3QQ7A

Crystal structure of the p97 n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
b'KNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Hierarchical Binding of Cofactors to the AAA ATPase p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 168
sequence length 168
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qq7A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qq7A02
4CRZA 2KI8A 3GTPA 1I3QA 1TWHA 3IR5A 4AOKB 4CS0A 5DYGA 1IW7D 1S3SA 1Q16A 2V3VA 1PYUB 3HKZA 1TWAA 3PLXB 1YLEA 1SFOA 1G8JA 3GTJA 1UHEA 5GLFA 4KDIA 1G8KA 1TWFA 3TM7B 2JV2A 2VPWA 2WB1A 3HU3A 2JIQA 2NYAA 2NVXA 1PQFA 3HU1A 1E18A 1QCSA 1DMRA 3O5AA 3OUGA 4AAYA 3GTLA 1UHDA 5B6CA 1TMOA 1Y1WA 1H5NA 1WLFA 2Y0SA 4AYBA 3TIWA 3DMRA 1CZ5A 5FTKA 5DYIA 1E60A 2VPYA 4DMRA 1PYQA 2EEOB 4C2MA 3GTGA 2JIOA 1R7RA 4CRYG 3GTQA 1Y4ZA 1TWGA 2JA6A 3HU2A 2V45A 5FTLA 2B63A 5FTMA 5FTJA 1CR5A 1FDIA 4QIWA 2JA5A 2E2HA 4AZDA 1OGYA 1AA6A 1WCMA 1KQFA 3QWZA 1VC3B 1R27A 2R92A 3GTOA 2JIRA 3CQZA 1QDNA 5EPPA 4RV0A 4GA5A 1EU1A 1Y1VA 1PQEA 1SIWA 2E7ZA 1R9TA 2DMRA 4KO8A 3ML1A 1K83A 2PJHB 5T5MD 2YUJA 2R93A 2JIMA 3GTKA 2NAPA 5C1BA 1DMSA 1E5VA 3QQ8A 5C18A 2VUMA 1FDOA 2IV2X 2PMZA 1I50A 4KODA 1H0HA 1ZC1A 2YU9A 1PPYA 1TWCA 3FKIA 1Y5IA 4D7ZB 2VPXA 1E61A 2VPZA 4KLNA 2E2IA 2JA7A 2C45A 3CF2A 1KQGA 1CZ4A 5T5ID 4KDLA 3QQ7A 3H0GA 1PT1A 3QC8A 2WAQA 3IR6A 2JIPA 1PQHA 1E32A 4AONB 1PT0A 4GA6A 3GTMA 2NVYA 3IR7A 1AW8B 2R7ZA 5FTNA
chains in the Genus database with same CATH superfamily
1HD5A 4CRZA 2KI8A 3GTPA 1I3QA 1TWHA 2O5JD 3IR5A 4AOKB 2A69D 5DYGA 1IW7D 4CS0A 2QQRA 5H4UA 1L8FA 1S3SA 2B25A 1Q16A 2A6HD 1PYUB 2V3VA 3HKZA 1TWAA 4JP7A 4FFTA 3PLXB 1YLEA 2GFAA 1SFOA 1G8JA 3GTJA 2Q1DX 3X2JA 1UHEA 5GLFA 2QQSA 4KDIA 1G8KA 1TWFA 3TM7B 2JV2A 2VPWA 3BQBA 2WB1A 3HU3A 2JIQA 2NYAA 2NVXA 1PQFA 3HU1A 2GF7A 3X2NA 1E18A 2BH0A 1QCSA 5CCXA 1DMRA 4L48A 3O5AA 3OUGA 4AAYA 2ENGA 3GTLA 2Q1AX 1YNND 1UHDA 5B6CA 1TMOA 1Y1WA 2CW0D 2PI8A 1O54A 1BW3A 3ZGZA 1H5NA 1WLFA 2Y0SA 4AYBA 3TIWA 4UC4A 2GAEA 3DMRA 2Q19X 1CZ5A 2PWYA 5D6XA 2AE0X 5FTKA 5DYIA 1E60A 2VPYA 4DMRA 2KQAA 4ENGA 1PYQA 3ENGA 1N10A 2EEOB 4C2MA 3GTGA 2JIOA 3D30A 2Q1CX 4AS1A 1BW4A 1R7RA 4CRYG 2Q18X 3GTQA 1Y4ZA 1TWGA 2JA6A 3ZJTA 5D6WA 1WC2A 3HU2A 2V45A 5FTLA 