 A;  3J7A F;  1N9S A;  2LJ1 A;  4FSX A;  3I55 Q;  4RMO A;  3VS6 A;  1VYT A;  2JT4 A;  2HQE A;  2MAM A;  2OI3 A;  1JQQ A;  5ERG B;  1XJW B;  2RM4 A;  5HK3 A;  2P0K A;  1NM7 A;  5KYN A;  1VQ4 Q;  2KXD A;  1Q7Y U;  3CCE A;  3CCQ T;  2EYW A;  1B07 A;  1VYV A;  2DVE A;  3M4G A;  4Q5W A;  5GMK m;  3HU3 A;  2QYZ A;  3URG A;  1ZUU A;  1I4K 1;  4OVA A;  4E7Z A;  2JTF A;  1IXD A;  1MHN A;  1G3Y A;  4M75 D;  2DZC A;  2SRC A;  2OAU A;  3RBB B;  2PWY A;  1PRL C;  3OYJ A;  2QI2 A;  2LMJ A;  3EH2 A;  1IB8 A;  4QQD A;  3CXC S;  1BYM A;  5GAO r;  1XTD A;  1VQO A;  4L6V 5;  5FU6 B;  4A53 A;  3GF5 A;  2EVR A;  2COZ A;  3PE0 A;  5KYY A;  2YRC A;  2K5L A;  1OUL A;  3PFS A;  4N0A A;  2CGH A;  2CH4 A;  4QT7 A;  4PJO C;  3E19 A;  2RJD A;  3JCM f;  3H6Z A;  4V2S A;  1K1Z A;  4OMN A;  3QJY A;  1D1C A;  2F2X A;  3JB9 G;  2DA9 A;  1KQ1 A;  2KR3 A;  3M0T A;  4EMK C;  4OML A;  1ZSG A;  3L42 A;  2DRK A;  1YWO A;  3L2R A;  3NGP A;  3LGL A;  3EFR A;  5D7U A;  1G5V A;  5GAN 3;  4PL6 A;  4DEY A;  4FT2 A;  4QQG A;  4NL3 A;  3OYL A;  1IZ6 A;  4FCY A;  3MPU B;  5GAN 8;  3KXT A;  4Y92 A;  1RLP C;  2XMF A;  3OYK A;  1VQL T;  4PKC C;  3CCS T;  1MMD A;  3LHD A;  1RI0 A;  4O5V A;  4XTV A;  3QDF A; 
#chains in the Genus database with same CATH homology
 3OYY A;  2DZ9 A;  2ZGW A;  5I2S A;  4BE1 A;  4BI4 A;  1FXX A;  3SFM A;  5HK0 A;  4MML A;  3NTK A;  5GAN d;  2XKO C;  3G7Z A;  3NFC A;  1YJN A;  4M75 G;  4P5N A;  3F70 A;  3BDU A;  3E9G A;  5FRM A;  2EQJ A;  1E32 A;  4EMG A;  3QO3 A;  4XTY A;  4BAC A;  1YIT T;  4M7A B;  3MEV A;  3L2Z A;  4C0G A;  3RMS A;  3VYH B;  3GNF B;  2PVO B;  1NJI U;  3BW1 A;  5A2Q E;  3OS0 A;  3EFS A;  3OS2 A;  3P8D A;  1N8R U;  2EJF A;  2RI5 A;  3C4S A;  2YRV A;  4MZM A;  3S3M A;  2HQX A;  4NL2 A;  3JCM W;  4C92 E;  2EFI A;  2K3Y A;  4BE2 A;  1Q86 C;  1ZHI A;  1SSF A;  2M16 A;  3DB4 A;  2O01 E;  3GOX A;  5KE3 A;  1YI2 T;  3MP6 A;  5CKE A;  4RKU E;  4OGE A;  1WJS A;  1XOV A;  4C92 C;  4VUB A;  5FU6 C;  3ZJU A;  2LC4 A;  5CKH A;  3X20 B;  5IT9 E;  3G6E T;  