3QQ7A

Crystal structure of the p97 n-terminal domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
KNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Hierarchical Binding of Cofactors to the AAA ATPase p97.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 168
sequence length 168
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qq7A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qq7A02
3HU1A 1I50A 2EEOB 1TWGA 1TWCA 1R27A 3GTPA 5FTMA 5EPPA 2Y0SA 1PYQA 2PMZA 1Y4ZA 1R9TA 5B6CA 5C1BA 1DMSA 2V3VA 4KLNA 5DYIA 4RV0A 4D7ZB 3OUGA 3GTMA 2R93A 2VPZA 2JA7A 1Q16A 2WAQA 1SFOA 5T5ID 4AOKB 3IR6A 4CS0A 3GTGA 1S3SA 4GA6A 3HKZA 2DMRA 2JIQA 1FDOA 2JIOA 1E32A 2E2IA 3QWZA 2B63A 1CZ4A 1G8JA 3CF2A 1H0HA 4CRYG 3GTLA 1OGYA 2VUMA 4CRZA 3IR5A 2VPXA 5FTNA 5C18A 1KQGA 2NAPA 3H0GA 3QC8A 5DYGA 1CR5A 1PQFA 4QIWA 1EU1A 4DMRA 2YU9A 1WLFA 3PLXB 1Y1VA 3CQZA 3TM7B 2R7ZA 1SIWA 4KO8A 1QCSA 2PJHB 4GA5A 2VPYA 2NVXA 3GTOA 1KQFA 1PT0A 5FTLA 3GTJA 2WB1A 5T5MD 4AYBA 2JA6A 1H5NA 2KI8A 1E18A 3TIWA 3QQ8A 4KODA 3HU3A 1UHDA 5GLFA 1Y5IA 1IW7D 1E61A 3FKIA 1AA6A 1DMRA 1UHEA 3GTQA 2C45A 3HU2A 1PPYA 3IR7A 2JA5A 2E2HA 2YUJA 5FTJA 1TWHA 3DMRA 1ZC1A 1TWFA 1K83A 1QDNA 1TMOA 1VC3B 3O5AA 4KDIA 1G8KA 2V45A 1I3QA 4AAYA 1E5VA 2JV2A 1PQHA 1AW8B 3QQ7A 1PQEA 4KDLA 1CZ5A 2JIPA 2NYAA 4AONB 5FTKA 2NVYA 4C2MA 1R7RA 4AZDA 3ML1A 2JIMA 2VPWA 2IV2X 2R92A 1PYUB 1FDIA 1TWAA 2E7ZA 2JIRA 3GTKA 1E60A 1YLEA 1Y1WA 1PT1A 1WCMA
chains in the Genus database with same CATH superfamily
3HU1A 2PNWA 3FPUA 3CZBA 5D6WA 1I50A 5D6YA 2EEOB 1TWGA 1TWCA 2A69D 1R27A 3GTPA 5FTMA 5EPPA 2Y0SA 1PYQA 2HCZX 5GLXA 4AS1A 2PMZA 3X2JA 1Y4ZA 1R9TA 4UC4A 4FG4A 5B6CA 5C1BA 1DMSA 2V3VA 2BE5D 3ENGA 3M3GA 4KLNA 5DYIA 3SUJA 4RV0A 2Q1CX 4D7ZB 3OUGA 4AVRA 3GTMA 2R93A 2VPZA 3BQBA 2O5JD 2JA7A 1Q16A 2Q19X 2WAQA 1SFOA 5T5ID 4AOKB 5ERGB 3IR6A 4CS0A 3GTGA 5GLYA 1S3SA 4GA6A 2GF7A 3HKZA 3X2PA 3X2KA 2DMRA 2JIQA 2ENGA 1FDOA 2JIOA 1E32A 2E2IA 1BW4A 3QWZA 3X2HA 2B25A 2B63A 1CZ4A 1G8JA 3CF2A 1H0HA 4CRYG 4JP6A 3GTLA 1OGYA 2VUMA 3SULA 2JV2A 4CRZA 2G6GA 3IR5A 2VPXA 2MM2A 5FTNA 5C18A 1KQGA 3MB5A 3X2NA 2NAPA 3H0GA 3QC8A 5DYGA 1CR5A 1PQFA 4QIWA 1EU1A 4DMRA 3D30A 2YU9A 1ZYRD 2PICA 4ARCA 1WLFA 3PLXB 1Y1VA 3CQZA 3TM7B 2R7ZA 