1O54A

Crystal structure of sam-dependent o-methyltransferase (tm0748) from thermotoga maritima at 1.65 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
266
structure length
265
Chain Sequence
HHHVGKVADTLKPGDRVLLSFEDESEFLVDLEKDKKLHTHLGIIDLNEVFEKGPGEIIRTSAGKKGYILIPSLIDEIMNMKRTQIVYPKDSSFIAMMLDVKEGDRIIDTGVGSGAMCAVLARAVGSSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEGFDEKDVDALFLDVPDPWNYIDKCWEALKGGGRFATVCPTTNQVQETLKKLQELPFIRIEVWESLFRPYKPVPERLRPVDRMVAHTAYMIFATKVCRREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SAM-dependent O-methyltransferase
publication title Crystal structure of SAM-dependent O-methyltransferase (TM0748) from Thermotoga maritima at 1.65 A resolution
rcsb
source organism Thermotoga maritima
total genus 79
structure length 265
sequence length 266
ec nomenclature ec 2.1.1.-:
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1o54A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1o54A02
5EZSA 5F2OA 2EJUA 3FPGA 5KQRA 4PYQA 2PJDA 1QANA 4EMSA 2FHPA 3LSTA 3P9NA 1D2GA 5CVEA 3P9IA 4P58A 4GOOD 3V97A 4QPNA 4AZWA 3B89A 3R3HA 2XYRA 2AOUA 5GIPE 1SKMA 4QPPA 1NW6A 2P3LA 5HEKA 2AVDA 2CL5A 2JHPA 2YXEA 2CKDA 2PX4A 3DXYA 3LCCA 5E1OA 3EMDA 2IBTA 5EHIA 3P2KA 2O06A 2YVLA 5ICEA 1NV8A 1UIRA 4PIPA 5DX8A 1JSXA 1IY9A 2P7HA 1P1BA 5LQNA 4IV0A 2C7RA 3HNRA 4GBED 5DSTA 4HG2A 3TLJA 3EVCA 1O54A 4RVDA 4DA4A 4HGZA 3GDHA 4X60A 1JG1A 2NXEA 4MHTA 3LKZA 3UJ8A 4YUWA 3B3FA 3BUSA 1SVUA 5E2AA 4LWPA 1X1AA 3NVMB 5DTMA 4AX8A 5HZMA 3SX0A 4OQDA 3U81A 2Z6QA 2P35A 3CJRA 5B1SA 3TRKA 3UJ7A 4O29A 5EOVA 2PX8A 4A6EA 2CMHA 3M33A 1N7IA 3MCZA 5K0CA 5EQJB 3FPHA 5CM2Z 4BLWA 2AOTB 2IBSA 3UJAA 1HNNA 1RJEA 3CGGA 2HR1A 4E2ZA 4M36A 5K09A 4HGYA 4JXJA 4DKJA 3ELDA 3GRRA 2AOVA 2I62A 3GJYA 3NDJA 3HCFA 2NNWB 2ZBQA 5U4XA 4FT4A 1M6EX 1XTPA 5GM1A 5GOZA 5G02A 5JR3A 2VS1A 2PY6A 1JQEA 5HIMA 5ICFA 3BKXA 3LDFA 3UJCA 3FTCA 4FP9A 1XXLA 2NXCA 3TOSA 4LECA 1VPTA 2QYOA 3DUWA 4FSDA 3OFJA 2PX2A 2ONYA 4RVGA 1RI1A 3NWEA 5LSAA 3GGDA 3KKZA 4RTKA 2UYQA 5CVJA 2Y1WA 3EVDA 4Y30A 3UJ6A 3FPFA 4R05A 4GOLD 4DZRA 3JWGA 4R8SA 5GIOE 5HOQA 1O9GA 3HCEA 9MHTA 4ER7A 4CKBA 3Q7EA 5IKMA 2OXTA 1WXWA 1JTEA 3FTFA 4OBXA 1O9HA 3KQYA 3MCTA 4IWNA 3DULA 5E9WA 4RTNA 4RVFA 1NKVA 3EVAA 3IHTA 1AQIA 4KIFA 2UYCA 1YZHA 2AOWA 10MHA 1ZGJA 4M7RA 4QTTB 3A27A 5DSXA 2G8NA 2O07A 2PGXA 5D1NA 5E1DA 3O7WA 3LDGA 3EEOA 1SG9A 2O57A 1G8AA 1SQGA 3G8BA 4DCMA 1P91A 2AN3A 4C4AA 3P2EA 4F86A 5BXYA 5M5BA 1NV9A 2IDKA 3BWCA 2HTEA 5K0EA 2PWYA 3HA3A 1EQAA 4FS8A 1FP2A 1R18A 3MQ2A 4B17A 5DPMA 3M4XA 3OZTA 3LBFA 1G6Q1 2ONZA 3A4TA 4R6WA 5DLYA 5GP1A 3UWPA 3PX2A 3DOUA 4YUXA 1PRYA 4YV2A 2EX4A 2OPBA 4PWYA 2GH1A 3VC2A 2YXLA 1JQDA 1DL5A 2ADMA 1KXZA 4U7PB 3NWBA 4Z2YA 2AS0A 2B2CA 1SUIA 1QZZA 2C7PA 2P8JA 2YXDA 5E1BA 4OX9Y 1NBIA 5DM1A 2YR0A 3LHDA 3ANXA 3GXOA 4RTPA 2P7IA 4RTOA 2XYQA 4CXMA 5KYGA 1IM8A 4XCXA 1L9KA 3NW9A 4RV9A 3TQSA 1YFJA 3GIWA 3REOA 1X1BA 4DM3A 5KS2A 5GINE 2AVNA 1N2XA 4U7TB 3TKYA 4WVLA 2OB2A 3CJQA 4V0QA 5T67A 2VP3A 1R8YA 4KDCA 4PYOA 1R8XA 5GWXA 1G38A 3R0QA 3LDUA 1EAMA 2B3TA 1X1CA 2NP6A 4YMHA 4FGZA 4FSXA 8MHTA 2G70A 2ZSUA 3TM5A 1Q0TA 4X41A 1T43A 1TW2A 3MHTA 3ORHA 1BC5A 1RJDA 4BY9E 2XBMA 4PCAA 5BP7A 5CVVA 1YF3A 2NP7A 3KPJA 4X61A 5DXJA 3G2PA 4ATNA 1PJZA 5BW4A 1I4WA 1QAOA 3AJDA 3I9FA 2AN5A 3GU3A 5E8JA 3B3GA 4YV1A 3EVBA 1XCLA 3EVGA 1NT2A 1M6YA 1Q0SA 4M37A 3KHKA 2PWPA 4WXHA 1WXXA 4HH4A 2P40A 1NW8A 1KP9A 3P9KA 4PYNA 3CKKA 3HM2A 3FUWA 5LQRA 5KQSA 3DMHA 3TPZA 5K0FA 4MWZA 4GOND 4DMGA 5CCXA 1XDSA 3AXTA 4RTMA 3SVZA 3LX6A 1JQ3A 1YUBA 2ZW9A 3IEIA 4C07A 1KIAA 1XJ5A 5GM2A 3KR1A 2O0LA 3FUXA 2B25A 2ORED 4RTRA 5EVJA 1ZQ9A 4EK9A 1INLA 1XVAA 1WY7A 2ZZMA 3JWJA 3MAGA 4R8RA 2OZVA 2Z6UA 5FCDA 5CUQA 2OY0A 4E31A 1F3LA 4KW7A 4OA5A 3HVKA 3CBGA 4L7VA 3KQTA 3KPUA 2C7QA 5DXAA 3B3JA 4F84A 4AZSA 3VSEA 5DM2A 1FJXA 2QY6A 3DXXA 3I58A 4RWZA 3M6UA 5EGSA 1QAMA 3V8VA 1L3IA 5HIIA 3IV6A 4BLUA 4UOEA 3K0BA 5LQKA 3FRIA 2XVMA 5H02A 1EJ6A 1VE3A 3QOWA 2ESRA 2YTZA 2LD4A 2R6ZA 5EMKA 3KR2A 1NE2A 5FHRA 3SSNA 3LL7A 1JR4A 4KVZA 4XUDA 1JSZA 4YUZA 1AQJA 4G56A 4QVGA 4X63A 1B42A 3GRYA 5EG5A 1FBNA 4HSGA 3EVEA 4CTKA 4RTSA 2B9EA 2NYUA 4QQKA 4BLVA 2IH4A 3HA7A 2P1DA 2GS9A 1EIZA 1KR5A 1IXKA 5CVUA 4AZTA 2VDVE 2GAFA 3PB3A 3OE4A 5FWDA 1RI5A 5FQOA 5JUWA 3UJBA 3AY0A 5EMMA 3LKDA 4KRGA 3HVHA 1R00A 4PYMA 3T7SA 4E32A 2O05A 1TPYA 5FHQA 2WA2A 3KQMA 5EEGA 2H11A 3X0DA 3LCUA 4YUYA 3FTEA 4P7KA 4XUCA 2F8LA 1Y8CA 5T64A 2ZZKA 1QYRA 3P97A 1NW7A 2PT9A 5F2NA 3G5LA 2ZIEA 4HTFA 1WG8A 2FRXA 2JH9A 4A6DA 2AR0A 3KQVA 3JWIA 4RSRA 3PFHA 3TKAA 1KPIA 2H1RA 1X19A 3EVZA 3GO4A 1VBFA 3BXOA 2FCAA 1NW3A 5KVAA 4GC5A 3FZGA 3KQQA 3ER8A 3B5IA 1RJFA 3TR6A 2P41A 4PYKA 4Y2HA 4PIMA 1RJGA 1U2ZA 3GRVA 2ERCA 3MERA 4ISCA 4RYLA 1VQ1A 4M38A 2I6GA 3VYWA 3PFGA 5LQCA 3TFWA 2JG3A 4CKEA 3KQPA 4CKCA 1WZNA 2PXXA 3FYCA 3OU6A 4P7FA 4GC9A 3JWHA 5HIJA 4HC4A 4CWAA 2EJTA 2QRVB 3OZSA 4KDRA 2EFJA 5EEHA 2PKWA 3AWIA 2CWWA 3C3PA 3NMUF 2ZVJA 1F38A 2IPXA 1KYZA 3DP7A 3LCVB 3MGGA 3SSMA 3VC1A 4F85A 3DLIA 2H00A 2VDWA 2ZULA 5K0NA 2DULA 4YMGA 3HP7A 1KHHA 5DRTA 2FPOA 3OZRA 3MB5A 1L3CA 1X1DA 1G55A 3G7UA 4PINA 3THSA 3L8DA 3PTAA 