1OYX A;  3T9N A;  3VU3 C;  4KT0 E;  3V7S A;  4ZGE B;  1Q82 U;  1JJ2 A;  4KO8 A;  1M90 U;  4DQ2 A;  2PVD B;  3RKY A;  5KCO A;  2QEX A;  2VGN A;  4KOD A;  4GY5 A;  1K9M U;  1QW1 A;  1QVF A;  2VC8 A;  4DOW A;  3WVD B;  1VQL A;  2LT4 A;  4C92 D;  2XD0 A;  1UGR B;  3QYG B;  3CCS A;  5I21 A;  1W2B S;  2WSE E;  3MP8 A;  4ARC A;  4OB2 B;  4X9C A;  3HSB A;  2XDP A;  3M5A A;  5CCA A;  1VQ9 T;  5GAN 4;  4HCC A;  1QP3 A;  1KD1 C;  4C92 A;  2AHJ B;  3I56 A;  4RCB A;  2A7Y A;  5FLX E;  3ZGZ A;  5GLF A;  2RI2 A;  4PJO G;  4A4E A;  1K73 C;  3CCL T;  3JSC A;  5GAM e;  1U1T A;  1FX7 A;  2RI3 A;  3FLG A;  4FL6 A;  2WSF E;  3M54 A;  2FYK A;  3HU2 A;  1RL2 A;  2X4X A;  3OYI A;  2WAC A;  2MM2 A;  3HU1 A;  5FTN A;  2E41 A;  3CC7 T;  4DA4 A;  3CC4 T;  1YIT A;  4PJO F;  4JRQ A;  5GAM f;  1VQK A;  4BUG A;  4QVC A;  3LGA A;  1V29 B;  1WJQ A;  3E9F A;  3SWN C;  3OA6 A;  2EQM A;  2ZPH B;  3VYG A;  1ZQ1 A;  5KE2 A;  2DK3 A;  2E12 A;  2P0Q A;  3JB9 J;  1UEB A;  3QUI A;  3M4Y A;  4OP0 A;  1VQP T;  3JCM g;  3S6W A;  4ZGD B;  2LW6 A;  4M7A G;  2DEQ A;  3MCA B;  4J8O A;  4M78 E;  4C92 B;  2JZ2 A;  2CZ7 B;  2Y4X A;  2BUD A;  5CQX A;  4KBM B;  5LJ5 e;  2ZPI B;  2OTL A;  1M5Q 1;  1WPY A;  5DLQ E;  4BD3 A;  4J6W A;  3CCU T;  1CR5 A;  5CVI A;  3SWN A;  5C18 A;  5FU7 B;  2JN0 A;  3GNG A;  4ZN1 A;  4M78 C;  5GMK e;  4M7A F;  3G6E A;  3LWI A;  2DPP B;  5LJ5 f;  2YVL A;  4LD6 A;  1BI0 A;  5CAI A;  4N4H A;  3J81 E;  3GPL A;  3CME T;  3LH0 A;  1Q86 U;  2XU8 A;  1LOJ A;  5CKF A;  2MWO A;  1WJR A;  3CPW S;  1I8F A;  4R56 A;  1BIB A;  1VIF A;  1VQ9 A;  4B9X A;  2DO3 A;  2MMP A;  2CZ0 B;  5GAN 6;  3VUZ A;  3GIB A;  2QQA A;  3M55 A;  4XU1 A;  2I2L A;  2PUK B;  4M78 A;  3CBP A;  3QC8 A;  3OMC A;  5EQJ B;  3ZBD A;  2LVM A;  1Y96 A;  2EKO A;  3JCM h;  3CCL A;  3MHX A;  1OZ2 A;  3ER0 A;  5GAN g;  2XDD A;  2KVQ G;  4Y28 E;  3ME9 A;  1JBM A;  1N6A A;  1QDN A;  2LCC A;  4RG8 A;  3SWN B;  2Q1A X;  2JTM A;  5EPP A;  2F5T X;  2RHY A;  4PLL A;  4E7L A;  1KQS A;  2VXF A;  2YHT A;  4A4H A;  4JRP A;  