4L48A 1SIWA 1HD5A 4KO8A 1O54A 2Q1AX 2QQSA 4AQ7A 1WC2A 1QCSA 2PJHB 4GA5A 2VPYA 2NVXA 3GTOA 1KQFA 1PT0A 5FTLA 3GTJA 5GM9A 2GFAA 1I9GA 2WB1A 5T5MD 4AYBA 4ARIA 2JA6A 1H5NA 2PI8A 2KI8A 4FFTA 1SMYD 4ZM7A 1E18A 4NOHA 3TIWA 3QQ8A 2XDPA 4KODA 3HU3A 4FG2A 1UHDA 3ZGZA 4JP7A 1OA7A 1Y5IA 5GLFA 3X2GA 2KY9A 3FPTA 4JS7A 1YNND 2MM0A 2QQRA 1IW7D 1E61A 3FKIA 1AA6A 4FIBA 1DMRA 3ZJVA 2Q1DX 1UHEA 2CW0D 3X2LA 3GTQA 4ENGA 4JCWA 2C45A 3X2MA 3HU2A 1PPYA 3IR7A 2JA5A 2A6ED 2PWYA 3X2OA 2A68D 2YUJA 2E2HA 3FPRA 2KQAA 1N10A 5EQJB 5FTJA 1BW3A 1TWHA 5CCBA 3DMRA 1ZC1A 2A6HD 1TWFA 4FERA 1K83A 5CD1A 1QDNA 1TMOA 1VC3B 2Q18X 3O5AA 4KDIA 1G8KA 2V45A 3LGAA 2AE0X 2PJJA 1I3QA 4AAYA 1E5VA 2GAEA 1PQHA 2BH0A 1AW8B 3QQ7A 1PQEA 4JJOA 4KDLA 3SUMA 2JIPA 2NYAA 1OA9A 1YNJD 4AONB 1CZ5A 3LHDA 5FTKA 3ZJUA 2NVYA 4C2MA 3ZJTA 1R7RA 4AZDA 5D6XA 3ML1A 2JIMA 2VPWA 2IV2X 2R92A 1PYUB 1FDIA 1TWAA 2E7ZA 2JIRA 3GTKA 1E60A 3SUKA 1L8FA 1YLEA 1Y1WA 2LW6A 2YVLA 5CCXA 4CQNA 1PT1A 2G5DA 3X2IA 5H4UA 1WCMA
chains in the Genus database with same CATH topology
3HU1A 2PNWA 3FPUA 3CZBA 5D6WA 1I50A 5D6YA 2EEOB 1TWGA 1TWCA 2A69D 1R27A 3GTPA 5FTMA 5EPPA 2Y0SA 1PYQA 4AS1A 2PMZA 1Y4ZA 1R9TA 4UC4A 5B6CA 5C1BA 1DMSA 2V3VA 2BE5D 4KLNA 5DYIA 4RV0A 2Q1CX 4D7ZB 3OUGA 3GTMA 2R93A 2VPZA 3BQBA 2O5JD 2JA7A 1Q16A 2Q19X 2WAQA 1SFOA 5T5ID 4AOKB 5ERGB 3IR6A 4CS0A 3GTGA 1S3SA 4GA6A 2GF7A 3HKZA 2DMRA 2JIQA 1FDOA 2JIOA 1E32A 2E2IA 3QWZA 2B25A 2B63A 1CZ4A 1G8JA 3CF2A 1H0HA 4CRYG 3GTLA 1OGYA 2VUMA 4CRZA 2G6GA 3IR5A 2VPXA 2MM2A 5FTNA 5C18A 1KQGA 3MB5A 2NAPA 3H0GA 3QC8A 5DYGA 1CR5A 1PQFA 4QIWA 1EU1A 4DMRA 2YU9A 4FIBA 1ZYRD 2PICA 4ARCA 1WLFA 3PLXB 1Y1VA 3CQZA 3TM7B 2R7ZA 1SIWA 4KO8A 1O54A 2Q1AX 2QQSA 4AQ7A 1QCSA 2PJHB 4GA5A 2VPYA 2NVXA 3GTOA 1KQFA 1PT0A 5FTLA 3GTJA 2GFAA 1I9GA 2WB1A 5T5MD 4AYBA 4ARIA 2JA6A 1H5NA 2PI8A 2KI8A 1SMYD 1E18A 4NOHA 3TIWA 3QQ8A 2XDPA 4KODA 3HU3A 1UHDA 3ZGZA 5GLFA 1Y5IA 2KY9A 3FPTA 1YNND 2MM0A 2QQRA 1IW7D 1E61A 3FKIA 1AA6A 1DMRA 3ZJVA 2Q1DX 1UHEA 2CW0D 3GTQA 2C45A 3HU2A 1PPYA 3IR7A 2JA5A 2A6ED 2PWYA 2A68D 2YUJA 2E2HA 3FPRA 5EQJB 5FTJA 1TWHA 5CCBA 3DMRA 1ZC1A 2A6HD 1TWFA 1K83A 5CD1A 1QDNA 1TMOA 1VC3B 2Q18X 3O5AA 4KDIA 1G8KA 2V45A 3LGAA 2AE0X 2PJJA 1I3QA 4AAYA 1E5VA 2GAEA 1PQHA 2JV2A 1AW8B 