3QQ7A

Crystal structure of the p97 n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
KNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Hierarchical Binding of Cofactors to the AAA ATPase p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 168
sequence length 168
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qq7A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qq7A02
1IW7D 1CZ4A 5EPPA 1EU1A 1OGYA 2VPWA 3IR6A 2JA6A 4QIWA 5C1BA 4CS0A 1PT1A 2KI8A 1E5VA 2V45A 1PPYA 3GTQA 2C45A 5T5MD 1UHDA 3IR7A 3GTPA 1E60A 1CR5A 1WCMA 1KQFA 1G8KA 4CRZA 2NVXA 2NAPA 5GLFA 2NYAA 1TWGA 3HKZA 1QDNA 1FDIA 2EEOB 4KO8A 1K83A 4DMRA 1I50A 1TWFA 1R9TA 1Y1WA 3HU1A 3QC8A 4KODA 1UHEA 2E2IA 1PQHA 4AOKB 4AAYA 2JIOA 4GA5A 1ZC1A 1YLEA 1H0HA 1PQFA 3GTJA 2YUJA 5FTKA 4AONB 2VUMA 1WLFA 3QQ8A 2R92A 3GTGA 3O5AA 2R7ZA 3GTKA 4RV0A 2IV2X 3GTOA 2V3VA 1E32A 2WAQA 2YU9A 3GTLA 5T5ID 2E7ZA 1VC3B 2JIRA 3QWZA 1Q16A 1KQGA 2JA7A 1TWHA 2Y0SA 3DMRA 5B6CA 2JA5A 2VPZA 1PYQA 5FTJA 1TWCA 2WB1A 1Y1VA 2DMRA 3QQ7A 5C18A 1CZ5A 1AA6A 1DMRA 3IR5A 2R93A 4KLNA 1PQEA 1TWAA 4KDLA 1PT0A 3PLXB 5FTLA 4AYBA 5DYIA 2JIQA 3CF2A 1H5NA 4D7ZB 3FKIA 2JV2A 2JIMA 1FDOA 1AW8B 2E2HA 3HU3A 2PMZA 5FTMA 1PYUB 2VPXA 1SIWA 1Y5IA 3ML1A 3TIWA 1R27A 2B63A 2VPYA 1I3QA 1TMOA 1Y4ZA 1E18A 3H0GA 1G8JA 5DYGA 2NVYA 4CRYG 1SFOA 5FTNA 4C2MA 4GA6A 1R7RA 1S3SA 3OUGA 3TM7B 4AZDA 3HU2A 1DMSA 4KDIA 3GTMA 2PJHB 1E61A 2JIPA 3CQZA 1QCSA
chains in the Genus database with same CATH superfamily
1IW7D 1CZ4A 1OA7A 1EU1A 1OGYA 5EPPA 4UC4A 2VPWA 4JS7A 3IR6A 2JA6A 4QIWA 3LHDA 5C1BA 4CS0A 3X2PA 1PT1A 1BW3A 2KI8A 1E5VA 2V45A 3X2HA 1PPYA 3GTQA 2C45A 5T5MD 2Q1CX 1UHDA 3IR7A 2G6GA 1E60A 3GTPA 1CR5A 2AE0X 1WCMA 1KQFA 2G5DA 1G8KA 2A6ED 3X2IA 3X2GA 4CRZA 2NAPA 5GLFA 2NVXA 3SULA 2NYAA 1TWGA 4JP6A 3HKZA 4JJOA 1QDNA 2QQRA 4ARIA 3ZJVA 5GLYA 1FDIA 2EEOB 5H4UA 3FPRA 4FERA 4KO8A 1K83A 4L48A 1I9GA 4DMRA 1I50A 1TWFA 1R9TA 1Y1WA 3X2MA 3HU1A 2MM0A 3QC8A 4KODA 1UHEA 1L8FA 1PQHA 2E2IA 3X2JA 4AOKB 4AAYA 2JIOA 4GA5A 1ZC1A 1YLEA 2A68D 2BH0A 1YNND 3FPUA 1H0HA 3FPTA 3M3GA 1PQFA 3GTJA 2Q1DX 2YUJA 5FTKA 2XDPA 4AONB 2VUMA 2B25A 1WLFA 3QQ8A 2PWYA 2A69D 2R92A 3GTGA 1HD5A 1N10A 3O5AA 2R7ZA 3GTKA 4RV0A 2IV2X 3GTOA 2V3VA 1E32A 2MM2A 