3JCM d;  3HP9 A;  2E10 A;  3L1A A;  3RER A;  4CRI A;  4OMF B;  4PNO A;  3PIO A;  3QPH A;  3QZ5 B;  1NE8 A;  4FIB A;  2Q18 X;  1B34 A;  2PQW A;  1BIA A;  2DXT A;  3M56 A;  4XTX A;  1K73 U;  1WNL A;  2P0P A;  1VQP A;  1Y71 A;  2EQU A;  2RHI A;  3S3N A;  1BI1 A;  2XI9 A;  5M9O A;  2YLB A;  3INZ A;  3FC3 A;  3MB5 A;  3OBW A;  4ZTJ A;  2RJC A;  4M78 B;  5CKB A;  3CBO A;  2RO0 A;  3OYG A;  4RV0 A;  5LJ3 h;  3QQ8 A;  3M9Q A;  3OYH A;  2PU9 B;  3QHS A;  1UB4 A;  2QXF A;  1QVG S;  3DLL A;  4J5Y A;  4L59 A;  2JNG A;  2E6Z A;  4C92 G;  5GAN h;  2QQR A;  3RMQ A;  2R58 A;  5LJ3 d;  3TIW A;  3OW2 A;  2KDS A;  2JV2 A;  5LJ3 j;  1O75 A;  3CME A;  1AHJ B;  1YJW T;  1M1K U;  3EAE A;  3JCM P;  2DD4 A;  3ASK A;  3LX7 A;  3UWN A;  1B34 B;  3TEE A;  2K5F A;  5GAO m;  2HAX A;  2CS7 A;  2LQK A;  4C92 F;  2QA4 T;  5GAN j;  1VQ6 T;  1R7R A;  2HD0 A;  2F5K A;  5DYG A;  4ZGJ B;  2DTI A;  3HHT B;  4OB0 B;  5CKD A;  2D6F A;  2B25 A;  1UGP B;  2H3J A;  3QWZ A;  1KC8 C;  1VQK T;  3RKW A;  3CXC A;  1HXD A;  4IKF A;  3C94 A;  4M7D E;  3QXE B;  3BY7 A;  4BDZ A;  4HCB A;  1S3S A;  5A0D A;  2EYQ A;  2LCL A;  5GAO n;  3G71 T;  1HK9 A;  3QSU A;  4MDX A;  4XU3 A;  4FM4 B;  1QVP A;  1VUB A;  3LYI A;  3QII A;  5J26 A;  5CD1 A;  1X75 C;  3JAM E;  2RH2 A;  4R55 A;  2QQS A;  2GF7 A;  3OQ5 A;  3CMA T;  3MEA A;  4M7D C;  1VQ8 T;  2ZPF B;  2RHZ A;  2DKG A;  1YHQ T;  3H8Z A;  3OYE A;  4NS5 A;  2OTL T;  1VQN T;  4OB1 B;  5GAN 7;  2FHD A;  1CZ4 A;  1G3S A;  1N27 A;  4BI3 A;  4Z02 A;  3OS1 A;  2CYZ B;  3CBM A;  5FTJ A;  4LDU A;  4M7D D;  5D6W A;  2RHX A;  2EWN A;  5L8R E;  3L2Q A;  1TH7 A;  4ATO A;  1PSF A;  3ZFJ A;  3VUB A;  4J6X A;  1OI1 A;  3RES A;  2RA2 A;  4IUR A;  3G4S T;  3CCM T;  4M7D A;  3HFO A;  4B9W A;  3FB9 A;  5FU7 C;  2O4X A;  1WQW A;  2EIF A;  4QW2 A;  2LDM A;  3MP1 A;  1NPP A;  2LT1 A;  3KBG A;  3BFM A;  5GAM g;  3AHU A;  2K2V A;  3NTH A;  3RKX A;  4HT8 A;  3A8O B;  2PJH B;  4QQ6 A;  2Q19 X;  4M78 G;  2JUF A;  2RK1 A;  2K57 A;  1PSE A;  2V8I A;  1YJW A;  3A8H B;  4C8Q F;  