1XCJA 3BZBA 3G88A 1TW3A 1YB2A 1QAQA 2GA9A 2PXAA 3KQWA 4QQNA 1G60A 3SSOA 3R9XB 1BHJA 2DPMA 1AF7A 1VP9A 5DTQA 2BR3A 3ME5A 3KR0A 3KR9A 3BKWA 3HVIA 1JTFA 3KPVA 1I1NA 1EJ0A 2BR4A 4GUAA 5LQAA 4IV8A 5HIKA 5K0GA 2JHCA 3BWBA 2JHAA 3O31A 1RI3A 1JG3A 5D1HA 3E8SA 4MQ4A 2XYVA 3DXZA 4QTUB 2IP2A 4FZVA 2NXNA 3A26A 3KQOA 3RIEA 3ER9A 5CIYA 3HTXA 3G5TA 4PGHA 2N47A 5T6BA 3EGIA 4KIGA 5E9JA 1VL5A 4QVKA 4MIKA 3FPEA 5EPEA 2ZIGA 4GF5A 2IDJA 3R6TA 5EC8A 5FTWA 3HCAA 2IH5A 2AOUB 2IIPA 3CC8A 5P8WA 3PT9A 5K0JA 5EKXA 5MHTA 2IGTA 3PX3A 4DCGA 3GCZA 1RI2A 1DCTA 3G2OA 2I7CA 5K01A 3SXJA 3F4KA 3DH0A 5FULA 2IFTA 3G8AA 2ZTHA 4RX1A 1RI4A 3C0KA 5HFJA 4IKPA 2FK7A 3DMFA 5LQUA 2KW5A 4PYLA 5EIWA 4P7JA 3C3YA 4H0NA 2AN4A 5EHGA 2HV9A 3FTDA 2UZ4A 3BWMA 4EVIA 1R74A 5LQJA 1G8SA 2AOXA 2R3SA 3MTEA 7MHTA 2FYTA 4OBWA 3EEYA 3HCCA 3P71T 3A25A 4GQBA 4E70A 1D2HA 5FA8A 3T7TA 3C6MA 4QDKA 4RTJA 3P2IA 2ZWVA 5FUBA 2V74B 3IYLW 2OKCA 2PLWA 3KQSA 2PV0A 3T7RA 2G71A 1HMYA 5K05A 4EKIA 3SMQA 5DT2A 3UJ9A 1BKYA 3DLCA 1SUSA 3DMGA 4E2WA 3BGIA 1ORHA 5E2BA 5DX0A 3UBTA 2JJQA 3PVCA 1OR8A 3KU1A 4C04A 2BR5A 1ZHFA 5FADA 4C08A 4LG1A 2ZCJA 5K03A 4RTLA 5DX1A 3S68A 4C03A 5LR6A 3R24A 4BP1A 4PNEA 3OE5A 1FP1D 4AZVA 4PYJA 3A7EA 1MHTA 3HEMA 1R6AA 3LECA 4PONA 5ERGB 3ID6C 4PYIA 5EMJA 4C06A 4K6MA 4YV0A 2VZ9A 2PX5A 4GEKA 3OU2A 1YZ3A 5DWQA 3TM4A 4PCLA 3M6VA 4E33A 2B78A 1XDUA 3NDIA 1P1CA 3EMBA 3EGEA 1NBHA 4DQ0A 1AV6A 3THRA 2EG5A 1VLMA 2AOTA 3I53A 4YUVA 4R6XA 2FK8A 3BGVA 3OPNA 1DUSA 3MTIA 5FWAA 4KWCA 2OBFA 5E1MA 5F2KA 3SR4A 4C05A 3NVKI 4HTFB 2HNKA 2WK1A 4GOMD 3FRHA 5C9ZA 3I5UA 3M6WA 5FQNA 1L3BA 5IH3A 2IH2A 2K4MA 1Z3CA 3KPYA 2P3QA 2OYRA 3BWYA 2Z6AA 2HMYB 2ZFUA 3NJRA 4RTQA 3EPPA 3ELUA 1BOOA 3E23A 2E5WA 4FT2A 3DR5A 3H2BA 3KPWA 3EVFA 3OCJA 3UZUA 2ZLBA 4ER0A 5C1IA 5FA5A 4E30A 2BZGA 3AXSA 2UYHA 2NXJA 3HA5A 3P9CA 4DF3A 1H1DA 4FR0A 4XUEA 3M70A 3RW9A 3CCFA 5ICGA 2G1PA 1UWVA 3GWZA 4V0RA 3OFKA 2CMGA 5DTRA 3M6XA 2C7OA 3D2LA 2VDUE 3PS9A 5E9QA 2ZZNA 5K0LA 2YX1A 3E7PA 1D2CA 3WSTA 1XDZA 3BT7A 3CJTA 4E2YA 5EZQA 1P39A 2PT6A 3K6RA 3SM3A 2HWKA 2OO3A 5CCBA 3TMAA 3UFBA 3ERCA 2OB1A 2QE6A 3G89A 1ORIA 2PVCA 5EMLA 3G2MA 5CVDA 1UFKA 4HRAA 4ZTBA 3ELYA 1V39A 3FUUA 3GRUA 1KYWA 1FPQA 1ZGAA 2PXCA 4CTJA 3C6KA 4POOA 3Q87B 3BGDA 2ZIFA 2A14A 3I64A 1KPHA 2YQZA 2GB4A 4MTLA 2G72A 4EKGA 1N7JA 2ZWAA 2AZTA 1WS6A 2YUIA 3OU7A 4RVHA 2BM8A 1M0EA 4OA8A 3HVJA 2P3OA 1ZKDA 1JG4A 5DRYA 3PLAE 3G2QA 1MJFA 4BP3A 2QRVA 4ER3A 2PBFA 5DM0A 2GLUA 3LPMA 3UA4A 2XVAA 5ICCA 1YFLA 1EG2A 1JG2A 1KPGA 3DTNA 3FYDA 4AUKA 2I9KA 1VP3A 3GRZA 1NW5A 4ER5A 5E8RA 3QV2A 2ZBPA 4E2XA 3UA3A 4PGGA 3NTVA 4QDJA 2GPYA 3SGLA 4P7GA 1SQFA 3O4FA 2Y1XA 5EIFA 5CD1A 1ZG3A 2ZBRA 4X1OA 3A7DA 5HILA 3B7PA 2JH8A 3FUVA 3QOXA 3GNLA 2WA1A 2V7EA 3FPJA 3UJDA 1L1EA 4NECA 3CVOA 4EQZA 3E05A 1VIDA 5EKUA 4OQEA 2UYOA 5K0BA 2PSSA 3LGAA 5C0OE 5BW5A 3HCDA 4ER6A 1I9GA 3EGVA 2Q41A 4LWOA 3LBYA 3ELWA 2BM9A 2QM3A 3HCBA 3P8ZA 3RODA 3T0IA 5DM4A 2BH2A 5K8VA 3FUTA
chains in the Genus database with same CATH superfamily
4HDCA 2CFTA 2HI0A 3RIGA 4M8IA 2FJPA 4LRUA 2VXCA 3DV0A 2ZEJA 1NQ5A 5K3FB 1M2OA 2XLCA 2XYRA 4ZCPA 3ZGNA 3ZCRA 3P2YA 1PL7A 3JZFA 3ICQB 2JRLA 3L8EA 5FBWB 5C5CA 1HA3A 1OLXB 4TT8A 4WERA 4R41A 1RYDA 3RYHB 4DPLA 3AHGA 1K4KA 4KH1A 4PBSA 2VJDA 3ZW7A 4PFSA 2OCBA 2R6AA 2PL3A 1ZHHA 1DRVA 3KS9A 3QBDA 4RGBA 5JS1A 2YJGA 5AW6A 4I1PA 3OWOA 2BGGA 4OBEA 1KYTA 4RMGA 4YP6A 1PG2A 4ZOCA 1VE6A 1X92A 4MHTA 3BUSA 4AX8A 4ZVOA 5JRJA 5JWHA 2WT9A 3EG9B 5FPQA 2C29D 1M6HA 1OVMA 4A6EA 2JHGA 2QX8A 2CMHA 3KEMA 1ZWKA 3Q3CA 3L5OA 4DEYA 4Q3NA 2PBZA 4F5DA 1FLVA 4I5EA 2BFDA 3A11A 4B6PA 1WUKS 4R9SA 4RAQA 2HH9A 2Z8YA 2YXPX 4MI9A 1KZHA 1E1NA 3ENWA 1W581 2XR1A 4PAWA 1O58A 1PNVA 2VNIA 2WKPA 3TIGA 1H6CA 4JXJA 4HDKA 4NU8X 2ZRGA 4R4JA 3PUVA 2IYQA 2RONA 3DE2X 4KP7A 1GZ6A 3KL4A 2IY7A 3EDCA 3P9SA 5JR3A 2PY6A 3FE2A 3NIBA 1QVWA 1TF5A 1BW9B 3LDFA 4ZICA 4L07A 4CM8B 3TOSA 1PWEA 5AK5A 1BE1A 2UUOA 1LS1A 1GA6A 4WIAA 3OC6A 1TT5A 5TIIA 1F6BA 2BRUA 5DNEA 4D0NA 5BR1A 2VDLB 5LSAA 4RTKA 3EVDA 4J1TA 5TGTA 1TUIA 1QQ6A 4I8IA 1KO1A 2BFBA 2REOA 4J0JA 5ALUA 1A8QA 1MEOA 1OI7A 1W75A 2ORYA 4ND4A 1IOZA 2ECKA 4FPXA 5DLQC 4Z9FA 3RS8A 3TLCA 4BNXA 3VNQA 2EX0A 4D43A 2O8CA 5FJJA 5D85A 1E4EA 3L40A 3GJ3A 3IVMA 2OKGA 5JFTA 1AKQA 1TZJA 1U3UA 3LBIA 2IS6A 4K0KB 1U81A 5BXQC 1XCGB 1SXJA 2QSZA 2PGXA 5D1NA 1RXIA 5GGYA 4K46A 3SZRA 5J9FA 3B52X 4TTSA 5IM4F 1SZDA 2OE2A 4CV2A 3E2IA 4JKOA 4IG9A 1ZMOA 3VR3A 5LP6F 4IIGA 2DKOA 2UYCA 4HDRB 3WNQA 1L5WA 1DE0A 4UUQA 3KE9A 3PWZA 1CQZA 4Q82A 1ENOA 5HA5A 1Y4UA 4R51A 4F6RA 4FB4A 3PT5A 1NLZA 2QE7A 3F8SA 5ERXA 1KY3A 1VZ2A 1ZD5A 1ORTA 3E3NA 3R5FA 1EPUA 4J3JA 2BD0A 5C3MA 1JDBB 1HSZA 3IHKA 3UAGA 2HA3A 3SN6A 3GR6A 2O8BA 3P9ZA 1M8PA 1SUIA 2ZB2A 4Y2RA 3SP1A 2H54A 1UQRA 1SXHA 3TCKA 3TQOA 2Y1EA 1Y3CE 1E8MA 2H2GA 1WKVA 3RT7A 3LHDA 4A9AA 2PGLA 1DHTA 4LSGA 1KIFA 1KZ1A 3EXIB 1NWHA 4GFDA 5D01A 4RTOA 3ENKA 2DB3A 5IXSA 4QM6A 5YASA 3OT4A 4LVCA 1EKXA 1ZJJA 3X1YA 2AVNA 1N2XA 1XRSB 4WLUA 1QRAA 4WVLA 4YB8A 2QBYB 3HBAA 1YO6A 2FEPA 4V0NA 2I0FA 4PY2A 1Y9ZA 5T67A 4BV3A 4KQ2A 4YREA 3AEXA 4DVJA 4YJHB 4TS1A 1KXJA 2JK1A 2XB6A 2OK7A 4HGNA 5ALEA 2G04A 4OYHA 4QGAA 