3QQ7A

Crystal structure of the p97 n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
KNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hierarchical Binding of Cofactors to the AAA ATPase p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 46
structure length 168
sequence length 168
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qq7A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qq7A02
2R7ZA 1R9TA 2JIOA 4KDIA 4KODA 2VPWA 2B63A 2NAPA 3H0GA 2JA5A 1CZ4A 1PT0A 2WB1A 3ML1A 2NVXA 3IR5A 1TWHA 1PYUB 1DMRA 2VPXA 3GTQA 1YLEA 2VPZA 3HU3A 1WCMA 1SIWA 2E7ZA 1DMSA 5C1BA 3HKZA 4CRYG 2JV2A 4KLNA 3DMRA 3QQ7A 3GTJA 2EEOB 2WAQA 4C2MA 1Y1VA 3PLXB 1KQGA 2PMZA 2V3VA 4AONB 1G8KA 1E18A 2E2HA 2NYAA 3IR7A 1FDIA 1UHEA 4AYBA 1PPYA 3GTOA 1I3QA 1H5NA 1SFOA 3GTMA 1R27A 1E60A 3GTLA 1FDOA 1AW8B 3TM7B 3GTGA 4CRZA 1ZC1A 1PYQA 1Q16A 2Y0SA 2C45A 3GTPA 1TWCA 2VUMA 1PT1A 1TMOA 2E2IA 3QQ8A 3TIWA 4GA5A 5T5ID 1E61A 1K83A 3FKIA 1S3SA 1VC3B 1Y1WA 2DMRA 5EPPA 3QWZA 1EU1A 1KQFA 2JIMA 2V45A 3HU1A 2JA6A 5FTNA 2YUJA 1QCSA 3IR6A 3OUGA 1E32A 5DYGA 1PQEA 5FTJA 4KDLA 2IV2X 4D7ZB 1E5VA 5FTKA 1AA6A 1UHDA 4AOKB 1I50A 1CR5A 2PJHB 3QC8A 5C18A 2VPYA 2KI8A 2R93A 1R7RA 4CS0A 1Y5IA 1H0HA 5T5MD 1QDNA 1PQFA 4AZDA 3GTKA 3HU2A 5DYIA 4RV0A 1TWFA 3O5AA 5FTLA 4KO8A 1TWAA 1WLFA 3CF2A 1PQHA 2R92A 4AAYA 5GLFA 2JIQA 1Y4ZA 3CQZA 5B6CA 2JA7A 1IW7D 1TWGA 1OGYA 2JIRA 2JIPA 2NVYA 4QIWA 2YU9A 1CZ5A 1G8JA 5FTMA 4DMRA 4GA6A
chains in the Genus database with same CATH superfamily
2R7ZA 4FIBA 1R9TA 1BW3A 2JIOA 2GFAA 5ERGB 4KDIA 2LW6A 2Q1AX 4KODA 2VPWA 2B63A 2NAPA 2Q19X 3H0GA 2JA5A 1CZ4A 4ARCA 2G6GA 4ZM7A 1PT0A 5CD1A 1WC2A 2WB1A 3ML1A 3ENGA 3IR5A 1TWHA 2NVXA 2KY9A 1PYUB 4AS1A 4L48A 1DMRA 2MM2A 3ZJTA 4NOHA 2VPXA 3FPRA 3GTQA 1YLEA 2VPZA 3HU3A 1WCMA 1SIWA 2E7ZA 4ARIA 4FG2A 1DMSA 5C1BA 3MB5A 3HKZA 3LGAA 2HCZX 3X2GA 4CRYG 2JV2A 4KLNA 3DMRA 1L8FA 3QQ7A 2A6HD 3X2IA 3GTJA 5D6XA 2AE0X 2A69D 3FPTA 2EEOB 2WAQA 2PWYA 1I9GA 2CW0D 4C2MA 1Y1VA 3PLXB 2MM0A 1KQGA 2PNWA 1YNJD 2PMZA 2V3VA 5H4UA 4AONB 1G8KA 1O54A 2ENGA 1E18A 2E2HA 2NYAA 3IR7A 1FDIA 1UHEA 1BW4A 4AYBA 3CZBA 1PPYA 3GTOA 3X2OA 2G5DA 1I3QA 4JP7A 4FERA 1H5NA 2PICA 1SFOA 3GTMA 3ZGZA 1R27A 1E60A 3GTLA 4JP6A 1FDOA 5D6WA 1AW8B 