2WAQA 2YU9A 3GTLA 2ENGA 3D30A 5T5ID 2E7ZA 1VC3B 2JIRA 3QWZA 1Q16A 3SUMA 1KQGA 3X2NA 1TWHA 2Y0SA 3DMRA 2JA7A 2QQSA 5CD1A 5B6CA 3ZJTA 4ARCA 2PNWA 2JA5A 4FFTA 2KY9A 1YNJD 2VPZA 1PYQA 5EQJB 5FTJA 2Q19X 2PI8A 1TWCA 3ENGA 2WB1A 1OA9A 3MB5A 5GM9A 2KQAA 3ZGZA 1Y1VA 2DMRA 3QQ7A 5C18A 1CZ5A 5CCBA 3LGAA 2PICA 4ZM7A 1AA6A 1DMRA 3IR5A 3X2KA 3SUKA 2R93A 4KLNA 1PQEA 1TWAA 4KDLA 1PT0A 3PLXB 5FTLA 4NOHA 3CZBA 4AYBA 2LW6A 5DYIA 2JIQA 3BQBA 4AS1A 3CF2A 1H5NA 4JP7A 4D7ZB 3FKIA 2GAEA 4FIBA 2CW0D 2JV2A 2HCZX 2GFAA 2JIMA 1FDOA 1AW8B 2E2HA 5CCXA 3HU3A 2O5JD 2PMZA 5FTMA 3ZJUA 2A6HD 1WC2A 1PYUB 2Q1AX 2VPXA 1SIWA 1Y5IA 3ML1A 3TIWA 4AVRA 3X2LA 1R27A 2B63A 4ENGA 2YVLA 2BE5D 4FG4A 2VPYA 1I3QA 5D6YA 5GLXA 1SMYD 5D6XA 1TMOA 1Y4ZA 3X2OA 2GF7A 3SUJA 1E18A 3H0GA 1G8JA 1ZYRD 5DYGA 1O54A 2NVYA 4CRYG 1SFOA 4AQ7A 5FTNA 4C2MA 4GA6A 4FG2A 1R7RA 1S3SA 3OUGA 3TM7B 4AZDA 5ERGB 3HU2A 2PJJA 4CQNA 1DMSA 4KDIA 1BW4A 4JCWA 3GTMA 5D6WA 2PJHB 2Q18X 1E61A 2JIPA 3CQZA 1QCSA
chains in the Genus database with same CATH topology
1IW7D 1CZ4A 5EPPA 1EU1A 1OGYA 4UC4A 2VPWA 3IR6A 2JA6A 4QIWA 3LHDA 5C1BA 4CS0A 1PT1A 2KI8A 1E5VA 2V45A 1PPYA 3GTQA 2C45A 5T5MD 2Q1CX 1UHDA 3IR7A 2G6GA 1E60A 3GTPA 1CR5A 2AE0X 1WCMA 1KQFA 2G5DA 1G8KA 2A6ED 4CRZA 2NVXA 2NAPA 5GLFA 2NYAA 1TWGA 3HKZA 1QDNA 2QQRA 4ARIA 3ZJVA 1FDIA 2EEOB 3FPRA 4KO8A 1K83A 1I9GA 4DMRA 1I50A 1TWFA 1R9TA 1Y1WA 3HU1A 2MM0A 3QC8A 4KODA 1UHEA 2E2IA 1PQHA 4AOKB 4AAYA 2JIOA 4GA5A 1ZC1A 1YLEA 2A68D 1YNND 3FPUA 1H0HA 3FPTA 1PQFA 3GTJA 2Q1DX 2YUJA 5FTKA 2XDPA 4AONB 2VUMA 2B25A 1WLFA 3QQ8A 2PWYA 2A69D 2R92A 3GTGA 3O5AA 2R7ZA 3GTKA 4RV0A 2IV2X 3GTOA 2V3VA 1E32A 2MM2A 2WAQA 2YU9A 3GTLA 5T5ID 2E7ZA 1VC3B 2JIRA 3QWZA 1Q16A 1KQGA 2JA7A 1TWHA 2Y0SA 3DMRA 2QQSA 5CD1A 5B6CA 3ZJTA 4ARCA 2PNWA 2JA5A 2KY9A 5EQJB 1YNJD 2VPZA 1PYQA 5FTJA 2Q19X 2PI8A 1TWCA 2WB1A 3MB5A 3ZGZA 1Y1VA 2DMRA 3QQ7A 5C18A 1CZ5A 5CCBA 3LGAA 2PICA 1AA6A 1DMRA 3IR5A 2R93A 4KLNA 1PQEA 1TWAA 4KDLA 1PT0A 3PLXB 5FTLA 4NOHA 3CZBA 4AYBA 2LW6A 5DYIA 2JIQA 3BQBA 4AS1A 3CF2A 1H5NA 4D7ZB 3FKIA 2GAEA 4FIBA 2CW0D 2JV2A 2GFAA 2JIMA 1FDOA 1AW8B 2E2HA 5CCXA 3HU3A 2O5JD 2PMZA 5FTMA 3ZJUA 2A6HD 1PYUB 2Q1AX 2VPXA 1SIWA 1Y5IA 3ML1A 3TIWA 1R27A 2B63A 2YVLA 2BE5D 2VPYA 1I3QA 5D6YA 