2B63A 5FTMA 5GLYA 5EQJB 5FTJA 1CR5A 1FDIA 4JP6A 4QIWA 3X2KA 2JA5A 2MM0A 2E2HA 2YVLA 3SUKA 2G5DA 4AZDA 1OGYA 4JCWA 4ZM7A 1AA6A 2PJJA 2LW6A 1WCMA 4FERA 1KQFA 3QWZA 1VC3B 1R27A 5D6YA 2R92A 3GTOA 2JIRA 3CQZA 1QDNA 4NOHA 5EPPA 4RV0A 4GA5A 1EU1A 4ARIA 5GLXA 1Y1VA 3FPRA 1PQEA 1OA7A 1SIWA 1YNJD 2E7ZA 1R9TA 2DMRA 4KO8A 1I9GA 3ML1A 3X2LA 1K83A 3SULA 3LGAA 2PJHB 5T5MD 2YUJA 1ZYRD 2R93A 3SUMA 5CCBA 3MB5A 4FG2A 3X2OA 2HCZX 4AVRA 3X2HA 2JIMA 3ZJUA 3GTKA 2NAPA 3ZJVA 5C1BA 1OA9A 4JJOA 2XDPA 1DMSA 1E5VA 3QQ8A 5C18A 2VUMA 4AQ7A 1FDOA 2IV2X 3M3GA 2PMZA 1I50A 4KODA 1H0HA 4FG4A 1ZC1A 2BE5D 3CZBA 1PPYA 1TWCA 3FKIA 1Y5IA 4D7ZB 2VPXA 1E61A 2YU9A 2VPZA 4KLNA 2E2IA 2MM2A 2JA7A 3X2MA 2C45A 3CF2A 3FPUA 4ARCA 2PICA 1CZ4A 5T5ID 1SMYD 4KDLA 3QQ7A 3X2PA 1KQGA 3H0GA 1PT1A 3QC8A 3X2GA 2G6GA 5ERGB 2WAQA 3IR6A 2JIPA 2PNWA 1PQHA 2A68D 2A6ED 1E32A 2KY9A 4AONB 1PT0A 4GA6A 4JS7A 5GM9A 3GTMA 3X2IA 3LHDA 4FIBA 3SUJA 2NVYA 3IR7A 1AW8B 2R7ZA 5FTNA 5CD1A 3FPTA 4CQNA
chains in the Genus database with same CATH topology
4CRZA 2KI8A 3GTPA 1I3QA 1TWHA 2O5JD 3IR5A 4AOKB 2A69D 5DYGA 1IW7D 4CS0A 2QQRA 1S3SA 2B25A 1Q16A 2A6HD 1PYUB 2V3VA 3HKZA 1TWAA 3PLXB 1YLEA 2GFAA 1SFOA 1G8JA 3GTJA 2Q1DX 1UHEA 5GLFA 2QQSA 4KDIA 1G8KA 1TWFA 3TM7B 2JV2A 2VPWA 3BQBA 2WB1A 3HU3A 2JIQA 2NYAA 2NVXA 1PQFA 3HU1A 2GF7A 1E18A 1QCSA 5CCXA 1DMRA 3O5AA 3OUGA 4AAYA 3GTLA 2Q1AX 1YNND 1UHDA 5B6CA 1TMOA 1Y1WA 2CW0D 2PI8A 1O54A 3ZGZA 1H5NA 1WLFA 2Y0SA 4AYBA 3TIWA 4UC4A 2GAEA 3DMRA 2Q19X 1CZ5A 2PWYA 5D6XA 2AE0X 5FTKA 5DYIA 1E60A 2VPYA 4DMRA 1PYQA 2EEOB 4C2MA 3GTGA 2JIOA 2Q1CX 4AS1A 1R7RA 4CRYG 2Q18X 3GTQA 1Y4ZA 1TWGA 2JA6A 3ZJTA 5D6WA 3HU2A 2V45A 5FTLA 2B63A 5FTMA 5EQJB 5FTJA 1CR5A 1FDIA 4QIWA 2JA5A 2MM0A 2YVLA 2E2HA 2G5DA 4AZDA 1OGYA 1AA6A 2PJJA 2LW6A 1WCMA 1KQFA 5D6YA 3QWZA 1VC3B 1R27A 2R92A 3GTOA 2JIRA 3CQZA 1QDNA 4NOHA 5EPPA 4RV0A 4GA5A 1EU1A 4ARIA 1Y1VA 3FPRA 1PQEA 1SIWA 1YNJD 2E7ZA 1R9TA 2DMRA 4KO8A 1I9GA 3ML1A 1K83A 3LGAA 2PJHB 5T5MD 2YUJA 1ZYRD 2R93A 5CCBA 3MB5A 2JIMA 3ZJUA 3GTKA 2NAPA 3ZJVA 5C1BA 2XDPA 1DMSA 1E5VA 3QQ8A 5C18A 2VUMA 4AQ7A 1FDOA 2IV2X 2PMZA 1I50A 4KODA 1H0HA 1ZC1A 2BE5D 3CZBA 1PPYA 1TWCA 3FKIA 1Y5IA 4D7ZB 2VPXA 1E61A 2YU9A 2VPZA 4KLNA 2E2IA 2MM2A 2JA7A 2C45A 3CF2A 