3JCM Q;  2KMT A;  4KUD K;  4A4K A;  3DLM A;  1IRE B;  2QDY B;  2X35 A;  5AYF A;  1U1S A;  2E6N A;  4KUI A;  2VYT A;  1OZ3 A;  5GAN 2;  5GAO l;  3L2V A;  2QA4 A;  4E7J A;  1VQ6 A;  4JS4 A;  1VQ5 T;  2L8D A;  2R5M A;  1ZC1 A;  3QQ7 A;  4M78 F;  1I9G A;  5CR2 A;  3A8L B;  2YUJ A;  2DTO A;  4EPC A;  2BIV A;  2A3L A;  3CD6 T;  3HKS A;  2K4Y A;  5A0L A;  4Y91 A;  4JUV A;  3HRU A;  4M7D B;  1QP2 A;  1ZBX A;  4C8Q E;  5LJ5 g;  3BQB A;  2O4X B;  3G71 A;  2DIQ A;  4YTL A;  4DOV A;  2GFU A;  4JDS A;  1CZ5 A;  4J7I A;  4M77 B;  3L2W A;  1XNI A;  2VGM A;  3UDC A;  3GLX A;  3MET A;  3CMA A;  5GAM h;  3FJP A;  1K8A C;  1VQ8 A;  5IAY A;  4C8Q C;  1YHQ A;  3TCJ A;  2GFA A;  2L3R A;  2KK4 A;  2VUB A;  2X4W A;  3PTA A;  1VQN A;  1YCY A;  2QQB A;  3OS5 A;  1NPR A;  4QVD A;  4JJN K;  2VXE A;  3V7R A;  4A4G A;  4F7U E;  3ZEH A;  4IUP A;  5FRN A;  2Q1D X;  5C1B A;  5GAM d;  1G3W A;  2LX9 A;  2RJE A;  1EIF A;  4LDW A;  5GAM j;  4C8Q D;  4C5I A;  3PNW C;  2M0O A;  3G4S A;  2IVW A;  3CCM A;  2HBP A;  2XHC A;  4IUV A;  2G3R A;  2K3X A;  1BI2 A;  4C8Q A;  3BDL A;  2Y4Y A;  2MI6 A;  3SD4 A;  2DD5 A;  3X25 B;  3JCM c;  5HKC A;  4X9D A;  3CCR T;  1X6O A;  4M78 D;  1QCS A;  3M59 A;  5LJ3 g;  3PMT A;  1JB0 E;  3LGF A;  4IUQ A;  5LJ5 h;  5FTM A;  1D3B A;  2JVV A;  1VIE A;  5CIU A;  4J7F A;  1H64 1;  2DAQ A;  1UGS B;  5J3B A;  1M1G A;  3PGG A;  1N9R A;  3SDZ A;  3CCV A;  5DLO A;  2MM0 A;  4OF1 A;  4GLK A;  2F69 A;  2OTJ A;  3OSV A;  5GMK h;  2ZCF B;  3FPT A;  1VQ5 A;  4EDU A;  5LJ5 d;  4F7U A;  3I55 T;  5LJ5 j;  2IG0 A;  5IN1 A;  1YJ9 T;  4HT9 A;  3OYF A;  3CD6 A;  2CZ1 B;  1VQM A;  3QKJ A;  4XU2 A;  3CCQ A;  4EMH A;  2L89 A;  1KD1 U;  2RHU A;  4XU0 A;  4BY6 C;  5GMK j;  3JCM X;  1JJ2 S;  4C8Q B;  3PIP A;  1M9S A;  2XK0 A;  3TRE A;  3CF2 A;  3Q1J A;  3RIR A;  3CC2 T;  1QVF S;  2Q1C X;  3MEU A;  1M8V A;  2X4Y A;  1D3B B;  1VQ4 T;  3R6O A;  3UT1 A;  4M7D G;  4QVZ A;  3LWH A;  3A8M B;  4KLN A;  1W2B A;  3HFN A;  3FPU A;  1X01 A;  5CQY A;  2DJZ A;  4AQ7 A;  1YBY A;  3M57 A;  