1PFYA 1GFWA 2LPMA 1N2CE 2DYKA 5ILGA 2FWBA 2G70A 4JFAA 4KOEC 2PS3A 2YYSA 4WN9A 3ZKWB 2JAHA 4NXMB 1TL7C 1U80A 3ESZA 2O5EA 3V2HA 3F6EX 4YRNA 2QQFA 5E7MA 2Y0DA 1HDRA 2QORA 3EIXA 5LDGA 2PUJA 5FR1A 4E46A 3K9WA 4WLNA 4YV1A 2X7XA 2WU0A 1FF9A 4C0JA 1RFGE 1JRLA 1NT2A 4ZVVA 5SV2A 3V8BA 1S1MA 1KEKA 2V7TA 3R7BA 5I48A 4YY3B 5JMOA 2XEDA 1XVVA 3PHLA 1RHKA 2X4GA 4QUHA 3IQDB 4YFVA 5DSZA 1X1EA 1XRQA 5AVKA 1W0KA 2OFPA 3KYCA 1CIVA 1PAUA 4KR3A 1C9NA 1NXTA 1W34A 3MT8A 3H0CA 1UXGA 2YC2C 4R1LA 4IO1A 3NT4A 3S2YA 2H8GA 1BU5A 1ZD4A 3G9ZA 4IGIA 1DAGA 4JGBA 1RWMA 3P0RA 3OKFA 4F4UA 4I9FA 1J5EB 4EL5A 2ZYGA 3JVUA 4RH0A 4A10A 3G59A 2VJOA 3WP0A 4CMHA 3OX3A 3JWJA 4MS3B 4PZ9A 5EJIA 5F35A 4B2IA 4JP5A 1D7AA 3FWKA 1CRWG 4ROSA 5FR2A 2CC2A 5KAMA 3ZHBA 4C2BA 1XQXA 2O2HA 3AL3A 4OQLA 4EVRA 3KLOA 4O4HB 1NY6A 1U04A 4MDFA 3HN7A 4IR7A 2XLBA 2FXVA 3M6UA 3UMCA 1T1JA 3IAFA 1QGDA 3ND6A 3QNUA 2OAQ1 3JSXA 5ALTA 4IQ8A 3F5SA 3FRIA 2V1UA 1FFXB 1OAKA 4ROTA 2HDHA 3Q9SA 2IHYA 1RWOA 1Z9BA 2AK3A 4JP8A 2F1JA 5CCEA 1QGED 5IVPA 3GLIA 3WIDA 3U61B 3CRMA 3ZJ4A 3ROTA 1KMHA 4LYYA 4CMKA 4EAQA 3EXEA 3M1LA 3IP8A 4B3RB 3N8KA 2P9TA 2PL9A 2MJLA 1XK7A 4IDFA 2YXNA 4BVJA 5C32A 1YULA 4AJ2A 2ZJ4A 4PRKA 4W1SA 4HAVA 2Z5GA 1M33A 2KHZA 1L9XA 4RXMA 1DMSA 2WD8A 3G5UA 4G1UC 4DNPA 1Z0DA 1PR4A 5EMMA 3DVAB 3S5JA 3LKDA 2G9ZA 4BUJA 3L4BC 1AK1A 4JC0A 1J5XA 2ZRCA 4YAFA 5EWJB 3ER6A 3S2FA 3STUA 2DFTA 3X1JA 5IUKC 4XUCA 1V8ZA 4KQCA 3L7KA 1BJKA 1Y8CA 5DASA 1GRCA 3HWWA 1F1BA 1U3FA 3USZA 2FRXA 3GFGA 1EK5A 3UMVA 2HMAA 2Y67A 2X6RA 1YQ9A 4XVUA 5DGCA 1I2MA 3U37A 1EAYA 4FILA 3MRTA 1VZ3A 1K8QA 2BEVA 4I2VA 4L72A 2GRAA 2W6MA 3OQNA 1W0JA 1CCWA 4LY0A 4WHMA 3L7AA 3E9CA 4N9QA 1AIPA 4IQ0A 3TKLA 1E9SA 1WEKA 3A2NA 3TLZA 3QXGA 3MERA 4CI9A 2J7PD 2P62A 4M38A 1Z35A 2NO6A 2V7PA 3E3AA 3P9QA 4PX3A 3S5UA 2JG3A 2OYSA 2IW3A 2EFDB 2PXXA 3GNQA 3IUMA 4J8PA 2Y4NA 3B20A 4XR4A 4QVIA 2X0IA 5A9SB 5C7YA 1TEHA 1J8VA 3HU2A 4MA5A 4AZ3B 2PSHA 4TQUS 4BAUA 2PZLA 3WC4A 4D74A 4ZKDA 3N86A 3DP7A 3WB2A 5JCXA 1PEKE 2O3QA 3JQAB 5H4HA 2O20A 5J63A 5KNBH 4X71A 4L28A 3EUAA 5BQ5A 2AEEA 1YT5A 1QIKA 1TZMA 2NU7A 4TXJA 2OD7A 3CRRA 1JLKA 2AX4A 1SUBA 4CMJA 4UNRA 2XTAA 4L74A 3FBTA 3EGOA 3FYUB 3QSGA 4OLAA 4HNUA 1XCJA 1B23P 2NYRA 3IKTA 2GA8A 3KB2A 5CPBA 3PFFA 3NKVA 5ALOA 3T0GA 3ND9A 3HS3A 5E38A 3FWYA 4CM4B 1WM1A 4WCVA 5KNCD 1QPZA 4ZC8A 3AERA 1UAYA 1SQ5A 3FPBA 2Y1DA 3IS3A 1JJIA 4LRSB 2ACWA 3V8PA 1Y8AA 1ULBA 2FCRA 5NULA 1YA6A 1JG6A 1DOAA 4UBOA 2V97A 3GEBA 5FP0A 2FGKA 1AA6A 4RELA 5EQDA 4BV9A 1R0LA 4M6WA 1MR3F 2XIQA 2HSZA 1VL5A 1AB5A 1OWNA 4QGGA 5JYBA 2I29A 1EVKA 4RVUA 2IDJA 1BCSB 1M8FA 2CEAA 2QL9A 1LDMA 4HLNA 1GQQA 2BBOA 3C16C 1GKUB 3KOWA 5K1ZA 2ZP1A 3H2ZA 3WWPA 4RKQA 1JJBA 4XQCA 3J81A 3BAZA 3D2BA 4LYDA 2NU9A 2P8SA 2ZR9A 4KFUA 1PL6A 1WMDA 2IT1A 4BXOB 3IMCA 1IZ9A 4KREA 4NCHA 1BROA 4LF9B 3W2FA 4XCQA 2YVUA 5EHGA 4LJYA 5I8PA 4YP9A 2B37A 3JQPA 2H1HA 3RJ5A 4H3VA 3BMCA 1I2ZA 3ET5A 4GECA 4KGDA 5F1KA 2WUGA 1T4BA 2OM6A 3CNQS 4Q1BA 1Z7YA 3TZCA 4PSVA 3UB3A 1P80A 2VDMB 4JJ6A 4OBWA 3EIOA 5DOZA 5FJIA 2QMZA 4AY3A 1Y89A 2Z1NA 4I8DA 4LHYA 2HC9A 1VOTA 2IZ6A 4JBWA 2XRYA 4YDSA 5HFNA 3RJ9A 4B76A 4UM7A 2IIVA 4IKOA 4UUAA 1IVNA 3FLAA 5JG7A 1THMA 3V2UA 5LP6B 4F21A 3RTAA 2A0UA 2QZZA 1NIJA 1WMSA 2B1RA 4HK4A 4M76B 4GKJB 1M34B 1DHRA 3GNTA 4II7A 1QGUA 4IJ5A 4OP3A 4JKIA 2XODA 5JYDA 1YJBA 1NBAA 4E2WA 1ANKA 3MJCA 3Q40A 4H7KA 3SK0A 1OR8A 3D1VA 4IAOA 1RLTA 3TB6A 4C04A 2VCYA 1XNHA 3IB3A 4GYYA 2J0UA 1X7DA 2X5NA 4L95C 1NDHA 3IO3A 1AY0A 2VHXA 4AZVA 4FJ1A 2XWJI 1CVIA 4LOKA 4JVMA 4NG4A 4PTYA 1FU7A 5CNIA 5JI2E 3NC0C 3LGSA 2PGOA 1VXRA 3DWEX 4UU8A 4U1RA 3WLRA 3CM0A 4EEKA 1UBNA 3GDFA 3OU2A 4F7DA 4S04A 4RM3A 4F45A 4M1ZA 4N01A 2B78A 2OXCA 3SQLA 4ZRMA 2QQ0A 4JQSA 1M7HA 3EMBA 3ZS9A 1JPUA 2Q3JA 1J23A 1FXSA 2A2ZA 4AWAA 3M2TA 1UJNA 3DONA 3L0YA 4HFRA 5EWLB 4QQRA 1W8DA 2AJDA 2PLRA 3F71A 2WABA 4IX9A 4XWGA 4Z0NA 5LZ4A 2EW8A 2IYVA 4YAIA 3IH5A 3KYJB 3RR2A 4E88A 4IHAA 3VV3A 4OI4A 2AZXA 1E6UA 4IHQA 1NHGA 1CNEA 2IH2A 5FQNA 1CTQA 2AR9A 1R0CA 1PT6A 2ZIXB 4K88A 1CQJB 1HDIA 4RV4A 4EZBA 2HRZA 4ND5A 5A02A 3DDHA 3OF5A 3QE3A 1N92A 1DAFA 1XZPA 2CVPA 2OV2A 3C8HA 4FT2A 3H2BA 3ZC3A 3VHLB 4K7JA 4B8YA 4HLDA 4EL0A 3GLHA 2EBHX 1EDEA 3EIWA 3HGQA 4K9KA 5FA5A 5G0WA 2G9RA 4GG1A 3HM9A 3WNZA 1BX0A 2ES4A 5IT4A 1K0UA 3KLPX 4YRMA 1PVOA 4CF6A 1ELOA 3INRA 3BL6A 3F4BA 3L8CA 3PS9A 5LZ7A 3V4FA 1U0LA 2YX1A 5K45A 2B34A 2A0XA 3DBHA 2RFLA 1DIGA 3QWBA 2CHFA 1IJBA 1P5HA 2ZCJA 3KB1A 1HG1A 4IIHA 4UEJA 2FPSA 1AUPA 3MCAA 4ND6A 2R1ZA 3G89A 1U11A 2PVCA 1XEFA 3E9DA 4IG4A 3ONNA 2Z30A 4P0PB 4BL5A 3OEEA 2H9AA 3R1IA 4N48A 3SF8B 1I5RA 9ABPA 2VA9A 1Q12A 4UXIA 1EBBA 1W85A 2GKOA 2B1JA 3RFXA 3PNPA 3ZJ5A 2C96A 5KMGA 2MINA 3HKEA 2VP2A 1B6TA 1HSOA 3QYFA 5CTAA 2EW1A 5JJIA 2WU4A 2WIBA 1PR6A 3FDZA 3QLUA 4OATA 4QYIA 3U3XA 3T3OA 1REQB 1HGXA 3K20A 1T8RA 4JJ7A 5I8ZA 5DM60 1UEJA 3CT6A 4J2OA 2CXQA 2WLTA 4LZNA 1WEHA 3R3YA 4RHTA 1E7MA 2J3JA 2FDCA 1GPWB 1W4ZA 1CUWA 3K9NA 4XM1A 5KWJA 4E07A 2XE7A 4K6CA 3GJ6A 4EYGA 1VP3A 1Y3AA 3GRZA 1A5ZA 3PNBA 4OLJA 1US8B 4DXAA 1LI4A 3W4KA 1XAJA 4NE7A 3LY5A 4S35A 3WJAA 5JBNA 1PGOA 2AXQA 3D8UA 1Y42X 2PGDA 2C92A 2RGYA 1MJ5A 4HH1A 5TPWA 