1SMYD 5D6XA 1TMOA 1Y4ZA 2GF7A 1O54A 1E18A 3H0GA 1G8JA 1ZYRD 5DYGA 2NVYA 4CRYG 1SFOA 4AQ7A 5FTNA 4C2MA 4GA6A 1R7RA 1S3SA 3OUGA 3TM7B 4AZDA 5ERGB 3HU2A 2PJJA 4CQNA 1DMSA 4KDIA 3GTMA 5D6WA 2PJHB 2Q18X 1E61A 2JIPA 3CQZA 1QCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 D;  1CZ4 A;  5EPP A;  1EU1 A;  1OGY A;  2VPW A;  3IR6 A;  2JA6 A;  4QIW A;  5C1B A;  4CS0 A;  1PT1 A;  2KI8 A;  1E5V A;  2V45 A;  1PPY A;  3GTQ A;  2C45 A;  5T5M D;  1UHD A;  3IR7 A;  3GTP A;  1E60 A;  1CR5 A;  1WCM A;  1KQF A;  1G8K A;  4CRZ A;  2NVX A;  2NAP A;  5GLF A;  2NYA A;  1TWG A;  3HKZ A;  1QDN A;  1FDI A;  2EEO B;  4KO8 A;  1K83 A;  4DMR A;  1I50 A;  1TWF A;  1R9T A;  1Y1W A;  3HU1 A;  3QC8 A;  4KOD A;  1UHE A;  2E2I A;  1PQH A;  4AOK B;  4AAY A;  2JIO A;  4GA5 A;  1ZC1 A;  1YLE A;  1H0H A;  1PQF A;  3GTJ A;  2YUJ A;  5FTK A;  4AON B;  2VUM A;  1WLF A;  3QQ8 A;  2R92 A;  3GTG A;  3O5A A;  2R7Z A;  3GTK A;  4RV0 A;  2IV2 X;  3GTO A;  2V3V A;  1E32 A;  2WAQ A;  2YU9 A;  3GTL A;  5T5I D;  2E7Z A;  1VC3 B;  2JIR A;  3QWZ A;  1Q16 A;  1KQG A;  2JA7 A;  1TWH A;  2Y0S A;  3DMR A;  5B6C A;  2JA5 A;  2VPZ A;  1PYQ A;  5FTJ A;  1TWC A;  2WB1 A;  1Y1V A;  2DMR A;  3QQ7 A;  5C18 A;  1CZ5 A;  1AA6 A;  1DMR A;  3IR5 A;  2R93 A;  4KLN A;  1PQE A;  1TWA A;  4KDL A;  1PT0 A;  3PLX B;  5FTL A;  4AYB A;  5DYI A;  2JIQ A;  3CF2 A;  1H5N A;  4D7Z B;  3FKI A;  2JV2 A;  2JIM A;  1FDO A;  1AW8 B;  2E2H A;  3HU3 A;  2PMZ A;  5FTM A;  1PYU B;  2VPX A;  1SIW A;  1Y5I A;  3ML1 A;  3TIW A;  1R27 A;  2B63 A;  2VPY A;  1I3Q A;  1TMO A;  1Y4Z A;  1E18 A;  3H0G A;  1G8J A;  5DYG A;  2NVY A;  4CRY G;  1SFO A;  5FTN A;  4C2M A;  4GA6 A;  1R7R A;  1S3S A;  3OUG A;  3TM7 B;  4AZD A;  3HU2 A;  1DMS A;  4KDI A;  3GTM A;  2PJH B;  1E61 A;  2JIP A;  3CQZ A;  1QCS A; 
#chains in the Genus database with same CATH topology
 1IW7 D;  1CZ4 A;  1OA7 A;  1EU1 A;  1OGY A;  5EPP A;  4UC4 A;  2VPW A;  4JS7 A;  3IR6 A;  2JA6 A;  4QIW A;  3LHD A;  5C1B A;  4CS0 A;  3X2P A;  1PT1 A;  1BW3 A;  2KI8 A;  1E5V A;  2V45 A;  3X2H A;  1PPY A;  3GTQ A;  2C45 A;  5T5M D;  2Q1C X;  1UHD A;  3IR7 A;  2G6G A;  1E60 A;  3GTP A;  1CR5 A;  2AE0 X;  1WCM A;  1KQF A;  2G5D A;  1G8K A;  2A6E D;  3X2I