3QQ7A

Crystal structure of the p97 n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
KNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hierarchical Binding of Cofactors to the AAA ATPase p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 46
structure length 168
sequence length 168
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qq7A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qq7A02
1TWGA 4KODA 4CS0A 3QQ7A 1CR5A 1Y5IA 1TWCA 3QC8A 5T5ID 2VUMA 1G8JA 1UHEA 2V45A 3IR5A 3IR7A 2E7ZA 2PJHB 2NVYA 3HU3A 2JIRA 3GTKA 4CRZA 1PQEA 1E32A 2JIPA 1TMOA 2VPYA 1PQFA 2E2HA 1ZC1A 4AZDA 1PQHA 2E2IA 5FTMA 3PLXB 1DMSA 1PYUB 1KQGA 2NAPA 3CF2A 3GTQA 3ML1A 3OUGA 1FDIA 2KI8A 1AW8B 3DMRA 3FKIA 1PT0A 2JIOA 5GLFA 2V3VA 2Y0SA 1DMRA 1OGYA 4GA6A 2PMZA 2JV2A 4KLNA 4AOKB 2NVXA 1PPYA 4DMRA 2EEOB 2JA7A 2B63A 1I3QA 5C18A 1K83A 1AA6A 2JA5A 1UHDA 1E18A 2R93A 2R7ZA 2JIQA 1TWFA 5FTNA 1KQFA 3IR6A 2JIMA 1PT1A 1R9TA 1R27A 1H5NA 1TWAA 1Y1WA 2YUJA 1R7RA 5DYGA 5FTJA 3TM7B 4QIWA 4D7ZB 3O5AA 3GTLA 1QCSA 1Y1VA 3TIWA 2C45A 3GTGA 2WB1A 5FTKA 3H0GA 1SIWA 4KDLA 4AYBA 3GTMA 2YU9A 5C1BA 4AAYA 1EU1A 1G8KA 2NYAA 1PYQA 4GA5A 1YLEA 2VPXA 1WLFA 5DYIA 4C2MA 1Q16A 3QWZA 1FDOA 1E5VA 4KO8A 5EPPA 5T5MD 1SFOA 4KDIA 2WAQA 1VC3B 3HKZA 1H0HA 4CRYG 5B6CA 2DMRA 1E61A 4AONB 4RV0A 2JA6A 1E60A 1CZ5A 1I50A 1Y4ZA 3QQ8A 1WCMA 1TWHA 2VPZA 5FTLA 2VPWA 1CZ4A 2R92A 3HU2A 3HU1A 3GTJA 2IV2X 3GTOA 1QDNA 1S3SA 3CQZA 3GTPA 1IW7D
chains in the Genus database with same CATH superfamily
3FPRA 3LGAA 2A6ED 2ENGA 1TWGA 4KODA 3ENGA 3QQ7A 4CS0A 1CR5A 4ZM7A 1Y5IA 2PICA 1O54A 1TWCA 3QC8A 4JCWA 5T5ID 2VUMA 1G8JA 1UHEA 2V45A 4AQ7A 3IR5A 3IR7A 2E7ZA 2PJHB 1OA9A 2NVYA 3D30A 3HU3A 2JIRA 5GLXA 2PWYA 5D6YA 5CCBA 3GTKA 4CRZA 4ARIA 1PQEA 1E32A 2A69D 5H4UA 2JIPA 3CZBA 3X2NA 1TMOA 2VPYA 1PQFA 4ENGA 2E2HA 1ZC1A 2KY9A 4AZDA 2Q1CX 5D6WA 1PQHA 4UC4A 2KQAA 2GAEA 3BQBA 3X2HA 2E2IA 5FTMA 3PLXB 1DMSA 1PYUB 2MM2A 1KQGA 2NAPA 3CF2A 2AE0X 3ML1A 3GTQA 3ZJUA 3OUGA 1FDIA 2KI8A 1AW8B 3SUMA 3LHDA 4ARCA 1WC2A 2B25A 3DMRA 3FKIA 2O5JD 1PT0A 1YNND 2JIOA 5GLFA 2V3VA 3X2LA 2Y0SA 1DMRA 1OGYA 4GA6A 2PMZA 4L48A 2YVLA 2JV2A 4KLNA 4AOKB 2XDPA 2NVXA 1PPYA 4DMRA 5CD1A 2EEOB 2G6GA 2JA7A 2MM0A 2B63A 5EQJB 1YNJD 4NOHA 