2VJQA 3TINA 1RKBA 4X1OA 4NH4A 4E4YA 4R3UC 5EHQA 2C77A 2FF5A 1K8ZB 4C2UA 5BYBA 1YRBA 4NNOA 1PKEA 2DWQA 3PD7A 2E0IA 3Q0IA 1JW9B 2WTMA 3CVOA 1V1RA 4CVNA 3K6SA 3LNCA 1FBTA 4LNAA 3PGKA 3ZBQA 4MQFB 3V2IA 3K1JA 2WDPA 2HQOA 1T8UA 2EKPA 4R1UA 3UK6A 1SOVA 4BU0A 2BLNA 1CIJA 4LQLA 3T3GA 4OQQA 2UVPA 3OWHA 1LU9A 3CX6A 1C3OA 3FUTA 1XXHA 2WIGA 5EZSA 4YC7A 3T7IA 3HVRA 4RPCA 2EKZA 2PJDA 2ZJFA 5AKZA 3B6KA 4QAJA 3L8MA 1ZP6A 2A1TS 2JGLA 4QELA 3TSWA 4CNBA 1CRQA 1F14A 1DIHA 1RQRA 1MB3A 3QLUC 3NX4A 3DTVA 2AOUA 4YLYA 1NUQA 3L8YA 2P3LA 1CUAA 3TOZA 3I23A 2AVDA 2PX4A 2PZAA 3GARA 1FU8A 3PWKA 4D7AA 4M60A 3U4IA 2DBRA 4ZZ2A 1OX6A 2EL9A 4BC0A 4GIBA 5B4VA 2O0MA 2X3UA 2JKZA 1ID8A 1ATZA 3UB2A 5KQGA 1QSGA 2XGSA 1WY5A 2R4TA 5DYYA 1T0HB 2CZCA 3HNRA 2BGMA 4D4LA 4G4SP 4FSHA 1T1SA 3VUEA 1M0SA 5ADVA 3LAWA 4FGKA 4B46A 1USKA 2YDYA 3GLKA 4HEHA 4QRHA 2OZLB 4NEGA 1JHAA 1X1AA 3J7AC 2AFVA 1OZHA 4OGGA 1NJ6A 4R8VA 3U81A 1G41A 1G21A 1OTYA 5JDCC 4W7HA 3SYMA 5FUMA 2B5VA 4UDXX 1ZA1A 4CLRB 3IDSA 2RHLA 2POCA 2WAYA 5FL7D 1HKUA 4BQFA 1XK6A 3N05A 1U63A 2IHJA 2Q4OA 1XYVA 4E14A 1V16B 1OV6A 3EQ6A 4HS4A 3K0FA 3FAZA 1G4AE 3AY7A 2IYRA 2ET6A 3IT1A 3R76A 3FAKA 1V9LA 2PZGA 1XYYA 2GPSA 3L1UA 3WQRA 1IMJA 1XTPA 2VYFA 5G02A 1FFCA 1KH2A 3MRXA 4NYMR 4B32A 8ABPA 2WF5A 3O8NA 5ICFA 4N8SA 1CUJA 3QMVA 4I50A 1E2KA 5AM4A 4J4TA 4Q15A 3M3DA 4C7XA 4MZDA 1CFZA 1NVMB 3LH5A 2H51A 1JBKA 1HOXA 4KYIB 5EYPB 3FCUB 2F43A 1NX6A 5IKPA 3KX2A 2AYXA 3EYWA 4A8JA 5EE9A 2A9KA 4NCAA 1CB0A 4B3DA 5KOHB 4V38A 1F2UB 4NPAA 3C7AA 1I0LA 3EXFB 4JU9A 1J1ZA 4BRWA 5BN3A 3ODGA 3ZWDA 1T8WA 4H15A 4GMXA 3GEGA 3M9WA 2A84A 4S3MA 4Y2PA 2PKYX 3GW8A 4QC2A 3WR5A 1GHTA 3MJVA 4ZVUA 5B2EA 4CMIA 5DTEA 1VGQA 2H4YA 5LMCA 3LCMA 3D7SA 5DI9A 4BC1A 4B6EA 3GC6A 4DLXA 4YRJA 5KQMA 1USVA 4TYYA 1J2JA 1NR5A 4TLDA 3O7WA 1TYDE 4DWJA 1NQXA 1QHHB 5LMUB 1LY1A 2O57A 4R0MA 2JGKA 1P91A 2OSBA 1GCOA 2VHZA 3ZU2A 1AZSC 3JQ7A 4ZO6A 1W2GA 2QDXA 1FP2A 1J9GA 1AN9A 2IXDA 2C2XA 3DM9B 2QTCA 4JLJA 3WJ7A 1I0ZA 2QZJA 3DVRX 2AHRA 3DOUA 3GAFA 5D6OA 4EHIA 5FD8A 4PWYA 3ABQB 4GMKA 3RS4A 4B09A 4KXVA 2Q9UA 4DA8A 3QE2A 2YXDA 3OVMA 2QMOA 4W1RA 2JLXA 1DQPA 5C8YA 2X0NA 1C4WA 1G3MA 1GPYA 2DR2A 1XVLA 2ODBA 3MVEA 2JV2A 1NWCA 4RF5A 4WZAE 1V26A 5EWMA 3G5AA 3TECE 4YNBA 4KODA 4AMZA 3SOZA 4U7TB 4UBLA 5H3LA 2OB2A 3CJQA 4NJMB 1Z6XA 3WNVA 4ZAVA 3DFMA 1E2BA 4EYOA 1NZJA 3D2CA 1E2IA 4QU8A 3I62A 3EWIA 3FYSA 3K31A 4IXDA 2PJRA 1SCQA 3LHFA 3R7DA 1J1IA 3ZU3A 2JFZA 1FTSA 5B58T 3CLHA 2YHAA 1I7PA 3HGTA 16PKA 4WK0B 3ESAA 5FORA 5T4FA 3VZRA 5FX2A 2NVOA 3NALA 4WRRA 1J1UA 3E1KA 1BC5A 2H1VA 4XYMA 1OJLA 4M99A 4IDBA 4QODA 2XBMA 2DH5A 1EWKA 4KMSA 4ATNA 4C4TA 2D2XA 1TAUA 3AJDA 3GELA 3IAUA 5E8JA 3GU3A 1J42A 1RQXA 1TECE 1FX0A 2QL6A 1LTKA 3I6BA 1DXOA 3HBFA 2HF7A 1NBMD 2GEBA 1UJ6A 3P1JA 4M88A 3OTQA 3IHLA 4N0MA 1M2OB 1V7QA 2B8WA 2XIJA 1XAGA 4HP8A 2B99A 4R8KA 4A26A 2RHHA 3A1NA 3BWDD 4WY8A 3EZ9A 2ZRNA 2J7KA 2YIMA 5B7GA 4DV7B 1ACJA 1R27A 2Y1FA 4L4UA 4PIVA 1JU3A 2UVQA 1YQEA 2DFKB 1U2DC 4GH5A 5GJCA 2YY7A 3UXEA 5BQXA 2LGJA 3EDOA 1CQIB 3KR1A 4IJQA 5K0EA 4D8TA 5DP2A 4R54A 2R44A 1POWA 1X7HA 5KVSA 1CZ4A 4CTMA 1XVAA 2PD6A 1F5SA 1Z6ZA 2QYTA 1OTXA 2R8BA 2WD7A 5FXMA 2HT6A 5MN4A 1ZWLA 4EJMA 3RYCA 1FCJA 1NR7A 2H57A 1KI4A 4A0RA 4YPFA 2HPHA 3O0TA 4BJ6A 1WVIA 1HZJA 5TMEA 4Z9AA 3G2NA 4C5CA 1ZXLA 2ZCUA 1J39A 2VUUA 2C7QA 1WW8A 4KBFA 9GPBA 5JAHA 1JA0A 3FKQA 4W9RA 4A7PA 1FQJA 3JALB 3EZ2A 1CUBA 4UJ5A 1ZIXA 4Z4GA 4F2WA 2GJ8A 5F3DA 4LOLA 3KJEA 4HDKB 5LQKA 1RLMA 3LO8A 2DUMA 2GN8A 2OZKA 2VWQA 4LDJA 1FNMA 2FW0A 4LI0A 4OXIA 2VI5A 5JZBA 3TTSA 2PT7A 1QTIA 3U1VA 1B0PA 4MAFA 4RIFA 3OM1A 1AQJA 2VLBA 4OQXA 1WPXA 2VDQB 4DIDA 4RTSA 1I6LA 3SFTA 1F9EA 2B9EA 2JJ1A 1XZKA 3GLRA 5C3UA 4FWIB 2VYQA 2W4MA 3L0CA 1GPH1 2BFBB 4CMAA 5ISMA 5FQOA 4OGFA 2O8CB 1UZMA 2W6JA 1C81A 1NZFA 3VTAA 4C7KA 5JXIA 4NBRA 3RVQA 4XWAA 3VH4A 4EGAA 4K87A 3Q3IA 4HNVA 1F9AA 2QN9A 2WJIA 4IMIB 1O6CA 1UADA 3U4HA 1WDWB 4KFTA 3WLQA 5IAAA 1NW7A 2PT9A 3D4BA 1GKYA 2WZDA 1EGHA 4JSYA 3W9YA 4BWVA 1R0ZA 2F8MA 2H4ZA 4AKSA 4XGQA 3C7DB 4G1CA 3ZHOA 4DDMA 4F3RA 1KI1A 1M0TA 1E7RA 4YVFA 2BMEA 4OI1A 1FNDA 2DTDA 8ATCA 3AM1A 3KQQA 3I28A 3E53A 4J16A 4Z0HO 3OZIA 1Z16A 2IZOA 3R3VA 4P22A 4R0NA 3F5QA 2P41A 1V47A 5CDGA 3TQIA 4F8EA 1G20E 4M9CA 4KXQA 4Y2HA 3G49A 1MC5A 1AHHA 4PIMA 5FPHA 3BWVA 1FFBA 4LHVA 1SIOA 4WFIA 2XB8A 4YI5A 2IHKA 3AETB 3C24A 2YWJA 2O8BB 4JSRA 1NR1A 1SU8A 3NCHA 3KT3A 2H17A 1KFBB 3ITEA 4AF6A 2BGJA 2M32A 2WZBA 4LMPA 2IPXA 2V55B 3OCUA 2P0AA 1WETA 2WHPA 3DAYA 3VPHA 4H1WA 2VDWA 1XN4A 1JAZA 4UAUA 4QNNA 3HP1A 5DRTA 3SXUB 4M9ZA 1P9WA 3F5DA 3NATA 4YBZA 4DDUA 5BVGA 1O0BA 4YJDA 4QBFA 3QM1A 3SEFA 1ZXXA 2GCNA 4WNAA 2FXIA 1C41A 4ZO4A 4IDCA 3SNHA 1E2DA 2CWDA 1J0DA 1IG0A 1ZOIA 2OV1A 3COSA 3MS4A 3EXG2 3HEBA 1UPCA 4V0ME 1IH8A 1LZKA 3KR0A 1CR1A 1QH8A 4TRJA 1LGYA 1NQWA 1IZ0A 3M6IA 5H83A 4DDVA 1E5DA 1R4ZA 2A5JA 1WPQA 1RWXA 2JFUA 1J0EA 2WSBA 2WVJA 3LUCA 4PHTA 1S2IA 1C1XB 3UGTA 2J46A 4XYGA 4PS0A 3KD2A 1K6JA 2LCIA 4Y2YA 3ZE7A 2REQA 3C4JA 2D5BA 5H80A 3KSRA 4QTUB 4PSUA 2IP2A 4TM8A 5B64A 1G8PA 2ZAYA 1SELA 1NP6A 2HIHA 5TQ2A 3SC2B 2HUNA 2NVWA 5TV2A 3PUZA 1MC8A 2A59A 5HM8A 3BCUA 3Q7SA 3ZTTA 2WTAA 