A;  3X2G A;  4CRZ A;  2NAP A;  5GLF A;  2NVX A;  3SUL A;  2NYA A;  1TWG A;  4JP6 A;  3HKZ A;  4JJO A;  1QDN A;  2QQR A;  4ARI A;  3ZJV A;  5GLY A;  1FDI A;  2EEO B;  5H4U A;  3FPR A;  4FER A;  4KO8 A;  1K83 A;  4L48 A;  1I9G A;  4DMR A;  1I50 A;  1TWF A;  1R9T A;  1Y1W A;  3X2M A;  3HU1 A;  2MM0 A;  3QC8 A;  4KOD A;  1UHE A;  1L8F A;  1PQH A;  2E2I A;  3X2J A;  4AOK B;  4AAY A;  2JIO A;  4GA5 A;  1ZC1 A;  1YLE A;  2A68 D;  2BH0 A;  1YNN D;  3FPU A;  1H0H A;  3FPT A;  3M3G A;  1PQF A;  3GTJ A;  2Q1D X;  2YUJ A;  5FTK A;  2XDP A;  4AON B;  2VUM A;  2B25 A;  1WLF A;  3QQ8 A;  2PWY A;  2A69 D;  2R92 A;  3GTG A;  1HD5 A;  1N10 A;  3O5A A;  2R7Z A;  3GTK A;  4RV0 A;  2IV2 X;  3GTO A;  2V3V A;  1E32 A;  2MM2 A;  2WAQ A;  2YU9 A;  3GTL A;  2ENG A;  3D30 A;  5T5I D;  2E7Z A;  1VC3 B;  2JIR A;  3QWZ A;  1Q16 A;  3SUM A;  1KQG A;  3X2N A;  1TWH A;  2Y0S A;  3DMR A;  2JA7 A;  2QQS A;  5CD1 A;  5B6C A;  3ZJT A;  4ARC A;  2PNW A;  2JA5 A;  4FFT A;  2KY9 A;  1YNJ D;  2VPZ A;  1PYQ A;  5EQJ B;  5FTJ A;  2Q19 X;  2PI8 A;  1TWC A;  3ENG A;  2WB1 A;  1OA9 A;  3MB5 A;  5GM9 A;  2KQA A;  3ZGZ A;  1Y1V A;  2DMR A;  3QQ7 A;  5C18 A;  1CZ5 A;  5CCB A;  3LGA A;  2PIC A;  4ZM7 A;  1AA6 A;  1DMR A;  3IR5 A;  3X2K A;  3SUK A;  2R93 A;  4KLN A;  1PQE A;  1TWA A;  4KDL A;  1PT0 A;  3PLX B;  5FTL A;  4NOH A;  3CZB A;  4AYB A;  2LW6 A;  5DYI A;  2JIQ A;  3BQB A;  4AS1 A;  3CF2 A;  1H5N A;  4JP7 A;  4D7Z B;  3FKI A;  2GAE A;  4FIB A;  2CW0 D;  2JV2 A;  2HCZ X;  2GFA A;  2JIM A;  1FDO A;  1AW8 B;  2E2H A;  5CCX A;  3HU3 A;  2O5J D;  2PMZ A;  5FTM A;  3ZJU A;  2A6H D;  1WC2 A;  1PYU B;  2Q1A X;  2VPX A;  1SIW A;  1Y5I A;  3ML1 A;  3TIW A;  4AVR A;  3X2L A;  1R27 A;  2B63 A;  4ENG A;  2YVL A;  2BE5 D;  4FG4 A;  2VPY A;  1I3Q A;  5D6Y A;  5GLX A;  1SMY D;  5D6X A;  1TMO A;  1Y4Z A;  3X2O A;  2GF7 A;  3SUJ A;  1E18 A;  3H0G A;  1G8J A;  1ZYR D;  5DYG A;  1O54 A;  2NVY A;  4CRY G;  1SFO A;  4AQ7 A;  5FTN A;  4C2M A;  4GA6 A;  4FG2 A;  1R7R A;  1S3S A;  3OUG A;  3TM7 B;  4AZD A;  5ERG B;  3HU2 A;  2PJJ A;  4CQN A;  1DMS A;  4KDI A;  1BW4 A;  4JCW A;  3GTM A;  5D6W A;  2PJH B;  2Q18 X;  1E61 A;  2JIP A;  3CQZ A;  1QCS A; 