1I3QA 2PI8A 5C18A 3ZJTA 3SULA 2HCZX 1AA6A 1K83A 3X2OA 4JJOA 2JA5A 1UHDA 1E18A 1HD5A 3SUJA 2R93A 2R7ZA 2JIQA 1TWFA 4FIBA 5FTNA 1KQFA 3IR6A 2JIMA 1PT1A 1R9TA 1R27A 1H5NA 2QQSA 4FG4A 3X2IA 2Q19X 1TWAA 2YUJA 1Y1WA 1BW4A 1R7RA 5DYGA 5FTJA 3TM7B 4JP6A 4QIWA 3O5AA 4D7ZB 3GTLA 1QCSA 1Y1VA 3SUKA 3TIWA 2PNWA 2C45A 3X2PA 2QQRA 3GTGA 4AVRA 1L8FA 2WB1A 5FTKA 4FFTA 1BW3A 3H0GA 1SIWA 2G5DA 4KDLA 4AYBA 3GTMA 1N10A 2CW0D 1SMYD 2YU9A 3GTPA 5C1BA 5ERGB 4AAYA 5CCXA 3X2MA 1EU1A 1G8KA 2NYAA 3X2JA 4AS1A 3ZGZA 1PYQA 4FG2A 1ZYRD 4GA5A 4JS7A 1YLEA 2VPXA 1WLFA 2A6HD 5DYIA 4C2MA 4CQNA 1Q16A 3QWZA 1FDOA 1E5VA 4KO8A 2LW6A 5EPPA 5T5MD 1SFOA 5GLYA 4KDIA 3FPTA 2WAQA 1VC3B 3HKZA 1H0HA 4CRYG 2PJJA 2GF7A 5B6CA 2Q18X 3FPUA 2A68D 2Q1DX 4FERA 2DMRA 1E61A 4AONB 4RV0A 2JA6A 1E60A 1CZ5A 3X2KA 1I50A 3MB5A 1Y4ZA 3QQ8A 1WCMA 1TWHA 2VPZA 3X2GA 5FTLA 1I9GA 2VPWA 5GM9A 3M3GA 1CZ4A 2R92A 3ZJVA 3HU2A 2BH0A 3HU1A 2BE5D 5D6XA 1OA7A 3GTJA 2IV2X 3GTOA 1QDNA 2GFAA 1S3SA 3CQZA 2Q1AX 4JP7A 1IW7D
chains in the Genus database with same CATH topology
3FPRA 3LGAA 2A6ED 1TWGA 4KODA 4CS0A 3QQ7A 1CR5A 1Y5IA 2PICA 1O54A 1TWCA 3QC8A 5T5ID 2VUMA 1G8JA 1UHEA 2V45A 4AQ7A 3IR5A 3IR7A 2E7ZA 2PJHB 2NVYA 3HU3A 2JIRA 2PWYA 5D6YA 5CCBA 3GTKA 4CRZA 4ARIA 1PQEA 1E32A 2A69D 2JIPA 3CZBA 1TMOA 2VPYA 1PQFA 2KY9A 2E2HA 1ZC1A 4AZDA 2Q1CX 5D6WA 1PQHA 4UC4A 2GAEA 3BQBA 2E2IA 5FTMA 3PLXB 1DMSA 1PYUB 2MM2A 1KQGA 2NAPA 3CF2A 2AE0X 3ML1A 3GTQA 3ZJUA 3OUGA 1FDIA 2KI8A 1AW8B 3LHDA 4ARCA 2B25A 3DMRA 3FKIA 2O5JD 1PT0A 1YNND 2JIOA 5GLFA 2V3VA 2Y0SA 1DMRA 1OGYA 4GA6A 2PMZA 2YVLA 2JV2A 4KLNA 4AOKB 2XDPA 2NVXA 1PPYA 4DMRA 5CD1A 2EEOB 2G6GA 2JA7A 2MM0A 2B63A 5EQJB 1YNJD 4NOHA 1I3QA 2PI8A 5C18A 3ZJTA 1K83A 1AA6A 2JA5A 1UHDA 1E18A 2R93A 2R7ZA 2JIQA 1TWFA 4FIBA 5FTNA 1KQFA 3IR6A 2JIMA 1PT1A 1R9TA 1R27A 1H5NA 2QQSA 2Q19X 1TWAA 2YUJA 1Y1WA 1R7RA 5DYGA 5FTJA 3TM7B 4QIWA 4D7ZB 3O5AA 3GTLA 1QCSA 1Y1VA 3TIWA 2PNWA 2C45A 2QQRA 3GTGA 2WB1A 5FTKA 3H0GA 1SIWA 2G5DA 4KDLA 4AYBA 3GTMA 2CW0D 1SMYD 2YU9A 5C1BA 5ERGB 4AAYA 5CCXA 1EU1A 1G8KA 2NYAA 4AS1A 3ZGZA 1PYQA 1ZYRD 4GA5A 1YLEA 2VPXA 1WLFA 2A6HD 5DYIA 4C2MA 4CQNA 1Q16A 3QWZA 1FDOA 1E5VA 4KO8A 2LW6A 5EPPA 5T5MD 1SFOA 4KDIA 3FPTA 2WAQA 1VC3B 3HKZA 1H0HA 4CRYG 2PJJA 2GF7A 