3TM7B 3GTGA 4CRZA 1ZC1A 1PYQA 1Q16A 2Y0SA 3D30A 2C45A 3GTPA 1TWCA 3X2KA 2VUMA 1PT1A 5EQJB 1TMOA 2E2IA 3QQ8A 3TIWA 4GA5A 2PI8A 3M3GA 2QQRA 5T5ID 1E61A 1K83A 3FKIA 1OA9A 1S3SA 3ZJUA 2PJJA 2Q1CX 1VC3B 1Y1WA 2DMRA 4JJOA 3QWZA 5EPPA 1EU1A 1KQFA 2Q1DX 2JIMA 2YVLA 5CCBA 3X2NA 2A6ED 2V45A 4JS7A 2XDPA 4FFTA 3HU1A 2A68D 2JA6A 5FTNA 2YUJA 1QCSA 3IR6A 3OUGA 1E32A 5DYGA 1PQEA 5FTJA 4KDLA 2IV2X 3X2MA 3ZJVA 4D7ZB 1E5VA 4UC4A 5FTKA 1AA6A 2KQAA 1UHDA 4AOKB 5GLXA 1I50A 1CR5A 2PJHB 3QC8A 5C18A 2Q18X 5CCXA 2VPYA 2KI8A 5GM9A 3SUMA 2R93A 4CQNA 1R7RA 4CS0A 2BE5D 1Y5IA 1H0HA 5T5MD 1QDNA 1PQFA 4AZDA 3GTKA 3FPUA 3HU2A 5DYIA 4RV0A 1TWFA 3O5AA 4FG4A 3LHDA 1ZYRD 2O5JD 5FTLA 4KO8A 5GLYA 1TWAA 1WLFA 3CF2A 1PQHA 2R92A 2QQSA 4AVRA 1HD5A 4AAYA 1YNND 5GLFA 3X2LA 2JIQA 2B25A 1Y4ZA 4AQ7A 3CQZA 1SMYD 2GAEA 3SULA 5B6CA 1N10A 2JA7A 1IW7D 1TWGA 3SUJA 1OGYA 2JIRA 3X2HA 2GF7A 4ENGA 2BH0A 2JIPA 2NVYA 4QIWA 3X2PA 3BQBA 2YU9A 1OA7A 3SUKA 1G8JA 3X2JA 1CZ5A 4JCWA 5FTMA 4DMRA 5D6YA 4GA6A
chains in the Genus database with same CATH topology
2R7ZA 1R9TA 2JIOA 2GFAA 5ERGB 4KDIA 2LW6A 2Q1AX 4KODA 2VPWA 2B63A 2NAPA 2Q19X 3H0GA 2JA5A 1CZ4A 4ARCA 2G6GA 1PT0A 5CD1A 2WB1A 3ML1A 2NVXA 3IR5A 1TWHA 2KY9A 1PYUB 4AS1A 1DMRA 2MM2A 3ZJTA 4NOHA 2VPXA 3FPRA 3GTQA 1YLEA 2VPZA 3HU3A 1WCMA 1SIWA 2E7ZA 4ARIA 1DMSA 5C1BA 3MB5A 3HKZA 3LGAA 4CRYG 2JV2A 4KLNA 3DMRA 3QQ7A 2A6HD 3GTJA 5D6XA 2AE0X 2A69D 3FPTA 2EEOB 2WAQA 2PWYA 1I9GA 2CW0D 4C2MA 1Y1VA 3PLXB 2MM0A 1KQGA 2PNWA 1YNJD 2PMZA 2V3VA 4AONB 1O54A 1G8KA 3ZJUA 1E18A 2E2HA 2NYAA 3IR7A 1FDIA 1UHEA 4AYBA 3CZBA 1PPYA 3GTOA 2G5DA 1I3QA 1H5NA 2PICA 1SFOA 3GTMA 3ZGZA 1R27A 1E60A 3GTLA 1FDOA 5D6WA 1AW8B 3TM7B 3GTGA 4CRZA 1ZC1A 1PYQA 1Q16A 2Y0SA 2C45A 3GTPA 1TWCA 2VUMA 5EQJB 1PT1A 1TMOA 2E2IA 3QQ8A 3TIWA 4GA5A 2PI8A 2QQRA 5T5ID 1E61A 1K83A 3FKIA 1S3SA 2PJJA 2Q1CX 1VC3B 1Y1WA 2DMRA 5EPPA 3QWZA 1EU1A 1KQFA 2Q1DX 2JIMA 2YVLA 5CCBA 2A6ED 2V45A 2XDPA 3HU1A 2A68D 2JA6A 5FTNA 2YUJA 1QCSA 3IR6A 3OUGA 1E32A 5DYGA 1PQEA 5FTJA 4KDLA 2IV2X 3ZJVA 4D7ZB 1E5VA 4UC4A 5FTKA 1AA6A 1UHDA 4AOKB 1I50A 1CR5A 2PJHB 3QC8A 5C18A 2Q18X 5CCXA 2VPYA 2KI8A 2R93A 4CQNA 1R7RA 4CS0A 2BE5D 1Y5IA 1H0HA 5T5MD 1QDNA 1PQFA 4AZDA 3GTKA 3FPUA 3HU2A 5DYIA 4RV0A 1TWFA 3O5AA 3LHDA 