#chains in the Genus database with same CATH homology
 1IW7 D;  1CZ4 A;  5EPP A;  1EU1 A;  1OGY A;  4UC4 A;  2VPW A;  3IR6 A;  2JA6 A;  4QIW A;  3LHD A;  5C1B A;  4CS0 A;  1PT1 A;  2KI8 A;  1E5V A;  2V45 A;  1PPY A;  3GTQ A;  2C45 A;  5T5M D;  2Q1C X;  1UHD A;  3IR7 A;  2G6G A;  1E60 A;  3GTP A;  1CR5 A;  2AE0 X;  1WCM A;  1KQF A;  2G5D A;  1G8K A;  2A6E D;  4CRZ A;  2NVX A;  2NAP A;  5GLF A;  2NYA A;  1TWG A;  3HKZ A;  1QDN A;  2QQR A;  4ARI A;  3ZJV A;  1FDI A;  2EEO B;  3FPR A;  4KO8 A;  1K83 A;  1I9G A;  4DMR A;  1I50 A;  1TWF A;  1R9T A;  1Y1W A;  3HU1 A;  2MM0 A;  3QC8 A;  4KOD A;  1UHE A;  2E2I A;  1PQH A;  4AOK B;  4AAY A;  2JIO A;  4GA5 A;  1ZC1 A;  1YLE A;  2A68 D;  1YNN D;  3FPU A;  1H0H A;  3FPT A;  1PQF A;  3GTJ A;  2Q1D X;  2YUJ A;  5FTK A;  2XDP A;  4AON B;  2VUM A;  2B25 A;  1WLF A;  3QQ8 A;  2PWY A;  2A69 D;  2R92 A;  3GTG A;  3O5A A;  2R7Z A;  3GTK A;  4RV0 A;  2IV2 X;  3GTO A;  2V3V A;  1E32 A;  2MM2 A;  2WAQ A;  2YU9 A;  3GTL A;  5T5I D;  2E7Z A;  1VC3 B;  2JIR A;  3QWZ A;  1Q16 A;  1KQG A;  2JA7 A;  1TWH A;  2Y0S A;  3DMR A;  2QQS A;  5CD1 A;  5B6C A;  3ZJT A;  4ARC A;  2PNW A;  2JA5 A;  2KY9 A;  5EQJ B;  1YNJ D;  2VPZ A;  1PYQ A;  5FTJ A;  2Q19 X;  2PI8 A;  1TWC A;  2WB1 A;  3MB5 A;  3ZGZ A;  1Y1V A;  2DMR A;  3QQ7 A;  5C18 A;  1CZ5 A;  5CCB A;  3LGA A;  2PIC A;  1AA6 A;  1DMR A;  3IR5 A;  2R93 A;  4KLN A;  1PQE A;  1TWA A;  4KDL A;  1PT0 A;  3PLX B;  5FTL A;  4NOH A;  3CZB A;  4AYB A;  2LW6 A;  5DYI A;  2JIQ A;  3BQB A;  4AS1 A;  3CF2 A;  1H5N A;  4D7Z B;  3FKI A;  2GAE A;  4FIB A;  2CW0 D;  2JV2 A;  2GFA A;  2JIM A;  1FDO A;  1AW8 B;  2E2H A;  5CCX A;  3HU3 A;  2O5J D;  2PMZ A;  5FTM A;  3ZJU A;  2A6H D;  1PYU B;  2Q1A X;  2VPX A;  1SIW A;  1Y5I A;  3ML1 A;  3TIW A;  1R27 A;  2B63 A;  2YVL A;  2BE5 D;  2VPY A;  1I3Q A;  5D6Y A;  1SMY D;  5D6X A;  1TMO A;  1Y4Z A;  2GF7 A;  1O54 A;  1E18 A;  3H0G A;  1G8J A;  1ZYR D;  5DYG A;  2NVY A;  4CRY G;  1SFO A;  4AQ7 A;  5FTN A;  4C2M A;  4GA6 A;  1R7R A;  1S3S A;  3OUG A;  3TM7 B;  4AZD A;  5ERG B;  3HU2 A;  2PJJ A;  4CQN A;  1DMS A;  4KDI A;  3GTM A;  5D6W A;  2PJH B;  2Q18 X;  1E61 A;  2JIP A;  3CQZ A;  1QCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...