5B6CA 2Q18X 3FPUA 2A68D 2Q1DX 2DMRA 1E61A 4AONB 4RV0A 2JA6A 1E60A 1CZ5A 3MB5A 1I50A 1Y4ZA 3QQ8A 1WCMA 1TWHA 2VPZA 5FTLA 1I9GA 2VPWA 3ZJVA 1CZ4A 2R92A 3HU2A 3HU1A 2BE5D 5D6XA 3GTJA 2IV2X 3GTOA 1QDNA 2GFAA 1S3SA 3CQZA 2Q1AX 3GTPA 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG A;  4KOD A;  4CS0 A;  3QQ7 A;  1CR5 A;  1Y5I A;  1TWC A;  3QC8 A;  5T5I D;  2VUM A;  1G8J A;  1UHE A;  2V45 A;  3IR5 A;  3IR7 A;  2E7Z A;  2PJH B;  2NVY A;  3HU3 A;  2JIR A;  3GTK A;  4CRZ A;  1PQE A;  1E32 A;  2JIP A;  1TMO A;  2VPY A;  1PQF A;  2E2H A;  1ZC1 A;  4AZD A;  1PQH A;  2E2I A;  5FTM A;  3PLX B;  1DMS A;  1PYU B;  1KQG A;  2NAP A;  3CF2 A;  3GTQ A;  3ML1 A;  3OUG A;  1FDI A;  2KI8 A;  1AW8 B;  3DMR A;  3FKI A;  1PT0 A;  2JIO A;  5GLF A;  2V3V A;  2Y0S A;  1DMR A;  1OGY A;  4GA6 A;  2PMZ A;  2JV2 A;  4KLN A;  4AOK B;  2NVX A;  1PPY A;  4DMR A;  2EEO B;  2JA7 A;  2B63 A;  1I3Q A;  5C18 A;  1K83 A;  1AA6 A;  2JA5 A;  1UHD A;  1E18 A;  2R93 A;  2R7Z A;  2JIQ A;  1TWF A;  5FTN A;  1KQF A;  3IR6 A;  2JIM A;  1PT1 A;  1R9T A;  1R27 A;  1H5N A;  1TWA A;  1Y1W A;  2YUJ A;  1R7R A;  5DYG A;  5FTJ A;  3TM7 B;  4QIW A;  4D7Z B;  3O5A A;  3GTL A;  1QCS A;  1Y1V A;  3TIW A;  2C45 A;  3GTG A;  2WB1 A;  5FTK A;  3H0G A;  1SIW A;  4KDL A;  4AYB A;  3GTM A;  2YU9 A;  5C1B A;  4AAY A;  1EU1 A;  1G8K A;  2NYA A;  1PYQ A;  4GA5 A;  1YLE A;  2VPX A;  1WLF A;  5DYI A;  4C2M A;  1Q16 A;  3QWZ A;  1FDO A;  1E5V A;  4KO8 A;  5EPP A;  5T5M D;  1SFO A;  4KDI A;  2WAQ A;  1VC3 B;  3HKZ A;  1H0H A;  4CRY G;  5B6C A;  2DMR A;  1E61 A;  4AON B;  4RV0 A;  2JA6 A;  1E60 A;  1CZ5 A;  1I50 A;  1Y4Z A;  3QQ8 A;  1WCM A;  1TWH A;  2VPZ A;  5FTL A;  2VPW A;  1CZ4 A;  2R92 A;  3HU2 A;  3HU1 A;  3GTJ A;  2IV2 X;  3GTO A;  1QDN A;  1S3S A;  3CQZ A;  3GTP A;  1IW7 D; 
#chains in the Genus database with same CATH topology
 3FPR A;  3LGA A;  2A6E D;  2ENG A;  1TWG A;  4KOD A;  3ENG A;  3QQ7 A;  4CS0 A;  1CR5 A;  4ZM7 A;  1Y5I A;  2PIC A;  1O54 A;  1TWC A;  3QC8 A;  4JCW A;  5T5I D;  2VUM A;  1G8J A;  1UHE A;  2V45 A;  4AQ7 A;  3IR5 A;  3IR7 A;  2E7Z A;  2PJH B;  1OA9 A;  2NVY A;  3D30 A;  3HU3 A;  2JIR A;  5GLX A;  2PWY A;  5D6Y A;  5CCB A;  3GTK A;  4CRZ A;  4ARI