1ZYRD 2O5JD 5FTLA 4KO8A 1TWAA 1WLFA 3CF2A 1PQHA 2R92A 2QQSA 4AAYA 1YNND 5GLFA 2JIQA 2B25A 1Y4ZA 4AQ7A 3CQZA 1SMYD 2GAEA 5B6CA 2JA7A 1IW7D 1TWGA 1OGYA 2JIRA 2GF7A 2JIPA 2NVYA 4QIWA 3BQBA 4FIBA 2YU9A 1CZ5A 1G8JA 5D6YA 5FTMA 4DMRA 4GA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z A;  1R9T A;  2JIO A;  4KDI A;  4KOD A;  2VPW A;  2B63 A;  2NAP A;  3H0G A;  2JA5 A;  1CZ4 A;  1PT0 A;  2WB1 A;  3ML1 A;  2NVX A;  3IR5 A;  1TWH A;  1PYU B;  1DMR A;  2VPX A;  3GTQ A;  1YLE A;  2VPZ A;  3HU3 A;  1WCM A;  1SIW A;  2E7Z A;  1DMS A;  5C1B A;  3HKZ A;  4CRY G;  2JV2 A;  4KLN A;  3DMR A;  3QQ7 A;  3GTJ A;  2EEO B;  2WAQ A;  4C2M A;  1Y1V A;  3PLX B;  1KQG A;  2PMZ A;  2V3V A;  4AON B;  1G8K A;  1E18 A;  2E2H A;  2NYA A;  3IR7 A;  1FDI A;  1UHE A;  4AYB A;  1PPY A;  3GTO A;  1I3Q A;  1H5N A;  1SFO A;  3GTM A;  1R27 A;  1E60 A;  3GTL A;  1FDO A;  1AW8 B;  3TM7 B;  3GTG A;  4CRZ A;  1ZC1 A;  1PYQ A;  1Q16 A;  2Y0S A;  2C45 A;  3GTP A;  1TWC A;  2VUM A;  1PT1 A;  1TMO A;  2E2I A;  3QQ8 A;  3TIW A;  4GA5 A;  5T5I D;  1E61 A;  1K83 A;  3FKI A;  1S3S A;  1VC3 B;  1Y1W A;  2DMR A;  5EPP A;  3QWZ A;  1EU1 A;  1KQF A;  2JIM A;  2V45 A;  3HU1 A;  2JA6 A;  5FTN A;  2YUJ A;  1QCS A;  3IR6 A;  3OUG A;  1E32 A;  5DYG A;  1PQE A;  5FTJ A;  4KDL A;  2IV2 X;  4D7Z B;  1E5V A;  5FTK A;  1AA6 A;  1UHD A;  4AOK B;  1I50 A;  1CR5 A;  2PJH B;  3QC8 A;  5C18 A;  2VPY A;  2KI8 A;  2R93 A;  1R7R A;  4CS0 A;  1Y5I A;  1H0H A;  5T5M D;  1QDN A;  1PQF A;  4AZD A;  3GTK A;  3HU2 A;  5DYI A;  4RV0 A;  1TWF A;  3O5A A;  5FTL A;  4KO8 A;  1TWA A;  1WLF A;  3CF2 A;  1PQH A;  2R92 A;  4AAY A;  5GLF A;  2JIQ A;  1Y4Z A;  3CQZ A;  5B6C A;  2JA7 A;  1IW7 D;  1TWG A;  1OGY A;  2JIR A;  2JIP A;  2NVY A;  4QIW A;  2YU9 A;  1CZ5 A;  1G8J A;  5FTM A;  4DMR A;  4GA6 A; 
#chains in the Genus database with same CATH topology
 2R7Z A;  4FIB A;  1R9T A;  1BW3 A;  2JIO A;  2GFA A;  5ERG B;  4KDI A;  2LW6 A;  2Q1A X;  4KOD A;  2VPW A;  2B63 A;  2NAP A;  2Q19 X;  3H0G A;  2JA5 A;  1CZ4 A;  4ARC A;  2G6G A;  4ZM7 A;  1PT0 A;  5CD1 A;  1WC2 A;  2WB1 A;  3ML1 A;  3ENG A;  3IR5 A;  1TWH A;  2NVX A;  2KY9 A;  1PYU B;  4AS1 A;  4L48 A;  1DMR A;  2MM2 A;  3ZJT A;  4NOH A;  2VPX