3QQ7A 1PQEA 4KDLA 1CZ5A 2JIPA 2NYAA 4AONB 1YNJD 3LHDA 5FTKA 3ZJUA 2NVYA 4C2MA 3ZJTA 1R7RA 4AZDA 5D6XA 3ML1A 2JIMA 2VPWA 2IV2X 2R92A 1PYUB 1FDIA 1TWAA 2E7ZA 2JIRA 3GTKA 1E60A 5CCXA 1YLEA 1Y1WA 2LW6A 2YVLA 4CQNA 1PT1A 2G5DA 1WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HU1 A;  1I50 A;  2EEO B;  1TWG A;  1TWC A;  1R27 A;  3GTP A;  5FTM A;  5EPP A;  2Y0S A;  1PYQ A;  2PMZ A;  1Y4Z A;  1R9T A;  5B6C A;  5C1B A;  1DMS A;  2V3V A;  4KLN A;  5DYI A;  4RV0 A;  4D7Z B;  3OUG A;  3GTM A;  2R93 A;  2VPZ A;  2JA7 A;  1Q16 A;  2WAQ A;  1SFO A;  5T5I D;  4AOK B;  3IR6 A;  4CS0 A;  3GTG A;  1S3S A;  4GA6 A;  3HKZ A;  2DMR A;  2JIQ A;  1FDO A;  2JIO A;  1E32 A;  2E2I A;  3QWZ A;  2B63 A;  1CZ4 A;  1G8J A;  3CF2 A;  1H0H A;  4CRY G;  3GTL A;  1OGY A;  2VUM A;  4CRZ A;  3IR5 A;  2VPX A;  5FTN A;  5C18 A;  1KQG A;  2NAP A;  3H0G A;  3QC8 A;  5DYG A;  1CR5 A;  1PQF A;  4QIW A;  1EU1 A;  4DMR A;  2YU9 A;  1WLF A;  3PLX B;  1Y1V A;  3CQZ A;  3TM7 B;  2R7Z A;  1SIW A;  4KO8 A;  1QCS A;  2PJH B;  4GA5 A;  2VPY A;  2NVX A;  3GTO A;  1KQF A;  1PT0 A;  5FTL A;  3GTJ A;  2WB1 A;  5T5M D;  4AYB A;  2JA6 A;  1H5N A;  2KI8 A;  1E18 A;  3TIW A;  3QQ8 A;  4KOD A;  3HU3 A;  1UHD A;  5GLF A;  1Y5I A;  1IW7 D;  1E61 A;  3FKI A;  1AA6 A;  1DMR A;  1UHE A;  3GTQ A;  2C45 A;  3HU2 A;  1PPY A;  3IR7 A;  2JA5 A;  2E2H A;  2YUJ A;  5FTJ A;  1TWH A;  3DMR A;  1ZC1 A;  1TWF A;  1K83 A;  1QDN A;  1TMO A;  1VC3 B;  3O5A A;  4KDI A;  1G8K A;  2V45 A;  1I3Q A;  4AAY A;  1E5V A;  2JV2 A;  1PQH A;  1AW8 B;  3QQ7 A;  1PQE A;  4KDL A;  1CZ5 A;  2JIP A;  2NYA A;  4AON B;  5FTK A;  2NVY A;  4C2M A;  1R7R A;  4AZD A;  3ML1 A;  2JIM A;  2VPW A;  2IV2 X;  2R92 A;  1PYU B;  1FDI A;  1TWA A;  2E7Z A;  2JIR A;  3GTK A;  1E60 A;  1YLE A;  1Y1W A;  1PT1 A;  1WCM A; 
#chains in the Genus database with same CATH topology
 3HU1 A;  2PNW A;  3FPU A;  3CZB A;  5D6W A;  1I50 A;  5D6Y A;  2EEO B;  1TWG A;  1TWC A;  2A69 D;  1R27 A;  3GTP A;  5FTM A;  5EPP A;  2Y0S A;  1PYQ A;  2HCZ X;  5GLX A;  4AS1 A;  2PMZ A;  3X2J A;  1Y4Z A;  1R9T A;  4UC4 A;  4FG4 A;  5B6C A;  5C1B A;  1DMS A;  2V3V A;  2BE5 D;  3ENG A;  3M3G A;  4KLN A;  5DYI A;  3SUJ A;  4RV0 A;  2Q1C X;  4D7Z