5BV2P 4Y2QA 1A0OA 4D41A 3WMXA 4JENA 1AVTA 1L5NA 1KI6A 3KYCB 4CR6A 6LDHA 1KQPA 1U4NA 2V6JA 3O95A 2Q5HA 4INOA 1DCTA 5DEIA 4WOPA 4Y1RA 1P73A 1G9TA 1IUPA 3VNSA 3ICEA 3ZZNA 4YMSA 5A2QA 1NHWA 4LMBA 4TWJA 1WHSA 4M0PA 4NJOA 1H65A 4FHFA 3RJMA 1CDOA 3QVVA 5JJLA 2GZRA 4WQMA 2H1IA 5FWXA 3HJFA 1LXCA 1OBVA 4WGFA 3B8EA 4YA6A 1X70A 4KPUA 4C22A 1AH2A 1QFJA 3R44A 1QHNA 4O0LA 3ITDA 5FA8A 1EUCB 4ZREA 4AF8A 5E6SA 2G4VA 2GYWA 4RFSB 1KH3A 4ZYUA 2EDCA 3LX4A 1Z36A 2GD6A 2PLWA 5EPPA 2JJYA 2YWDA 3CPEA 5CFOA 1LW7A 1NBWB 2X2EA 5CLHA 5F3RA 4YFYA 2YVQA 2XMDA 3ABSB 4X93A 3E2MA 3T6KA 4L5YA 2AF4C 3KRTA 3GFQA 2BDUA 1NLMA 1E2UA 1XEWY 1OGIA 2AFHE 3NUZA 4Y67A 3GLIB 2JIPA 4RZSA 1GPJA 1HEIA 3KD3A 3EXEB 4JK3A 3TJMA 5DHSA 2CVZA 3Q2IA 3ZV4A 3FMFA 1F3OA 1XQVA 3NEJA 1VECA 4AUEA 1JMYA 2OAP1 3HEMA 2GXAA 4P8RA 1PJRA 4F4IA 1QRUA 3EGWA 4GEKA 2FSIA 1SQSA 3IODA 1W1IA 1PR1A 5HKKD 3I5AA 5C81A 3CNOA 1IEWA 4CW7A 1E79A 3C3KA 3EGEA 3MEQA 2GT1A 5CM9C 5FFFA 3V7UA 1YMQA 1CHDA 2IV3A 1B14A 1B76A 3BH0A 1VLMA 4KJZA 3KWMA 5KSPA 3I53A 1EXVA 2MSLA 3OHPA 4LGVA 4BJ3A 4XD7D 2YINC 1HL3A 2ZTVA 2DBYA 3NBYC 5HCIA 3AG6A 1E9CA 1L3BA 1Y6FA 4ME6A 1MTOA 2WWGA 3IKVA 4PLCA 3WLLA 1RJ9A 3OSZA 2IEIA 2ZFUA 3L6UA 4FCWA 4A23A 1J2UA 2BEVB 4FMBB 4O25A 1R15A 4LK3A 2E5WA 5EPUA 5IU6A 3EHDA 2K6GA 3N2KA 3PU6A 4S1WA 3VU3A 1P2BA 1NAHA 1FFAA 2PUVA 1OTHA 4KXUA 1NXSA 3M70A 1BDBA 1CDEA 4Y98A 2DETA 4GP7A 2FLKA 3DDNA 4I4TA 4NBTA 1CJTC 1XMPA 5JJ5A 3T8YA 5LZ9A 1XDZA 3SX4A 3QVGA 4HX5A 1TU3A 3V1NA 3R0ZA 3DQZA 1TRHA 2JS7A 2NV0A 4DGSA 3WB1A 4ZC1A 1NI5A 2VYVA 3EWNA 3I8XA 1AKRA 4LE1A 3QMMA 3ERCA 3WGQA 3JD4A 2D06A 4ABTA 3D7MA 5BNFA 3U3DA 5J2UF 2NLOA 3GRUA 4YRFA 2HBQA 3KWFA 3V4LA 5DT9A 5J47A 3UC9A 4PSAA 4KFSA 4FINA 4R7TA 1N4AA 2A14A 1FA9A 4QEDA 1YR9A 2A6PA 3B5EA 5ALDA 2Z56A 1YI8A 4M7PA 4YCLA 4HNRA 3VHQA 4XGRA 3I9V6 5K3AA 4RVHA 2OFOA 3I72A 2OXEA 1E0AA 5K3EA 3EFOA 3RS2A 4G07A 3T12A 2QTBA 4MGHA 1EVYA 4P3XA 3V1UA 2XNCA 2UUBB 6Q21A 5J4KA 2GLUA 2G06A 3LPMA 2XVAA 4LJ4A 4QSHA 3UA4A 4DB4A 1VPWA 3CB4A 3I2FA 4I50F 4AJ4A 4CR7A 1OZ0A 2VPZA 3EE6A 3H2HA 2WUVA 3FR8A 3QQ5A 3CLSC 5TE9A 1LRKA 2ZXUA 1YFZA 3P20A 2B4AA 5C5EA 1O0CA 3GMIA 2JKVA 2OUKA 3LRPA 3C3MA 1TU4A 5BYAA 2PKQO 3M5CA 4OHBA 4G81A 1IB0A 1AMOA 1J0AA 4I6JA 1GGMA 3OQ1A 3VVLA 5BV7A 5K2MA 2I9PA 2WA1A 3MWGA 3U7JA 4UOZA 3FTNA 1M8GA 2VH1A 2WHXA 3E05A 4IGAA 2NU9B 2G9UA 4UTNA 5G4KB 4EI2A 1ZRMA 3TXAA 4LYEA 1PYDA 2J4DA 5K0BA 5C0OE 1T4CA 2H9YA 5IS2A 3O2SB 4Q7JB 2Q1XA 1ZZGA 2H6EA 3LFTA 4JIMA 4OSPA 1U4OA 4N8EA 1BX1A 3VVMA 4P4TA 4ZVNA 4RDIA 3S28A 2EP8A 4R2IA 4G1MB 1DKNA 2AXNA 3H4IA 4BS9A 4LYHA 4UATA 5DN6D 3WB9A 4YQFA 3ZCVA 1UMBA 4N5LA 1JLLA 3A6PC 1UXJA 3ADDA 4G89A 4JB0A 2PQ0A 4RXTA 3WKCA 4MV1A 1A2BA 5DWVA 1K3UB 2HBZA 3EMDA 3ZY2A 1UBLS 1PV1A 1C2TA 5C8YF 1G5PA 1VCOA 5AUPB 4KXMA 2YOFA 1W36B 2H92A 1U8FO 3IOYA 4F8JA 3EEBA 3TF5A 4GEGA 4RZIA 2VUHB 3DT9A 3DLTA 4HZGA 2PZKA 5KYUA 1YR2A 1SOUA 3UKDA 1KP2A 2WM8A 5HZMA 4UDYX 1E2QA 2MR5A 3DYBA 5KI6A 2Z3VA 1M76A 1H6AA 2PX8A 2NU6B 2DY0A 1T15A 4P36A 3KTAA 2BL4A 4HVAA 5HR5A 2QNIA 1GL3A 4I1UA 4Q1EA 1PDOA 5E4TA 3FPHA 1CIPA 3NI2A 1IXZA 1P6QA 1R37A 2P9EA 4I6GA 4PZAA 4A91A 4CE6A 2IBSA 3VTFA 1M1YE 1IN7A 2FJUA 2P2CA 2DVMA 4M37A 1UK7A 4RJ2A 2HDNB 1OKKD 2OAGA 2PH1A 3E7DA 3NDJA 4TVBA 4JXZA 3DTYA 4GNRA 5GM1A 3UJHA 1OFHA 2XZTA 2RARA 3P4XA 5E3HA 5TB5A 4KFRA 2YS7A 1I7DA 1NVEA 5EP2A 1T10A 2O2XA 2OCKA 3L3BA 3ZD9A 1E3IA 1E94E 2E37A 3IOEA 1GVHA 1CS0A 1L4NA 4FSDA 4MULA 3ZK7A 1QLHA 3DOFA 1DJNA 2ADFA 2H52A 4CG1A 3OM0A 4R05A 3OSUA 3T7JA 2P0EA 3CNEA 3FWZA 3RSCA 4R8SA 4TTVA 3JQFA 2C3YA 3UAXA 4C21A 3ROGA 5KX5A 5GIOE 2CMFA 3RYIA 1S01A 1OH6A 3Q7EA 2J9YB 1D7OA 4QGHA 2OXTA 3AFOA 3KK0A 4P32A 4FHGA 5EJEA 5KTSA 3JZMA 3V8NA 2C8VA 4RK5A 4P7BA 4A15A 4D3DA 1ZH8A 2JGJA 4NPCA 2B7BA 2IVZA 3ADBA 4KWIA 2WPNA 1P7PA 1VLJA 3IAM6 4RK6A 5ERYA 1ONNA 4BFUA 3EOAI 2XA9A 1KSFX 2MSEB 2Z2JA 2O2SA 1QYXA 3EEOA 3CLKA 1HEYA 2WF7A 2QUZA 3OZGA 1HG0A 3GFOA 4Q4JA 4YJ3A 1LLUA 5ABPA 5KMGB 3HKEB 1NV9A 2FMUA 4AJPA 1I3NA 2B4YA 1G7CA 3OQIA 4GMHA 2HTEA 4JJ8A 2PWYA 2ZRIA 4LDRA 4JI6B 4D57A 4Q7QA 3PGXA 1R18A 5BWBA 2GZ1A 3PIIA 3IAM1 2IBMA 5CK4A 1JLSA 4Q7EA 4I2NA 4YUXA 5K4GA 5JPCA 4JHXA 1CSEE 2YXLA 3H2GA 1I24A 2MSKA 3PPXA 3PXXA 2OHHA 1XV5A 2B2CA 3OEHA 2FPGB 3ZV6A 3LWDA 4BFTA 3UG6A 2IYEA 4G5GA 3OM9A 4P34A 2WP8J 1NKSA 3PRHA 3ZNPA 2XYQA 4DABA 2MOKA 5TF4A 5TPWB 4WK2B 1YFJA 3WLSA 1LK5A 5A6SA 4DEVA 1QC5A 3K2QA 5DO9A 3MMNA 1E1LA 2EZUA 2Q1YA 3OIFA 3Q3VA 3WRVA 4BQRA 5IT9A 3VAYA 3BQMB 5AYVA 3AI3A 5HCNA 4S1TA 3Q1LA 4X0EA 3U0BA 2R60A 1EG7A 1V1RB 4JP1A 3K6SB 4RMNA 1L8OA 2CLFB 3CRNA 2JIMA 1HLFA 4YRKA 2FFJA 3WZ2A 4O5OA 2KJQA 2REBA 3L79A 2NP6A 4BMOB 4KE9A 1E1RD 2CXHA 1E3QA 2UVPB 1UODA 1C3LA 1RJDA 2V5VA 1C50A 4RW0A 2XCRB 5BP7A 5CVVA 5ALNA 1XXHB 4L6CA 1R88A 3EGXA 2D62A 4BQPA 5JECA 1EFHA 4KXYA 2I7DA 4CM7A 1J07A 1Z26A 2HDWA 1XCLA 3UCXA 2N0SA 1GQ2A 2YV1A 3DTVB 4FZRA 2DERA 3EA0A 4MVWA 2C4TA 2L42A 2QPAA 1NI4A 1S2NA 1VLLA 3MC1A 4KAXA 4KR7A 2Q4TA 1TK2A 3F6RA 5DGDA 2XSZA 2ZCVA 3GLGA 5I7FA 2CV1A 4DIBA 2PUBA 4N54A 2JH3A 3SDZA 3R4CA 4WKOA 4YQEA 3V80A 4GZMA 4TMWA 4D3YA 2ARKA 2MSCB 4WL0A 2ATEA 3AU9A 5IC5A 2QUJA 3L82B 1DOZA 3FWPA 