A;  3FPR A;  3GTQ A;  1YLE A;  2VPZ A;  3HU3 A;  1WCM A;  1SIW A;  2E7Z A;  4ARI A;  4FG2 A;  1DMS A;  5C1B A;  3MB5 A;  3HKZ A;  3LGA A;  2HCZ X;  3X2G A;  4CRY G;  2JV2 A;  4KLN A;  3DMR A;  1L8F A;  3QQ7 A;  2A6H D;  3X2I A;  3GTJ A;  5D6X A;  2AE0 X;  2A69 D;  3FPT A;  2EEO B;  2WAQ A;  2PWY A;  1I9G A;  2CW0 D;  4C2M A;  1Y1V A;  3PLX B;  2MM0 A;  1KQG A;  2PNW A;  1YNJ D;  2PMZ A;  2V3V A;  5H4U A;  4AON B;  1G8K A;  1O54 A;  2ENG A;  1E18 A;  2E2H A;  2NYA A;  3IR7 A;  1FDI A;  1UHE A;  1BW4 A;  4AYB A;  3CZB A;  1PPY A;  3GTO A;  3X2O A;  2G5D A;  1I3Q A;  4JP7 A;  4FER A;  1H5N A;  2PIC A;  1SFO A;  3GTM A;  3ZGZ A;  1R27 A;  1E60 A;  3GTL A;  4JP6 A;  1FDO A;  5D6W A;  1AW8 B;  3TM7 B;  3GTG A;  4CRZ A;  1ZC1 A;  1PYQ A;  1Q16 A;  2Y0S A;  3D30 A;  2C45 A;  3GTP A;  1TWC A;  3X2K A;  2VUM A;  1PT1 A;  5EQJ B;  1TMO A;  2E2I A;  3QQ8 A;  3TIW A;  4GA5 A;  2PI8 A;  3M3G A;  2QQR A;  5T5I D;  1E61 A;  1K83 A;  3FKI A;  1OA9 A;  1S3S A;  3ZJU A;  2PJJ A;  2Q1C X;  1VC3 B;  1Y1W A;  2DMR A;  4JJO A;  3QWZ A;  5EPP A;  1EU1 A;  1KQF A;  2Q1D X;  2JIM A;  2YVL A;  5CCB A;  3X2N A;  2A6E D;  2V45 A;  4JS7 A;  2XDP A;  4FFT A;  3HU1 A;  2A68 D;  2JA6 A;  5FTN A;  2YUJ A;  1QCS A;  3IR6 A;  3OUG A;  1E32 A;  5DYG A;  1PQE A;  5FTJ A;  4KDL A;  2IV2 X;  3X2M A;  3ZJV A;  4D7Z B;  1E5V A;  4UC4 A;  5FTK A;  1AA6 A;  2KQA A;  1UHD A;  4AOK B;  5GLX A;  1I50 A;  1CR5 A;  2PJH B;  3QC8 A;  5C18 A;  2Q18 X;  5CCX A;  2VPY A;  2KI8 A;  5GM9 A;  3SUM A;  2R93 A;  4CQN A;  1R7R A;  4CS0 A;  2BE5 D;  1Y5I A;  1H0H A;  5T5M D;  1QDN A;  1PQF A;  4AZD A;  3GTK A;  3FPU A;  3HU2 A;  5DYI A;  4RV0 A;  1TWF A;  3O5A A;  4FG4 A;  3LHD A;  1ZYR D;  2O5J D;  5FTL A;  4KO8 A;  5GLY A;  1TWA A;  1WLF A;  3CF2 A;  1PQH A;  2R92 A;  2QQS A;  4AVR A;  1HD5 A;  4AAY A;  1YNN D;  5GLF A;  3X2L A;  2JIQ A;  2B25 A;  1Y4Z A;  4AQ7 A;  3CQZ A;  1SMY D;  2GAE A;  3SUL A;  5B6C A;  1N10 A;  2JA7 A;  1IW7 D;  1TWG A;  3SUJ A;  1OGY A;  2JIR A;  3X2H A;  2GF7 A;  4ENG A;  2BH0 A;  2JIP A;  2NVY A;  4QIW A;  3X2P A;  3BQB A;  2YU9 A;  1OA7 A;  3SUK A;  1G8J A;  3X2J A;  1CZ5 A;  4JCW A;  5FTM A;  4DMR A;  5D6Y A;  4GA6 A; 