A;  1PQE A;  1E32 A;  2A69 D;  5H4U A;  2JIP A;  3CZB A;  3X2N A;  1TMO A;  2VPY A;  1PQF A;  4ENG A;  2E2H A;  1ZC1 A;  2KY9 A;  4AZD A;  2Q1C X;  5D6W A;  1PQH A;  4UC4 A;  2KQA A;  2GAE A;  3BQB A;  3X2H A;  2E2I A;  5FTM A;  3PLX B;  1DMS A;  1PYU B;  2MM2 A;  1KQG A;  2NAP A;  3CF2 A;  2AE0 X;  3ML1 A;  3GTQ A;  3ZJU A;  3OUG A;  1FDI A;  2KI8 A;  1AW8 B;  3SUM A;  3LHD A;  4ARC A;  1WC2 A;  2B25 A;  3DMR A;  3FKI A;  2O5J D;  1PT0 A;  1YNN D;  2JIO A;  5GLF A;  2V3V A;  3X2L A;  2Y0S A;  1DMR A;  1OGY A;  4GA6 A;  2PMZ A;  4L48 A;  2YVL A;  2JV2 A;  4KLN A;  4AOK B;  2XDP A;  2NVX A;  1PPY A;  4DMR A;  5CD1 A;  2EEO B;  2G6G A;  2JA7 A;  2MM0 A;  2B63 A;  5EQJ B;  1YNJ D;  4NOH A;  1I3Q A;  2PI8 A;  5C18 A;  3ZJT A;  3SUL A;  2HCZ X;  1AA6 A;  1K83 A;  3X2O A;  4JJO A;  2JA5 A;  1UHD A;  1E18 A;  1HD5 A;  3SUJ A;  2R93 A;  2R7Z A;  2JIQ A;  1TWF A;  4FIB A;  5FTN A;  1KQF A;  3IR6 A;  2JIM A;  1PT1 A;  1R9T A;  1R27 A;  1H5N A;  2QQS A;  4FG4 A;  3X2I A;  2Q19 X;  1TWA A;  2YUJ A;  1Y1W A;  1BW4 A;  1R7R A;  5DYG A;  5FTJ A;  3TM7 B;  4JP6 A;  4QIW A;  3O5A A;  4D7Z B;  3GTL A;  1QCS A;  1Y1V A;  3SUK A;  3TIW A;  2PNW A;  2C45 A;  3X2P A;  2QQR A;  3GTG A;  4AVR A;  1L8F A;  2WB1 A;  5FTK A;  4FFT A;  1BW3 A;  3H0G A;  1SIW A;  2G5D A;  4KDL A;  4AYB A;  3GTM A;  1N10 A;  2CW0 D;  1SMY D;  2YU9 A;  3GTP A;  5C1B A;  5ERG B;  4AAY A;  5CCX A;  3X2M A;  1EU1 A;  1G8K A;  2NYA A;  3X2J A;  4AS1 A;  3ZGZ A;  1PYQ A;  4FG2 A;  1ZYR D;  4GA5 A;  4JS7 A;  1YLE A;  2VPX A;  1WLF A;  2A6H D;  5DYI A;  4C2M A;  4CQN A;  1Q16 A;  3QWZ A;  1FDO A;  1E5V A;  4KO8 A;  2LW6 A;  5EPP A;  5T5M D;  1SFO A;  5GLY A;  4KDI A;  3FPT A;  2WAQ A;  1VC3 B;  3HKZ A;  1H0H A;  4CRY G;  2PJJ A;  2GF7 A;  5B6C A;  2Q18 X;  3FPU A;  2A68 D;  2Q1D X;  4FER A;  2DMR A;  1E61 A;  4AON B;  4RV0 A;  2JA6 A;  1E60 A;  1CZ5 A;  3X2K A;  1I50 A;  3MB5 A;  1Y4Z A;  3QQ8 A;  1WCM A;  1TWH A;  2VPZ A;  3X2G A;  5FTL A;  1I9G A;  2VPW A;  5GM9 A;  3M3G A;  1CZ4 A;  2R92 A;  3ZJV A;  3HU2 A;  2BH0 A;  3HU1 A;  2BE5 D;  5D6X A;  1OA7 A;  3GTJ A;  2IV2 X;  3GTO A;  1QDN A;  2GFA A;  1S3S A;  3CQZ A;  2Q1A X;  4JP7 A;  1IW7 D; 