B;  3OUG A;  4AVR A;  3GTM A;  2R93 A;  2VPZ A;  3BQB A;  2O5J D;  2JA7 A;  1Q16 A;  2Q19 X;  2WAQ A;  1SFO A;  5T5I D;  4AOK B;  5ERG B;  3IR6 A;  4CS0 A;  3GTG A;  5GLY A;  1S3S A;  4GA6 A;  2GF7 A;  3HKZ A;  3X2P A;  3X2K A;  2DMR A;  2JIQ A;  2ENG A;  1FDO A;  2JIO A;  1E32 A;  2E2I A;  1BW4 A;  3QWZ A;  3X2H A;  2B25 A;  2B63 A;  1CZ4 A;  1G8J A;  3CF2 A;  1H0H A;  4CRY G;  4JP6 A;  3GTL A;  1OGY A;  2VUM A;  3SUL A;  2JV2 A;  4CRZ A;  2G6G A;  3IR5 A;  2VPX A;  2MM2 A;  5FTN A;  5C18 A;  1KQG A;  3MB5 A;  3X2N A;  2NAP A;  3H0G A;  3QC8 A;  5DYG A;  1CR5 A;  1PQF A;  4QIW A;  1EU1 A;  4DMR A;  3D30 A;  2YU9 A;  1ZYR D;  2PIC A;  4ARC A;  1WLF A;  3PLX B;  1Y1V A;  3CQZ A;  3TM7 B;  2R7Z A;  4L48 A;  1SIW A;  1HD5 A;  4KO8 A;  1O54 A;  2Q1A X;  2QQS A;  4AQ7 A;  1WC2 A;  1QCS A;  2PJH B;  4GA5 A;  2VPY A;  2NVX A;  3GTO A;  1KQF A;  1PT0 A;  5FTL A;  3GTJ A;  5GM9 A;  2GFA A;  1I9G A;  2WB1 A;  5T5M D;  4AYB A;  4ARI A;  2JA6 A;  1H5N A;  2PI8 A;  2KI8 A;  4FFT A;  1SMY D;  4ZM7 A;  1E18 A;  4NOH A;  3TIW A;  3QQ8 A;  2XDP A;  4KOD A;  3HU3 A;  4FG2 A;  1UHD A;  3ZGZ A;  4JP7 A;  1OA7 A;  1Y5I A;  5GLF A;  3X2G A;  2KY9 A;  3FPT A;  4JS7 A;  1YNN D;  2MM0 A;  2QQR A;  1IW7 D;  1E61 A;  3FKI A;  1AA6 A;  4FIB A;  1DMR A;  3ZJV A;  2Q1D X;  1UHE A;  2CW0 D;  3X2L A;  3GTQ A;  4ENG A;  4JCW A;  2C45 A;  3X2M A;  3HU2 A;  1PPY A;  3IR7 A;  2JA5 A;  2A6E D;  2PWY A;  3X2O A;  2A68 D;  2YUJ A;  2E2H A;  3FPR A;  2KQA A;  1N10 A;  5EQJ B;  5FTJ A;  1BW3 A;  1TWH A;  5CCB A;  3DMR A;  1ZC1 A;  2A6H D;  1TWF A;  4FER A;  1K83 A;  5CD1 A;  1QDN A;  1TMO A;  1VC3 B;  2Q18 X;  3O5A A;  4KDI A;  1G8K A;  2V45 A;  3LGA A;  2AE0 X;  2PJJ A;  1I3Q A;  4AAY A;  1E5V A;  2GAE A;  1PQH A;  2BH0 A;  1AW8 B;  3QQ7 A;  1PQE A;  4JJO A;  4KDL A;  3SUM A;  2JIP A;  2NYA A;  1OA9 A;  1YNJ D;  4AON B;  1CZ5 A;  3LHD A;  5FTK A;  3ZJU A;  2NVY A;  4C2M A;  3ZJT A;  1R7R A;  4AZD A;  5D6X A;  3ML1 A;  2JIM A;  2VPW A;  2IV2 X;  2R92 A;  1PYU B;  1FDI A;  1TWA A;  2E7Z A;  2JIR A;  3GTK A;  1E60 A;  3SUK A;  1L8F A;  1YLE A;  1Y1W A;  2LW6 A;  2YVL A;  5CCX A;  4CQN A;  1PT1 A;  2G5D A;  3X2I A;  5H4U A;  1WCM A; 