#chains in the Genus database with same CATH homology
 2R7Z A;  1R9T A;  2JIO A;  2GFA A;  5ERG B;  4KDI A;  2LW6 A;  2Q1A X;  4KOD A;  2VPW A;  2B63 A;  2NAP A;  2Q19 X;  3H0G A;  2JA5 A;  1CZ4 A;  4ARC A;  2G6G A;  1PT0 A;  5CD1 A;  2WB1 A;  3ML1 A;  2NVX A;  3IR5 A;  1TWH A;  2KY9 A;  1PYU B;  4AS1 A;  1DMR A;  2MM2 A;  3ZJT A;  4NOH A;  2VPX A;  3FPR A;  3GTQ A;  1YLE A;  2VPZ A;  3HU3 A;  1WCM A;  1SIW A;  2E7Z A;  4ARI A;  1DMS A;  5C1B A;  3MB5 A;  3HKZ A;  3LGA A;  4CRY G;  2JV2 A;  4KLN A;  3DMR A;  3QQ7 A;  2A6H D;  3GTJ A;  5D6X A;  2AE0 X;  2A69 D;  3FPT A;  2EEO B;  2WAQ A;  2PWY A;  1I9G A;  2CW0 D;  4C2M A;  1Y1V A;  3PLX B;  2MM0 A;  1KQG A;  2PNW A;  1YNJ D;  2PMZ A;  2V3V A;  4AON B;  1O54 A;  1G8K A;  3ZJU A;  1E18 A;  2E2H A;  2NYA A;  3IR7 A;  1FDI A;  1UHE A;  4AYB A;  3CZB A;  1PPY A;  3GTO A;  2G5D A;  1I3Q A;  1H5N A;  2PIC A;  1SFO A;  3GTM A;  3ZGZ A;  1R27 A;  1E60 A;  3GTL A;  1FDO A;  5D6W A;  1AW8 B;  3TM7 B;  3GTG A;  4CRZ A;  1ZC1 A;  1PYQ A;  1Q16 A;  2Y0S A;  2C45 A;  3GTP A;  1TWC A;  2VUM A;  5EQJ B;  1PT1 A;  1TMO A;  2E2I A;  3QQ8 A;  3TIW A;  4GA5 A;  2PI8 A;  2QQR A;  5T5I D;  1E61 A;  1K83 A;  3FKI A;  1S3S A;  2PJJ A;  2Q1C X;  1VC3 B;  1Y1W A;  2DMR A;  5EPP A;  3QWZ A;  1EU1 A;  1KQF A;  2Q1D X;  2JIM A;  2YVL A;  5CCB A;  2A6E D;  2V45 A;  2XDP A;  3HU1 A;  2A68 D;  2JA6 A;  5FTN A;  2YUJ A;  1QCS A;  3IR6 A;  3OUG A;  1E32 A;  5DYG A;  1PQE A;  5FTJ A;  4KDL A;  2IV2 X;  3ZJV A;  4D7Z B;  1E5V A;  4UC4 A;  5FTK A;  1AA6 A;  1UHD A;  4AOK B;  1I50 A;  1CR5 A;  2PJH B;  3QC8 A;  5C18 A;  2Q18 X;  5CCX A;  2VPY A;  2KI8 A;  2R93 A;  4CQN A;  1R7R A;  4CS0 A;  2BE5 D;  1Y5I A;  1H0H A;  5T5M D;  1QDN A;  1PQF A;  4AZD A;  3GTK A;  3FPU A;  3HU2 A;  5DYI A;  4RV0 A;  1TWF A;  3O5A A;  3LHD A;  1ZYR D;  2O5J D;  5FTL A;  4KO8 A;  1TWA A;  1WLF A;  3CF2 A;  1PQH A;  2R92 A;  2QQS A;  4AAY A;  1YNN D;  5GLF A;  2JIQ A;  2B25 A;  1Y4Z A;  4AQ7 A;  3CQZ A;  1SMY D;  2GAE A;  5B6C A;  2JA7 A;  1IW7 D;  1TWG A;  1OGY A;  2JIR A;  2GF7 A;  2JIP A;  2NVY A;  4QIW A;  3BQB A;  4FIB A;  2YU9 A;  1CZ5 A;  1G8J A;  5D6Y A;  5FTM A;  4DMR A;  4GA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...