3JB9 F;  4C0D C;  3OSS C;  4AS1 A;  4C5H A;  4F7U B;  1LNX A;  4OB3 B;  4E7K A;  1U8R A;  1Q7Y C;  2KSS A;  1S72 T;  5KCH A;  4M7D F;  2KY9 A;  3HRS A;  5GMK i;  3ZJV A;  4IUT A;  5GAN e;  1KG1 A;  2DXB A;  3CEY A;  3OBY A;  4XAX B;  2R57 A;  4LDX A;  4TVR A;  3CCJ T;  1O9S A;  2GCX A;  2LRQ A;  4XTU A;  4M77 F;  3CCR A;  3S3O A;  1K8A U;  2FVU A;  1NZ9 A;  1KHC A;  5GAO p;  3PMI A;  2E64 A;  1G3T A;  4LDV A;  4LDY A;  5GAN f;  2V8K A;  4XTZ A;  1I81 A;  4ELZ C;  4ME7 A;  3L2U A;  3JB9 I;  2P4T A;  3OYN A;  3DB3 A;  3CCE T;  4JRK A;  4BB7 A;  3PT9 A;  2CZ6 B;  1W4S A;  3VV0 A;  2DTH A;  3HL8 A;  3V7C A;  5DM7 R;  3I55 A;  4BY6 B;  2RD1 A;  3CPF A;  2CKK A;  2M9U A;  5EG2 A;  4M77 E;  1Y7X A;  1DJ7 B;  3M58 A;  1YJ9 A;  2FL7 A;  3O8V A;  4ARI A;  2E1H A;  4EMK B;  4NOY A;  3M53 A;  2K5I A;  3LLR A;  5I2M A;  4E47 A;  1KQ2 A;  2MF2 A;  3OY9 A;  3JB9 D;  3MEW A;  2ZPE B;  4J6Y A;  4JRI A;  3OYD A;  4M77 C;  4C0F A;  5C0M A;  3CC2 A;  4A4F A;  1I5L A;  1WQ7 A;  2E5Q A;  4C0D B;  3OB9 A;  2HNI A;  4II1 A;  2X4J A;  5LL6 S;  1VQ4 A;  3FDR A;  4WF2 A;  2QTX A;  3QJ6 A;  2LNV A;  5J39 A;  3SB2 A;  3J7A F;  1N9S A;  1WGS A;  3CPW A;  4C8Q G;  3ZJT A;  4M77 D;  4FSX A;  4M75 F;  4LD9 K;  2EQK A;  4RMO A;  1BI3 A;  2LQ8 A;  1S72 A;  2HQE A;  2MAM A;  4M77 A;  4BI8 B;  1VQO T;  2C06 A;  3OMG A;  5ERG B;  4HA8 A;  1WLF A;  1KQS S;  4CQN A;  3CCJ A;  2RM4 A;  5HK3 A;  2FB7 A;  5HY6 A;  3E1S A;  3CCV T;  4F7U G;  2P0K A;  4HKE A;  4RG2 A;  4ELY C;  2DXC A;  2YLC A;  2DIG A;  4M75 E;  3MO8 A;  4OGC A;  4UC4 A;  4C5G A;  2XDB A;  3QBY A;  3QDR B;  4MZT A;  4X34 A;  1Q7Y U;  4KDL A;  1P92 A;  4J83 A;  1VQM T;  1YIJ A;  2V8J A;  3CCE A;  3CCQ T;  5CCB A;  4F7U F;  1Q81 C;  5FTK A;  2DVE A;  3M4G A;  2D0Q B;  4Q5W A;  3WVE B;  3WXM B;  5GMK m;  3TU4 K;  3HU3 A;  3FIF A;  4M75 C;  3URG A;  1I4K 1;  4OVA A;  5CO7 A;  2GQV A;  3QG1 A;  4RCC A;  2JTF A;  2Y90 A;  2PUO B;  1MHN A;  1FWZ A;  2ZZD A;  3A5Z B;  3P8B B;  4O6J A;  1VQ7 T;  3JCM b;  3OW2 S;  2RK2 A;  