1CEEA 3UNXA 5FL3A 3OQPA 1H0HA 1E0KA 1RBYA 2LCQA 2X5JO 2ZZMA 4CM9D 4JVNA 4PRYA 2HCFA 2ILVA 3N6VA 7ABPA 1CX9B 1G21B 5J2UB 4MGIR 2HADA 1YIAA 1AB6A 1WNFA 4B34A 1NFQA 3AM4A 4EB6B 2M2IA 4F5YA 5IBRA 1W48A 5K6AC 2VRCA 2A4KA 1FDIA 4UFNA 2F9LA 3MTBA 4AZSA 3VSEA 4IIJA 4ZEMA 5DM2A 5L8VA 4D9BA 1H2RS 4IWXA 4WJKB 4U7HA 4H3KB 3WRXC 4RWZA 5G2OA 2QTNA 1VC2A 4DMRA 4BO9A 3N39C 1UKBA 3RYCB 3S7ZA 2XVMA 1E0DA 4CMCA 2GASA 2IUSA 2W2XA 4OHKA 4D9HA 2W0SA 5FHRA 3PG5A 5LIPA 1G5TA 2VOEA 3B82A 1V3UA 3HLYA 4I50B 2Z57A 1JSZA 4QEZA 4YQYA 2P69A 5DMHA 3WI7A 3GRYA 2N46A 3KVRA 4AG5A 4EHDA 4LF8B 2RK4A 1TM3E 4YYZA 5KYTA 5GGXA 1NVBA 2F43B 2EVWX 2ZJZA 4YJKA 2XAUA 3W7BA 4E94A 1KR5A 5IWAB 3EQZA 1HC7A 1JFTA 3LU1A 1G5RA 4D4JA 1M2KA 4DV5B 4Z51A 1N33B 5BN3B 1RCTE 2DQKA 2BISA 3BMNA 1WIWA 2CXTA 2P2NA 1HETA 2EFGA 1JDUA 3LWNA 4KNVA 4ND2A 2VPQA 1PF7E 5F4BA 3RK0A 4CMIB 4YDRA 4PQYA 1YI0A 1SZJG 5F2NA 1WZEA 1WG8A 3OIVA 3DCNA 1PQ4A 1Z17A 4AC9A 1Z7GA 2E5FA 2ZPAA 3E8MA 2CD7A 2WU8A 4UVHA 1RRKA 2ODNA 2PRJA 3UUFA 4JITA 2H1RA 5IANA 3HWX1 1TFUA 3A1VA 1S9HA 3DPUA 4G9EA 4KIJA 4L5BA 4CKZA 4DJTA 1U9CA 3DGFC 4LHZA 4Q4DA 3FJOA 3JQ7B 4U0KA 1GXSA 1H1LA 2Y4OA 3IAEA 2WF6A 3PKIA 4KIUA 3UOWA 2NO5A 3LC7O 4OMFG 1GPKA 4MDEA 3OPMA 4YROA 2DG2A 4RYLA 4HNSA 4AJIA 3UK7A 1IQPA 5CP8A 5AVTA 1ADCA 3PFWO 3AEKA 3MA0A 3UGQA 1P8AA 4QUIA 1XA0A 3N8HA 2XECA 2DWUA 2HRBA 3JZDA 1Y1TA 4J76A 4LOAA 4WADA 2B36A 1T2FA 1TMYA 5C8YB 2C59A 2WJZB 3O3MB 2P9JA 5AVUA 1W4RA 3S29A 5SICE 2NUPA 5AJYA 5I7EA 3IOBA 5F9HA 1K98A 2ZYTX 4TWAA 3KV1A 2W6QA 1PEYA 2CXUA 3COWA 4GQIA 3KZKA 4EG4A 2QRKA 5EWMB 1HDYA 1PUJA 3MWDA 4PZCA 5GOTA 4RA9A 1HBJA 4Z0TA 4M9QA 4RQTA 2F00A 5AHOA 2XMCA 1M2WA 3KZOA 3HHPA 2AG1A 4H2DA 1VKZA 2QRUA 5T8KC 4KSCA 4BZQA 2PO7A 1H05A 1QAQA 3NKLA 2BGLA 1L5SA 2QN2A 2AEMA 1EFTA 3ADKA 3G1TA 2OG2A 1AF7A 2ACKA 5DHAA 2BR3A 5DTQA 4I1SA 5ILQA 4DA7A 3U09A 2HSWA 1Q74A 4ZZ0A 1PJTA 3KPVA 3PNKA 4EARA 1EFVA 1CD5A 1K5GA 4IGKA 4IV8A 3VKWA 4DUPA 2J1LA 5IC4A 5JH7F 5K0GA 3F3KA 4LFBB 2AUTA 2BSXA 3EAFA 3OX4A 4PG6A 2IV2X 3PA8A 5D1HA 1BDHA 5D6YA 4DR2B 2XYVA 1Z25A 1FX0B 3I2HA 5KOYA 4JI8B 5KUTA 4MIKA 5EC8A 4GF5A 2JGRA 3MPOA 1SBHA 4I4TF 4EENA 4FHEA 2VJMA 2DHCA 1YI1A 4Q9AA 3N8NA 4ZEXA 2IWRA 5HBGA 4X8LA 3MQFA 4EQ6A 3H2IA 1QYWA 1VI6A 2WM2A 4XPZA 3SXPA 1SFRA 4DXDA 3BTVA 2GN1A 4BAZA 4C5AA 4QLAA 3GA7A 4FGSA 3HY4A 4LDQA 1DEOA 1XMXA 2PMCA 3X2EA 1RI4A 4B79A 2PKRA 2PA0A 2ZDQA 1AK2A 4FI3C 3TBKA 1O3YA 1P1RA 4D92A 4F4HA 4OSEA 3NTRA 4Q93A 4IF6A 4CU2A 1X1QA 1DEHA 4CQMD 2Z04A 4ZTZB 4LOHA 4BNUA 5ELLA 2WD7B 4QBKA 1EZ1A 1FFHA 1QX4A 2KQUA 2AEFA 3ZKAA 3E58A 2Y6VA 1YIDA 2ZRDA 3TK1A 4A2WA 4JJEA 1NYTA 2QD5A 1XWIA 1D6SA 3EN0A 4ZYWA 1EZZA 1JAIA 1SPBS 2CHUA 3FMGA 2Y8EA 1P5ZB 3EBLA 3GN2A 4ARBA 4ENRA 1BDJA 1IDN1 1NT4A 1HMYA 4EF4A 2FF7A 4RKEA 4CLEA 2PGNA 3ZGVA 1GZSA 5F4ZA 2EWMA 3BGIA 4M0FA 5ALXA 3UBTA 1NTRA 1Z62A 1NC1A 3JSAA 5HF9A 2QX9A 3KG2A 3HBMA 1GJRA 3GP5A 3IHWA 4J07A 4RTLA 5DX1A 3O8CA 4BMCA 2VXYA 4IZOA 1ZD3A 4JEUA 4WE3A 3G9UA 1VGVA 3AF5A 4KL8S 3A7EA 1P3Y1 1HT1E 4L8LA 1R6AA 3ZY3A 4PYIA 5EMJA 1GLVA 1C3XA 4J9UE 3AB8A 2G17A 1T36A 1PJ8A 4OBBA 5K0SA 2HJRA 4H6WA 3HN2A 1SC6A 4OIMA 4YRGA 2PZBA 4RO0A 2BMVA 5DGHA 1KL7A 2DHQA 1G5QA 1WDLA 1Z7BA 3JZAA 4A36A 3DAFA 3QMPA 4R1TA 4EG1A 4ND7A 2XBLA 3ZXUB 5AW4A 2H07A 4R1PA 2AV6A 4RVNA 4KLNA 4JLKA 4AP6A 1KVRA 2PZFA 3SR4A 3VDMA 3H1AA 1KGSA 4DMLA 1E3SA 5JSZA 1PQUA 1AKVA 1PP4A 4BRZA 4UUNA 4R71A 1SBQA 1DCFA 4OG2A 4RXUA 3K9GA 4MARA 5E4YA 5EPOA 3CKLA 3W06A 1YE3A 4W5QA 2KMLA 2ZLBA 3DE6X 4BBJA 3AR6A 2UYHA 2W6ID 1QG0A 3G8YA 3QENA 1O7JA 4G37A 4L0MA 4MRVA 2OHFA 1XB2A 2VIIA 3X1ZA 4YMVA 3HR8A 2YZ2A 4K9PA 4R1NA 4RIEA 5HTKA 2Y2VA 3H1FA 1QHYA 1SA0A 3EBOA 2REXB 1I7QB 1X80B 3V42A 1ZI9A 3COVA 3E7PA 4PF1A 4ZCLA 5HIAA 1ZONA 3NRBA 1OC2A 2RAFA 1NF8A 2WHYA 3AESB 1E92A 4ISBA 3BYZA 1T24A 4PQEA 2HHHB 1QYIA 2UZIR 3Q3GE 2HQBA 2DHEA 4X7RA 1UK6A 5CT6A 2WHPB 2ZETA 4JU8A 1CR5A 4A73A 1XJCA 5K5EA 1VJ1A 3KJIA 1JDJA 4HGOA 2EKDA 1BE8A 1OY1A 3PI7A 1KYWA 4YXWA 2I71A 5KAPA 3ZCXA 2A7XA 1FJGB 3CVWA 2ZAOA 1YGYA 2ZIFA 5BPFA 3PXEA 1EK0A 1QV9A 1AMUA 2GB4A 1EFAA 3N7UA 4MTLA 3ZW9A 2OCXA 1DT5A 2PMDA 1YR1A 2WD9A 3ZR4B 1CDZA 3OU7A 1EESA 3GRKA 4OA8A 2VNSA 3D9QX 4L5IA 1JX6A 1T6ZA 5EI5A 2BHNA 4I1OA 1OA1A 4LJ5A 1DVRA 1H3NA 4JR1A 4ER3A 2Z0MA 4BBPA 2HLDD 4Q1AA 1G64A 1BHO1 1NLFA 1FP6A 1KAEA 4TZKA 5CHYA 4EUNA 3ZVNA 4OIFA 4ESHA 2REQB 3IX7A 3K8QA 2EU8A 1BN6A 4MYDA 3RU3A 4OY3A 4RMJA 5SYAA 1MCZA 4WUVA 4ZU1X 2XITA 1IZ7A 2PFSA 5CJJA 3PTZA 4HAOA 3LCJA 4BE4A 5I3ZA 5J4YA 2PU7A 3IPRA 4KLCA 1UJMA 4I9GA 4KKXB 5FLYA 2J87A 1YZLA 2INGX 2ISSD 2XMBA 3LYUA 4NABA 4KITB 1HOTA 3LKBA 4HUTA 1PQPA 3QWHA 1A8SA 3O8BA 3W2TA 4GLFA 1JDPA 2R25B 2RGDA 4IDPA 2COKA 2FG5A 2BHSA 3B2EA 1VIDA 2HMVA 3NGXA 4LTDA 1ECJA 2J5BA 4Y1RB 2O7NA 4F0JA 1KJZA 1OU4A 1JR3A 4IJMA 1TYCA 1U3DA 3NVAA 4GAEA 4B3JA 5A3JA 3HCDA 2P9GA 3E2PA 1GZHB 4Z53A 2RI6A 1WHSB 1IPHA 1TFRA 3KKPA 3QF4B 2QM3A 4XRGA 1O6BA 4NK5A 4LTMA 1ZU5A 4N0PA 3RSZA 1YB4A 2ZPUA 3M3HA 4HF7A 1J2EA 3SBOA 1UZLA 1A5TA 1ID1A 3CINA 1RQGA 4YJ3F 4DCNA 4YAGA 4ZJPA 4KPUB 3PJFA 1KYIA 5CVEA 4H7PA 3EA5A 3PRKE 3OA0A 3NM6B 2WYOA 1Z15A 2W2PA 3M2PA 5E6SB 2ZBEA 4QNRA 1ZVVA 