3FPUA 4ARCA 2PICA 1CZ4A 5T5ID 1SMYD 4KDLA 3QQ7A 1KQGA 3H0GA 1PT1A 3QC8A 2G6GA 5ERGB 2WAQA 3IR6A 2JIPA 2PNWA 1PQHA 2A68D 2A6ED 1E32A 2KY9A 4AONB 1PT0A 4GA6A 3LHDA 3GTMA 4FIBA 2NVYA 3IR7A 1AW8B 2R7ZA 5FTNA 5CD1A 3FPTA 4CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRZ A;  2KI8 A;  3GTP A;  1I3Q A;  1TWH A;  3IR5 A;  4AOK B;  4CS0 A;  5DYG A;  1IW7 D;  1S3S A;  1Q16 A;  2V3V A;  1PYU B;  3HKZ A;  1TWA A;  3PLX B;  1YLE A;  1SFO A;  1G8J A;  3GTJ A;  1UHE A;  5GLF A;  4KDI A;  1G8K A;  1TWF A;  3TM7 B;  2JV2 A;  2VPW A;  2WB1 A;  3HU3 A;  2JIQ A;  2NYA A;  2NVX A;  1PQF A;  3HU1 A;  1E18 A;  1QCS A;  1DMR A;  3O5A A;  3OUG A;  4AAY A;  3GTL A;  1UHD A;  5B6C A;  1TMO A;  1Y1W A;  1H5N A;  1WLF A;  2Y0S A;  4AYB A;  3TIW A;  3DMR A;  1CZ5 A;  5FTK A;  5DYI A;  1E60 A;  2VPY A;  4DMR A;  1PYQ A;  2EEO B;  4C2M A;  3GTG A;  2JIO A;  1R7R A;  4CRY G;  3GTQ A;  1Y4Z A;  1TWG A;  2JA6 A;  3HU2 A;  2V45 A;  5FTL A;  2B63 A;  5FTM A;  5FTJ A;  1CR5 A;  1FDI A;  4QIW A;  2JA5 A;  2E2H A;  4AZD A;  1OGY A;  1AA6 A;  1WCM A;  1KQF A;  3QWZ A;  1VC3 B;  1R27 A;  2R92 A;  3GTO A;  2JIR A;  3CQZ A;  1QDN A;  5EPP A;  4RV0 A;  4GA5 A;  1EU1 A;  1Y1V A;  1PQE A;  1SIW A;  2E7Z A;  1R9T A;  2DMR A;  4KO8 A;  3ML1 A;  1K83 A;  2PJH B;  5T5M D;  2YUJ A;  2R93 A;  2JIM A;  3GTK A;  2NAP A;  5C1B A;  1DMS A;  1E5V A;  3QQ8 A;  5C18 A;  2VUM A;  1FDO A;  2IV2 X;  2PMZ A;  1I50 A;  4KOD A;  1H0H A;  1ZC1 A;  2YU9 A;  1PPY A;  1TWC A;  3FKI A;  1Y5I A;  4D7Z B;  2VPX A;  1E61 A;  2VPZ A;  4KLN A;  2E2I A;  2JA7 A;  2C45 A;  3CF2 A;  1KQG A;  1CZ4 A;  5T5I D;  4KDL A;  3QQ7 A;  3H0G A;  1PT1 A;  3QC8 A;  2WAQ A;  3IR6 A;  2JIP A;  1PQH A;  1E32 A;  4AON B;  1PT0 A;  4GA6 A;  3GTM A;  2NVY A;  3IR7 A;  1AW8 B;  2R7Z A;  5FTN A; 
#chains in the Genus database with same CATH topology
 1HD5 A;  4CRZ A;  2KI8 A;  3GTP A;  1I3Q A;  1TWH A;  2O5J D;  3IR5 A;  4AOK B;  2A69 D;  5DYG A;  1IW7 D;  4CS0 A;  2QQR A;  5H4U A;  1L8F A;  1S3S A;  2B25 A;  1Q16 A;  2A6H D;  1PYU B;  2V3V A;  3HKZ A;  1TWA A;  4JP7 A;  4FFT A;  3PLX B;  1YLE A;  2GFA A;  1SFO A;  1G8J A;  3GTJ A;  2Q1D X;  3X2J A;  1UHE A;  5GLF A;  2QQS A;  4KDI A;  1G8K A;  1TWF