3X24 B;  4A54 A;  1G3Y A;  3VJP A;  2EJG A;  4M75 D;  1QVG A;  3N5B B;  3GP8 A;  2DZC A;  3V8J A;  4JS5 A;  2ZPG B;  1KC8 U;  2OAU A;  4M75 A;  2PWY A;  2LTO A;  3OYJ A;  3JCM J;  4E7H A;  2QI2 A;  5FRO A;  2WSC E;  1M4Z A;  2QQ9 A;  3X26 B;  4QQD A;  5CK9 A;  3NTI A;  4N0A C;  3RUX A;  3CXC S;  5GAO r;  1BYM A;  1XTD A;  1M1K C;  1VQO A;  5C6S A;  1M1F A;  3KUF A;  3QYH B;  4L6V 5;  3GF5 A;  5FU6 B;  4A53 A;  1MGQ A;  2NLU A;  1LJO A;  4C0Z A;  5GAN 5;  4BDY A;  1YI2 A;  4PJO E;  2XIC A;  2DXU A;  3VKI A;  4ZN3 A;  3JCM e;  1BKB A;  2K5L A;  2XG8 D;  1R8O B;  3QZ9 B;  4M75 B;  3PFS A;  2E65 A;  2MWP A;  2B8A A;  4N0A A;  1GXI E;  2CGH A;  1KHI A;  4L5G A;  2M1H A;  1NJI C;  4PJO C;  1Y07 A;  2RJF A;  4D6W A;  2BKD N;  3E19 A;  2RJD A;  3C12 A;  3V8L A;  4FU6 A;  3LW5 E;  4JLI A;  3JCM f;  2KQW A;  3H6Z A;  3HRT A;  1N8R C;  5CCX A;  5GMK l;  4HCZ A;  4V2S A;  3QJY A;  3JB9 G;  3J80 E;  4MMK A;  5DY9 A;  1YJN T;  2EAY A;  1UGQ B;  3OYA A;  1KQ1 A;  3JCM V;  5D6X A;  4EMK C;  5KH6 A;  4PJO D;  3OYC A;  5FTL A;  4FT4 A;  4N4I A;  4M7A E;  4XQ3 A;  1VQ7 A;  3FEO A;  3L42 A;  1O54 A;  4PJO A;  4KUL A;  5LJ3 e;  3L2R A;  2JOY A;  4M77 G;  1Q81 U;  3LGL A;  5A0G A;  3CC7 A;  1Q82 C;  2L5Q A;  2VV5 A;  3JRZ A;  1M90 C;  4M7A C;  3C95 A;  4N4G A;  3CC4 A;  5B6C A;  2PVG B;  3EFR A;  1K9M C;  5DYI A;  2RB6 A;  3A8G B;  3P8H A;  4C5E A;  4EMK A;  4MDW A;  3OYM A;  4ZTF A;  1G5V A;  5LJ3 f;  5GAN 3;  2R5A A;  5D6Y A;  3FRN A;  4PL6 A;  3JB9 H;  4FT2 A;  4QQG A;  4NL3 A;  4CI0 C;  3OYL A;  1IZ6 A;  1XQH A;  4M7A D;  4JLG A;  1JRI A;  2XID A;  5GAN 8;  4BE0 A;  3KXT A;  2E70 A;  4M7A A;  1Y96 B;  4PLI A;  3V8K A;  2D9T A;  3OYB A;  2QEX T;  3DKM A;  4XTW A;  3CCU A;  1YIJ T;  4PJO B;  3OYK A;  1VQL T;  4PKC C;  2EJ9 A;  3HPW A;  2ZPB B;  4MZP A;  3CCS T;  2KAF A;  4E7I A;  1H3Z A;  4KDI A;  3LHD A;  3FPR A;  4IUU A;  4XK8 E;  1RI0 A;  5GAO q;  3X28 B;  3UPU A;  4O5V A;  4XTV A;  2OTJ T;  3I56 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...