#chains in the Genus database with same CATH homology
 3FPR A;  3LGA A;  2A6E D;  1TWG A;  4KOD A;  4CS0 A;  3QQ7 A;  1CR5 A;  1Y5I A;  2PIC A;  1O54 A;  1TWC A;  3QC8 A;  5T5I D;  2VUM A;  1G8J A;  1UHE A;  2V45 A;  4AQ7 A;  3IR5 A;  3IR7 A;  2E7Z A;  2PJH B;  2NVY A;  3HU3 A;  2JIR A;  2PWY A;  5D6Y A;  5CCB A;  3GTK A;  4CRZ A;  4ARI A;  1PQE A;  1E32 A;  2A69 D;  2JIP A;  3CZB A;  1TMO A;  2VPY A;  1PQF A;  2KY9 A;  2E2H A;  1ZC1 A;  4AZD A;  2Q1C X;  5D6W A;  1PQH A;  4UC4 A;  2GAE A;  3BQB A;  2E2I A;  5FTM A;  3PLX B;  1DMS A;  1PYU B;  2MM2 A;  1KQG A;  2NAP A;  3CF2 A;  2AE0 X;  3ML1 A;  3GTQ A;  3ZJU A;  3OUG A;  1FDI A;  2KI8 A;  1AW8 B;  3LHD A;  4ARC A;  2B25 A;  3DMR A;  3FKI A;  2O5J D;  1PT0 A;  1YNN D;  2JIO A;  5GLF A;  2V3V A;  2Y0S A;  1DMR A;  1OGY A;  4GA6 A;  2PMZ A;  2YVL A;  2JV2 A;  4KLN A;  4AOK B;  2XDP A;  2NVX A;  1PPY A;  4DMR A;  5CD1 A;  2EEO B;  2G6G A;  2JA7 A;  2MM0 A;  2B63 A;  5EQJ B;  1YNJ D;  4NOH A;  1I3Q A;  2PI8 A;  5C18 A;  3ZJT A;  1K83 A;  1AA6 A;  2JA5 A;  1UHD A;  1E18 A;  2R93 A;  2R7Z A;  2JIQ A;  1TWF A;  4FIB A;  5FTN A;  1KQF A;  3IR6 A;  2JIM A;  1PT1 A;  1R9T A;  1R27 A;  1H5N A;  2QQS A;  2Q19 X;  1TWA A;  2YUJ A;  1Y1W A;  1R7R A;  5DYG A;  5FTJ A;  3TM7 B;  4QIW A;  4D7Z B;  3O5A A;  3GTL A;  1QCS A;  1Y1V A;  3TIW A;  2PNW A;  2C45 A;  2QQR A;  3GTG A;  2WB1 A;  5FTK A;  3H0G A;  1SIW A;  2G5D A;  4KDL A;  4AYB A;  3GTM A;  2CW0 D;  1SMY D;  2YU9 A;  5C1B A;  5ERG B;  4AAY A;  5CCX A;  1EU1 A;  1G8K A;  2NYA A;  4AS1 A;  3ZGZ A;  1PYQ A;  1ZYR D;  4GA5 A;  1YLE A;  2VPX A;  1WLF A;  2A6H D;  5DYI A;  4C2M A;  4CQN A;  1Q16 A;  3QWZ A;  1FDO A;  1E5V A;  4KO8 A;  2LW6 A;  5EPP A;  5T5M D;  1SFO A;  4KDI A;  3FPT A;  2WAQ A;  1VC3 B;  3HKZ A;  1H0H A;  4CRY G;  2PJJ A;  2GF7 A;  5B6C A;  2Q18 X;  3FPU A;  2A68 D;  2Q1D X;  2DMR A;  1E61 A;  4AON B;  4RV0 A;  2JA6 A;  1E60 A;  1CZ5 A;  3MB5 A;  1I50 A;  1Y4Z A;  3QQ8 A;  1WCM A;  1TWH A;  2VPZ A;  5FTL A;  1I9G A;  2VPW A;  3ZJV A;  1CZ4 A;  2R92 A;  3HU2 A;  3HU1 A;  2BE5 D;  5D6X A;  3GTJ A;  2IV2 X;  3GTO A;  1QDN A;  2GFA A;  1S3S A;  3CQZ A;  2Q1A X;  3GTP A;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...