A;  3TM7 B;  2JV2 A;  2VPW A;  3BQB A;  2WB1 A;  3HU3 A;  2JIQ A;  2NYA A;  2NVX A;  1PQF A;  3HU1 A;  2GF7 A;  3X2N A;  1E18 A;  2BH0 A;  1QCS A;  5CCX A;  1DMR A;  4L48 A;  3O5A A;  3OUG A;  4AAY A;  2ENG A;  3GTL A;  2Q1A X;  1YNN D;  1UHD A;  5B6C A;  1TMO A;  1Y1W A;  2CW0 D;  2PI8 A;  1O54 A;  1BW3 A;  3ZGZ A;  1H5N A;  1WLF A;  2Y0S A;  4AYB A;  3TIW A;  4UC4 A;  2GAE A;  3DMR A;  2Q19 X;  1CZ5 A;  2PWY A;  5D6X A;  2AE0 X;  5FTK A;  5DYI A;  1E60 A;  2VPY A;  4DMR A;  2KQA A;  4ENG A;  1PYQ A;  3ENG A;  1N10 A;  2EEO B;  4C2M A;  3GTG A;  2JIO A;  3D30 A;  2Q1C X;  4AS1 A;  1BW4 A;  1R7R A;  4CRY G;  2Q18 X;  3GTQ A;  1Y4Z A;  1TWG A;  2JA6 A;  3ZJT A;  5D6W A;  1WC2 A;  3HU2 A;  2V45 A;  5FTL A;  2B63 A;  5FTM A;  5GLY A;  5EQJ B;  5FTJ A;  1CR5 A;  1FDI A;  4JP6 A;  4QIW A;  3X2K A;  2JA5 A;  2MM0 A;  2E2H A;  2YVL A;  3SUK A;  2G5D A;  4AZD A;  1OGY A;  4JCW A;  4ZM7 A;  1AA6 A;  2PJJ A;  2LW6 A;  1WCM A;  4FER A;  1KQF A;  3QWZ A;  1VC3 B;  1R27 A;  5D6Y A;  2R92 A;  3GTO A;  2JIR A;  3CQZ A;  1QDN A;  4NOH A;  5EPP A;  4RV0 A;  4GA5 A;  1EU1 A;  4ARI A;  5GLX A;  1Y1V A;  3FPR A;  1PQE A;  1OA7 A;  1SIW A;  1YNJ D;  2E7Z A;  1R9T A;  2DMR A;  4KO8 A;  1I9G A;  3ML1 A;  3X2L A;  1K83 A;  3SUL A;  3LGA A;  2PJH B;  5T5M D;  2YUJ A;  1ZYR D;  2R93 A;  3SUM A;  5CCB A;  3MB5 A;  4FG2 A;  3X2O A;  2HCZ X;  4AVR A;  3X2H A;  2JIM A;  3ZJU A;  3GTK A;  2NAP A;  3ZJV A;  5C1B A;  1OA9 A;  4JJO A;  2XDP A;  1DMS A;  1E5V A;  3QQ8 A;  5C18 A;  2VUM A;  4AQ7 A;  1FDO A;  2IV2 X;  3M3G A;  2PMZ A;  1I50 A;  4KOD A;  1H0H A;  4FG4 A;  1ZC1 A;  2BE5 D;  3CZB A;  1PPY A;  1TWC A;  3FKI A;  1Y5I A;  4D7Z B;  2VPX A;  1E61 A;  2YU9 A;  2VPZ A;  4KLN A;  2E2I A;  2MM2 A;  2JA7 A;  3X2M A;  2C45 A;  3CF2 A;  3FPU A;  4ARC A;  2PIC A;  1CZ4 A;  5T5I D;  1SMY D;  4KDL A;  3QQ7 A;  3X2P A;  1KQG A;  3H0G A;  1PT1 A;  3QC8 A;  3X2G A;  2G6G A;  5ERG B;  2WAQ A;  3IR6 A;  2JIP A;  2PNW A;  1PQH A;  2A68 D;  2A6E D;  1E32 A;  2KY9 A;  4AON B;  1PT0 A;  4GA6 A;  4JS7 A;  5GM9 A;  3GTM A;  3X2I A;  3LHD A;  4FIB A;  3SUJ A;  2NVY A;  3IR7 A;  1AW8 B;  2R7Z A;  5FTN A;  5CD1 A;  3FPT A;  4CQN A; 