#chains in the Genus database with same CATH homology
 3HU1 A;  2PNW A;  3FPU A;  3CZB A;  5D6W A;  1I50 A;  5D6Y A;  2EEO B;  1TWG A;  1TWC A;  2A69 D;  1R27 A;  3GTP A;  5FTM A;  5EPP A;  2Y0S A;  1PYQ A;  4AS1 A;  2PMZ A;  1Y4Z A;  1R9T A;  4UC4 A;  5B6C A;  5C1B A;  1DMS A;  2V3V A;  2BE5 D;  4KLN A;  5DYI A;  4RV0 A;  2Q1C X;  4D7Z B;  3OUG A;  3GTM A;  2R93 A;  2VPZ A;  3BQB A;  2O5J D;  2JA7 A;  1Q16 A;  2Q19 X;  2WAQ A;  1SFO A;  5T5I D;  4AOK B;  5ERG B;  3IR6 A;  4CS0 A;  3GTG A;  1S3S A;  4GA6 A;  2GF7 A;  3HKZ A;  2DMR A;  2JIQ A;  1FDO A;  2JIO A;  1E32 A;  2E2I A;  3QWZ A;  2B25 A;  2B63 A;  1CZ4 A;  1G8J A;  3CF2 A;  1H0H A;  4CRY G;  3GTL A;  1OGY A;  2VUM A;  4CRZ A;  2G6G A;  3IR5 A;  2VPX A;  2MM2 A;  5FTN A;  5C18 A;  1KQG A;  3MB5 A;  2NAP A;  3H0G A;  3QC8 A;  5DYG A;  1CR5 A;  1PQF A;  4QIW A;  1EU1 A;  4DMR A;  2YU9 A;  4FIB A;  1ZYR D;  2PIC A;  4ARC A;  1WLF A;  3PLX B;  1Y1V A;  3CQZ A;  3TM7 B;  2R7Z A;  1SIW A;  4KO8 A;  1O54 A;  2Q1A X;  2QQS A;  4AQ7 A;  1QCS A;  2PJH B;  4GA5 A;  2VPY A;  2NVX A;  3GTO A;  1KQF A;  1PT0 A;  5FTL A;  3GTJ A;  2GFA A;  1I9G A;  2WB1 A;  5T5M D;  4AYB A;  4ARI A;  2JA6 A;  1H5N A;  2PI8 A;  2KI8 A;  1SMY D;  1E18 A;  4NOH A;  3TIW A;  3QQ8 A;  2XDP A;  4KOD A;  3HU3 A;  1UHD A;  3ZGZ A;  5GLF A;  1Y5I A;  2KY9 A;  3FPT A;  1YNN D;  2MM0 A;  2QQR A;  1IW7 D;  1E61 A;  3FKI A;  1AA6 A;  1DMR A;  3ZJV A;  2Q1D X;  1UHE A;  2CW0 D;  3GTQ A;  2C45 A;  3HU2 A;  1PPY A;  3IR7 A;  2JA5 A;  2A6E D;  2PWY A;  2A68 D;  2YUJ A;  2E2H A;  3FPR A;  5EQJ B;  5FTJ A;  1TWH A;  5CCB A;  3DMR A;  1ZC1 A;  2A6H D;  1TWF A;  1K83 A;  5CD1 A;  1QDN A;  1TMO A;  1VC3 B;  2Q18 X;  3O5A A;  4KDI A;  1G8K A;  2V45 A;  3LGA A;  2AE0 X;  2PJJ A;  1I3Q A;  4AAY A;  1E5V A;  2GAE A;  1PQH A;  2JV2 A;  1AW8 B;  3QQ7 A;  1PQE A;  4KDL A;  1CZ5 A;  2JIP A;  2NYA A;  4AON B;  1YNJ D;  3LHD A;  5FTK A;  3ZJU A;  2NVY A;  4C2M A;  3ZJT A;  1R7R A;  4AZD A;  5D6X A;  3ML1 A;  2JIM A;  2VPW A;  2IV2 X;  2R92 A;  1PYU B;  1FDI A;  1TWA A;  2E7Z A;  2JIR A;  3GTK A;  1E60 A;  5CCX A;  1YLE A;  1Y1W A;  2LW6 A;  2YVL A;  4CQN A;  1PT1 A;  2G5D A;  1WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...