4GMDA 3I8SA 1J21A 4HWKA 3DXYA 2FQ1A 1UDRA 2AUMA 5CK5A 3STXA 3V46A 3WO1A 1SHJA 2B6HA 5EHIA 2F62A 3P0JA 2LKDA 2I8AA 3DZIA 5AM5A 4P9NA 3JRNA 1YXMA 2CXXA 1XHEA 1VE9A 2PS0A 3CRZA 4J0CA 4TLAA 3HB0A 4HJXA 3O3CA 1OHHD 4I36A 2C7RA 4HG2A 4RF4A 3TCXB 2VT7A 1ST2A 3HB7A 4QUGA 2NXEA 4B8WA 4ZOAA 3ZE9A 4DSOA 3LKZA 3BRQA 2V54A 3PUKA 2PMWB 4MS4B 3U7QA 3UJNA 1Y81A 4LWPA 1F6WA 3A9CA 3CNHA 1Q5PA 3NVMB 4R5MA 3SX0A 3NRCA 4LN1A 5ITWA 3TRKA 1AHNA 3G8DA 2QX4A 1IY8A 3OOYA 1H2ZA 2QTLA 2BCEA 3FXAA 3MJDA 2R4QA 3E81A 4BZPA 4Z54A 4MWTA 3MCZA 1Y48E 1ZH4A 4N5MA 4UU1A 4BLWA 3COJA 5EXSA 3UJAA 4BNVA 2LVBA 2HR1A 3NYQA 4LX0A 2AYYA 4N9WA 1R16A 4NYIR 1KDYA 2O5CA 2NT4A 4BVHA 1C0PA 1IATA 2ZT8A 2RGRA 2C2YA 1DKMA 2I03A 5AXDA 3H9CA 5GOZA 1TQ4A 3HDGA 4PHCA 4BQIA 5JH7B 3EEQA 3R6DA 5CGQB 1YMVA 4R2JA 1HUQA 1ZH6A 4BEJA 3MIIA 4BNTA 3W6ZA 2EV9A 3N2KB 1VHQA 1H2EA 4Y2JA 3QV1A 4IUCS 5JO0A 1FIUA 1VIVA 1GGEA 2DWCA 4KGZA 1KYVA 3GLTA 2E89A 3L6OO 4MIYA 3WFJA 1BHQ1 2ZB7A 3RBZA 4DJJA 2PYZA 5HBRA 3OCWA 3K32A 4GM0A 4HZIA 1FTWA 1O9GA 2J9RA 2XDQA 4I4TB 4YS6A 3CTPA 4WJLA 4K6HA 1I5EA 3ZHXA 1QH9A 3QA9A 2IJGX 3PLNA 1DZIA 4B40A 1V95A 2OXIA 1VCHA 1KJWA 1RADA 2PS1A 1RE1A 2A3RA 3K1AA 1Y3DE 3U0VA 2JLCA 1G6HA 1IHPA 1RHUA 1H1TA 2RMKA 4KQJA 3K2EA 3G9QA 4Y9UA 1MZPA 1XZLA 3JW8A 1RCFA 1VKRA 3VYVA 1GSHA 3PHHA 1SIWA 4CJXA 7YASA 3G8BA 2H5EA 4ZWNA 2QB5A 1YC2A 4L4ZA 3LJKA 4IIJF 3U2QA 3PUWA 2DWOA 2M6SA 1E7SA 4U9IS 1XSEA 2AMJA 1IXRC 2FZGA 3B1WA 5ER6A 4D3XA 2C1XA 2A9FA 2IXAA 3FROA 4UEQA 3TI9A 4B17A 2KS6A 3O0DA 4GPEA 4XDYA 2ONZA 1DKPA 3AH8A 5DLYA 5JMPA 3UWPA 4BDTA 3PX2A 3J80A 2IS1A 3EFOB 4OQMA 1Y33E 4UASA 2ZSDA 3OUTA 2CUZA 5KPJA 3AFNA 1PNRA 1YZVA 4BO6A 5E1BA 5C1BA 3OCCA 1DQSA 1CEYA 4WN3A 5A03A 4DNXA 2FOXA 2H5JA 2PKQP 3G2HA 3HZRA 2Q6LA 3C4QA 3OJWA 1RM3A 1VMAA 2VT3A 2NU8A 1V5EA 4HZUB 4XX1A 3CTMA 3VR1A 1DRKA 3SEZA 3MSCA 1QX3A 1OV4A 4KAFA 3AF1A 2I65A 4U7WA 1HLGA 3IQEA 1TX4B 3ZWOA 1KRXA 3G6WA 3OJFA 4ON9A 3FVVA 1KP3A 4KOAA 4PYOA 4TXLA 1H94A 3GZNA 4YK7A 1G0OA 3FI0A 3ZH2A 2B3TA 2PIDA 8LDHA 1Z82A 3H6HA 1O94A 1NP3A 2PXHA 3WKBA 4YMHA 2YUTA 5C80A 2MSWA 2OP0A 3PITA 1TO2E 2ZSUA 2VNAA 3IBYA 3P4UA 4XQ9A 1ZMRA 4X41A 5KJFA 1GTSA 1VRCA 1VJ5A 4R40A 1KK1A 3ZCPA 3KOMA 3W9SA 1NMEA 2X9QA 4OO3A 1J6UA 1E96A 4X61A 3U9SA 3H7AA 3CX8A 4EG0A 5DGXA 1UMBB 2AKAB 2IU4A 4IVPA 1YKSA 4GLJA 4ZCQA 5A2GA 3NHBA 1D1SA 1M5UA 1K7YA 1KDRA 1XRNA 4MO2A 1M2HA 1PR2A 1SVKA 3U1TA 3VPXA 4BVBA 1PWYE 3OPYA 4UHJA 3HM2A 4HEA6 1NQVA 3JS5A 3F9IA 3LYLA 1TC2A 4LWZA 3DMHA 1Z29A 4W7IA 5KDOA 4DZRA 2Q0SA 2PWBA 4KYTA 1GFSA 4WINA 3M4JA 4OJYA 2Q5JA 1X9GA 1FNCA 3IPYA 4HXGA 4B80A 2OGWA 1XJ5A 3TAHA 2BV3A 1W7AA 1JXOA 2C7VA 3NWOA 3OJLA 3PYMA 5KYUB 1U3GA 1H4TA 3LP5A 2GILA 2ZJ8A 1ONSA 2OY0A 4MV7A 2J85A 4EDHA 3BIJA 2QJOA 5LP1A 1NNLA 4CMEA 1V4BA 1XELA 4TV9A 1O94C 1XEXA 3F6PA 3MJHA 1WSBA 3QWIA 1WU7A 3PSHA 2OC9A 5JEEA 1FJXA 1I4OA 2B5OA 3RC9A 1G5IA 1QHGA 3LVFO 5FA6A 4LJSA 4XXHA 3V33A 4H7HA 4PNPA 4Y2TA 5DNVA 2Q1TA 2HBYA 4IDGA 4Q4AA 3KR2A 5DP1A 3DFIA 2FFBA 3GEEA 2PBLA 4UAGA 3KKQA 2QI9C 2DF8A 4QUEA 1BE6A 1GNLA 1F8YA 1TK3A 4DBZA 1ZLYA 4TYWA 1Z5VA 1CS0B 1QOQB 3ECCA 2JLRA 3TNJA 4CTKA 4ZMBA 2I34A 1MLDA 4KTTE 1ISHA 1RMYA 4DV0B 4J0FA 3T5TA 1G3UA 3LQFA 4H59A 1MC1A 1P2FA 3I01M 2FRVA 1EB9A 1YRQA 3IERA 3U7EB 4IUDS 5FWDA 4OKSA 1QU2A 2JLBA 3P0EA 3UAVA 3UJBA 3RYIB 1O57A 3SR3A 1R00A 2O1WA 5H3HA 4IZIA 5FHQA 2ZYWX 1PDWA 2GZDA 2W6NA 4CKYA 1EX7A 5KINB 4NVRA 2Q46A 1IQ0A 3E84A 4NMHA 2X4LA 1G7RA 4PR0A 5DTJA 3FVQA 4TL9A 5KYVA 3WHLA 2DEUA 4L9WA 2PRSA 4MCHA 1Z4JA 1GQYA 1T5LA 3KXLA 2O0JA 5LXTA 5HZKA 4HQRA 1WW3A 3MQ4A 1OT3A 1OI3A 2FCAA 1NW3A 3Q0TA 4NYJR 4URHA 4MGZR 4YJ3B 1DBWA 5HDQA 5A3RA 2WAXA 4GWKA 1XZDA 3LC2O 3OQIB 1QBKC 4JNCA 4OXXA 2GJAA 2YHIA 5C7IO 2GQ0A 2XQJA 3HO1A 4RD1A 1QF6A 4MEBA 5AVZA 4CKXA 5B7NA 1PIWA 1CRPA 4BNIA 3EK2A 2A4MA 2BGNA 3TFWA 3MN1A 2C4KA 3KQPA 1WZNA 1P1KA 2CFCA 3RRZA 1Y3HA 4P7FA 1A27A 3SZGA 2ETVA 5DBHX 2QRVB 2EFJA 3IP6A 2C3MA 2H1OA 1JE0A 3PHBE 3SJZA 5EJ9A 3NMUF 3K05A 3UMBA 3AUTA 3URMA 3SSMA 1JXQA 3SBEA 3PFNA 4J03A 4NYMQ 1R50A 3CW2A 1XMVA 4ZARA 4RVCA 4Q34A 3A6ZA 2VZ8A 1RWNA 4GPD1 4NENA 2XNDD 5A6SB 5AOBA 1PJQA 2BY4A 2F9MA 4U6QA 5DHPA 2I6XA 2OXRA 3THWA 2V8BA 1G55A 2OCIA 4N1AA 4PPFA 2Z58A 2VAVA 3MOSA 3LK6A 1S9DA 1ZK3A 3ORYA 1YUMA 3PTAA 1X8LA 1GV1A 1L4EA 3W2EA 1XZAA 1G7SA 3BREA 3NHAA 3PICA 1RSZA 1II0A 2D7JA 2GKSA 2H1CA 3KYIB 4LC1A 4RYDA 1FP4A 3U26A 4KC0A 4ARZA 4D6PA 1X1TA 2TYSB 4BN5A 3HVIA 1ZJYA 2OZPA 3E22A 3T9AA 5KNBA 5KNLA 5LQAA 1TK9A 2OBLA 3UPTA 4QUBA 2Z1MA 1GNVA 1LBEA 1RRVA 2G5TA 2I2AA 2PUHA 1NMSA 2GF9A 3EUWA 3FH0A 3QGMA 3EGXB 3QY9A 1E4OA 4PVCA 4C0KA 1NMQA 3C41J 1A98A 1W6UA 1KDOA 2WTBA 1T2NA 1TYBE 3DZ8A 2ODAA 1SO8A 5C4GB 2B98A 3THYB 2XQFA 2ZJBA 4G8BA 1ENYA 2Q1WA 3NTQA 4KR0A 4XSGA 5FTWA 1KO8A 3RUFA 2H7YA 3SYLA 2IIPA 1IEXA 1NI4B 1VHTA 3DEHA 4K6FA 4Q24A 2QRZA 4F9GA 3E18A 3H5AA 3GLGB 3ZUPA 1PX0A 2FU5C 4PLHA 4WOKA 5IJAA 3RAGA 1C9DB 3SXJA 1Q44A 2CVFA 1TEVA 1J22A 2C9MA 2R5FA 3DH0A 3G8AA 3GN1A 2OHXA 3DNMA 3L6BA 3MF4A 1JP7A 1KKLA 1S7CA 1YFKA 3Q11A 1P4AA 2VHVA 4RHYA 3GCWA 1N8KA 1EJ2A 2JPDA 1W35A 1THGA 3CMCO 4AICA 1AOXA 1H6BA 1A9XB 2ZSBA 1LTQA 4C0XA 1QDEA 1D6MA 