#chains in the Genus database with same CATH homology
 4CRZ A;  2KI8 A;  3GTP A;  1I3Q A;  1TWH A;  2O5J D;  3IR5 A;  4AOK B;  2A69 D;  5DYG A;  1IW7 D;  4CS0 A;  2QQR A;  1S3S A;  2B25 A;  1Q16 A;  2A6H D;  1PYU B;  2V3V A;  3HKZ A;  1TWA A;  3PLX B;  1YLE A;  2GFA A;  1SFO A;  1G8J A;  3GTJ A;  2Q1D X;  1UHE A;  5GLF A;  2QQS A;  4KDI A;  1G8K A;  1TWF A;  3TM7 B;  2JV2 A;  2VPW A;  3BQB A;  2WB1 A;  3HU3 A;  2JIQ A;  2NYA A;  2NVX A;  1PQF A;  3HU1 A;  2GF7 A;  1E18 A;  1QCS A;  5CCX A;  1DMR A;  3O5A A;  3OUG A;  4AAY A;  3GTL A;  2Q1A X;  1YNN D;  1UHD A;  5B6C A;  1TMO A;  1Y1W A;  2CW0 D;  2PI8 A;  1O54 A;  3ZGZ A;  1H5N A;  1WLF A;  2Y0S A;  4AYB A;  3TIW A;  4UC4 A;  2GAE A;  3DMR A;  2Q19 X;  1CZ5 A;  2PWY A;  5D6X A;  2AE0 X;  5FTK A;  5DYI A;  1E60 A;  2VPY A;  4DMR A;  1PYQ A;  2EEO B;  4C2M A;  3GTG A;  2JIO A;  2Q1C X;  4AS1 A;  1R7R A;  4CRY G;  2Q18 X;  3GTQ A;  1Y4Z A;  1TWG A;  2JA6 A;  3ZJT A;  5D6W A;  3HU2 A;  2V45 A;  5FTL A;  2B63 A;  5FTM A;  5EQJ B;  5FTJ A;  1CR5 A;  1FDI A;  4QIW A;  2JA5 A;  2MM0 A;  2YVL A;  2E2H A;  2G5D A;  4AZD A;  1OGY A;  1AA6 A;  2PJJ A;  2LW6 A;  1WCM A;  1KQF A;  5D6Y A;  3QWZ A;  1VC3 B;  1R27 A;  2R92 A;  3GTO A;  2JIR A;  3CQZ A;  1QDN A;  4NOH A;  5EPP A;  4RV0 A;  4GA5 A;  1EU1 A;  4ARI A;  1Y1V A;  3FPR A;  1PQE A;  1SIW A;  1YNJ D;  2E7Z A;  1R9T A;  2DMR A;  4KO8 A;  1I9G A;  3ML1 A;  1K83 A;  3LGA A;  2PJH B;  5T5M D;  2YUJ A;  1ZYR D;  2R93 A;  5CCB A;  3MB5 A;  2JIM A;  3ZJU A;  3GTK A;  2NAP A;  3ZJV A;  5C1B A;  2XDP A;  1DMS A;  1E5V A;  3QQ8 A;  5C18 A;  2VUM A;  4AQ7 A;  1FDO A;  2IV2 X;  2PMZ A;  1I50 A;  4KOD A;  1H0H A;  1ZC1 A;  2BE5 D;  3CZB A;  1PPY A;  1TWC A;  3FKI A;  1Y5I A;  4D7Z B;  2VPX A;  1E61 A;  2YU9 A;  2VPZ A;  4KLN A;  2E2I A;  2MM2 A;  2JA7 A;  2C45 A;  3CF2 A;  3FPU A;  4ARC A;  2PIC A;  1CZ4 A;  5T5I D;  1SMY D;  4KDL A;  3QQ7 A;  1KQG A;  3H0G A;  1PT1 A;  3QC8 A;  2G6G A;  5ERG B;  2WAQ A;  3IR6 A;  2JIP A;  2PNW A;  1PQH A;  2A68 D;  2A6E D;  1E32 A;  2KY9 A;  4AON B;  1PT0 A;  4GA6 A;  3LHD A;  3GTM A;  4FIB A;  2NVY A;  3IR7 A;  1AW8 B;  2R7Z A;  5FTN A;  5CD1 A;  3FPT A;  4CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...