1UP6A 3WMRA 3M5WA 3Q4GA 4LYJA 4MRMA 5ITVA 1QXSA 5JADA 1VYUA 3CFYA 1WL8A 2A35A 5ALWA 1Z45A 5ITSA 2JEYA 4NQRA 4BUCA 3WB0A 1CUHA 1ETHA 4WVFA 1Q1NA 2B1GA 1E3EA 3VDXA 4E70A 4EVSA 5D7BA 2J0VA 3HQ4O 1U6JA 4PANA 4Q01A 4QDKA 4Q9KA 4IIJB 1ONBA 1E6WA 4H3HB 3TTWA 1SHTX 2IYSA 2D5IA 3H19A 4BP9A 3FWHA 1XTIA 1Q95A 1BKYA 4HWOA 3WE7A 1JJFA 1ECCA 2XTJA 3MAAC 1F4PA 2FUG6 1YR3A 2GAOA 3JTEA 1QU3A 5LMNB 5A1JA 2OAEA 4CM3A 5HNKA 1LSSA 3TAXA 2E82A 4JB8A 1NJGA 4NBVA 4LJ7A 1IUNA 1Z4QA 4MKFA 1X2EA 1U7OA 1YRLA 4B3BA 2P4HX 3DDCA 4MQEA 2HW8A 1UBKS 3KZCA 2VYCA 4QHTA 2DY1A 4YRDA 3FSEA 4AXXA 2JDIA 4NFLA 2WHEA 4JBXA 3IA7A 2QKYA 4PONA 2CT8A 2BP7A 3C1AA 4XIJA 4DLYA 5EJFA 2UYGA 1YRHA 2D6FA 2BE7A 2KB0A 1NVXQ 1JHYA 2V5AA 3GPCA 4QDOA 2FUG1 1CNFA 3RSFA 3WX0A 4E1BA 1GG8A 5BY2A 5IUJC 4DQ0A 1P3DA 2GHIA 4U63A 3BMNB 1QCZA 4WV3A 2VHJA 2UZ3A 3DP9A 4YCSA 1J8YF 4JC4A 1XE3A 5FOWA 5H16A 3WMGA 1NLYA 3GJ4A 4RMIA 4X1IB 2X22A 5FWAA 3T9BA 1LPBB 1L6RA 4UBIA 1DEKA 3W3AH 2GVZC 3BK2A 3R2JA 1YBMA 5F1YA 3JQGA 4L4SA 3KPYA 4A0QA 5DHUA 5FO0A 4HVLA 2CCKA 5JZVA 4TWBA 4MW9A 1M2JA 4BNDB 4X91A 1L5QA 4LW8A 1BOOA 3N59A 2H0QA 4OOFA 3RT9A 1Y1KE 1I94B 1GXSB 1IHUA 1PGJA 3BJZA 5DK4A 1Q91A 3HA5A 5LYYA 2L82A 5FH9A 3B53X 4MW7A 4IS2A 4M3NA 4XIYA 1TD9A 4EX7A 2G1PA 3UCFA 3W5VA 1V25A 4QREA 4JI7B 2GF2A 3MLEA 1FXWA 3G85A 4RD6A 2VDUE 4WZ6A 3TS1A 2ZZNA 5K0LA 4B71A 2CD9A 2W70A 1D2CA 1OW3B 1ZNQO 3HBJA 1QYDA 2I2WA 5CCBA 1U9ZA 1OBCA 2A30A 3NAQA 2EERA 3PQ7A 1U7TA 3R6GA 4FYWA 4MOWA 4OMCA 2Q5LA 4NE9A 6YASA 2EP7A 5I4KA 1F0NA 4ARSA 2CSXA 2CV0A 2I87A 3AV0B 4BQOA 3MWDB 2FMKA 1XNRB 4UEWA 2UXCB 3FI9A 4RA9B 4E3ZA 4IINA 1YK0A 4CF3A 1IVYA 1DAMA 3CCBA 3O9VA 4HQ6A 1F17A 3I64A 2QYHA 3S3TA 1TVKA 5CB6A 1GG2A 4GPIB 2G72A 3EW9A 3FRJA 4DBLC 2YUIA 3O2QB 1N8SA 2RHRA 2GZAA 3GJ5A 3L05A 4QBTA 1SKUA 2ENWA 4N41A 4CF4A 1JG4A 1U5AA 2QJFA 2CFIA 1MJFA 4BP3A 3H1BA 3KCNA 1ZEJA 1EFVB 1SRRA 3GEDA 5JZOA 3MNFA 1YFLA 6PFKA 2I9KA 2QRLA 2YVKA 3KTOA 1XLWA 1YL7A 3LT1A 2PUCA 1EGVB 4MJ7A 3H3XA 2Q3FA 2QG4A 4KTVE 4RHFA 4C01A 4E51A 1DXHA 1SU6A 1C1DA 2YMPA 2ZBPA 3QPCA 4PGGA 4RM2A 2HOQA 5TS3A 2PDAA 4AUMA 2VSQA 4B9EA 4IH9A 1G8FA 3AEQB 4AJ1A 2IPNA 4YMTA 2EFEB 3OLXA 2VAXA 5JSYA 1W87A 4XGNA 4BLQA 4F3KA 3WLPA 3DEYX 2NQ2C 2FZVA 3ANLA 3BJEA 1JAYA 1VKHA 3HXLA 1A2KC 3L7NA 5JXJA 2YHUA 2EFYA 3E27A 3COPA 1F20A 4ZT7A 3RJTA 1WTCA 3CLRC 1K6MA 1R7RA 1JSRA 3SDBA 3OJEA 2WG2A 3CLSD 4Y18A 3VR5D 3E8XA 1H3FA 4HEJA 4RUKA 2ECQA 2I54A 2IL1A 2YBEA 2YIVX 4LDZA 5AR1A 3V1YA 2HHLA 2E7ZA 3C5EA 4LWOA 1JECA 3U7IA 5JWRA 1BKDR 4I1YA 5CIWA 5B12A 4GUDA 2G3YA 2I4MA 2D0OB 3LTEA 1CZKA 3AJRA 4AIRA 4ZHQA 1GAWA 1FFEA 3IALA 4IIUA 4DWOA 5JSUA 3DE5X 3LSTA 3W6PA 3SIRA 4D9IA 4EJSA 2QR3A 2DSNA 4OU4A 4MCJA 5U4QA 4WLEA 3UT5B 2Q9AA 3LQ4A 2XKJE 2X8JA 3Q9UA 2ZUDA 5FPYA 5LLDA 3LT0A 2X5OA 3VOTA 4B6RA 2BWJA 3QQ8A 4K9SA 3CISA 3UWSA 1E98A 1LBSA 1W2WB 1UZUA 2E3JA 2JFPA 3DB2A 5CXUA 5FWYA 2CBGA 4HX2A 3WWYA 3DDWA 3W04A 2V6BA 1IY9A 2CDBA 3LPNA 2LNDA 3TLJA 1IG3A 1HURA 1L4LA 3NJ8A 1DXQA 3D3NA 4HFNA 5CT9A 4C87A 4RVDA 5DH9A 2HRCA 4DA4A 1KWGA 5DLDA 4X60A 3DUFA 1BG6A 4ENQA 1GAXA 4DMUB 2PMKA 4MLPA 3H9EO 1GIAA 3PUYA 1Y0BA 1O2DA 2ALJA 2BKUA 2CLCX 2UYYA 1G3RA 3PGA1 4JJZA 2Y77A 3A3KA 4UEOA 2P35A 5AKLA 4J43A 1W88A 3VPDA 3ZGZA 2X0KA 4MWCA 4E4RA 3ZLJA 1EQUA 1QZ3A 2WWXA 4PWZA 3SE0A 1Z6PA 1LBIA 2ZU6A 2X77A 4HSEA 1B2RA 3ZHUA 1VHWA 3NM4A 4TQGA 1IUOA 3B1ZA 1DARA 3CGGA 4Q3BA 2JFBA 2W2NA 4BJ1A 1LH0A 5EHNA 1QG2A 3TOVA 2H4FA 5JARA 4URWR 3RROA 2KYRA 3AGQA 3I5YA 2AZMA 3HCFA 1EHYA 1UT8A 4C4SA 5TQJA 3F74A 1XHFA 2IXFA 3U44B 1L5OA 2ZYUX 4DIFA 1DV2A 1X77A 2OMEA 3UJCA 4JOSA 3IV9A 4HPJB 4FP9A 3AT1A 3FMPB 1YTUA 1VPLA 4TMXA 5I7SA 3GT3A 4Q9HA 5KQPA 2FPIA 1RI1A 1V4VA 1M54A 2Q3HA 1DG1G 3ADOA 2UYQA 3HL4A 4Y30A 2YV5A 2HLNA 4PHGA 2PSEA 1ZEMA 2I3AA 3VR2A 3L7OA 5KYYA 3COYA 2Y66A 3IT0A 1SA0B 5HOQA 1G8KA 5C52B 1FY2A 3T7CA 3QVMA 3WZMA 2N9UA 4YLGA 4MR7A 2IYZA 4P83A 4ER7A 1M3SA 1WXWA 2AMYA 2L0XA 4JJAA 4ZVQA 5JMTA 1CJCA 2V7UA 5E9WA 4BJHB 1DFGA 4XDHA 3EXHA 3DYVA 4UEKA 4IOMA 1E8DA 1B00A 1LPAB 2PLAA 2OSVA 4N3GA 4LRTB 4ENSA 3VNUA 2B2NA 3O91A 2O07A 5ARCA 2DTXA 1EK6A 1RLJA 3IOMA 3A4NA 3MWLA 3LDGA 8GPBA 3DQPA 2HJVA 2HA0A 4ZTUB 1USIA 5F76A 1U0RA 2ZXFA 3RUAA 1KVSA 4DLUA 2BHLA 2GCGA 3L1KA 5ELMA 2C84A 3N75A 4IEEA 3X1WA 2FP3A 3DCIA 3D0RA 4QRDA 1U65A 1A4IA 4KAAA 4D3FA 2EEZA 1FYEA 3H65A 4KV7A 4URVR 5UKDA 3O93A 3QE0A 4ZT2A 3VC2A 4RHCA 3MHPA 2YWHA 1VKNA 3AHJA 5AJVB 3AF2A 2QN8A 4BKQA 5LMZA 3SJCA 2C7PA 4BMZA 2RAUA 1Z2CA 3KJNA 1NBIA 4M1QA 3CXUA 5ES4B 5JHGB 2QR2A 4PZYA 1P61B 2CF5A 2BTQA 4A8TA 5AI4A 4CDNA 3WWZA 3EPRA 4WKCA 5B2ZA 1NUHA 2AJBA 2CDNA 2UKDA 3NHMA 3WMFA 1I7LA 3ZGOA 4IIVA 1AUOA 5AD1A 1TEZA 3QVOA 1X1BA 5BRNA 1NW4A 4AJEA 2D5LA 2QNBA 2BCJQ 3JWEA 1DX9A 1O5TA 1TZ2A 3WGUA 3K1YA 2GWHA 1KNQA 3VZSA 1Q11A 1WBDA 1ACLA 1YUNA 4GQAA 3SCZA 1E9AA 3AVTA 5B37A 1RYNA 1SCJA 3HY3A 2GAJA 3Q98A 4MDYA 1ZJWA 3EDMA 2CSUA 2C5FA 3QBJA 5CDFE 1QQ5A 3DT8A 4WLFA 1N0HA 3U3JA 5LXTF 1DMRA 1C30A 5AXCA 2B61A 1EVEA 4XW2A 1EVQA 1HY3A 1O8BA 4ZZ3A 1VHLA 4Q3DA 1AQNA 3KVYA 4MVJE 4LK2A 1XQ6A 2FW6A 1CR0A 5BW4A 4TTQA 4LZPA 2O4UX 4O4LB 4L7QA 4G8JA 4UM8B 1HFWA 5JRDS 5KJ6A 5KNDD 2WM3A