1O54A

Crystal structure of sam-dependent o-methyltransferase (tm0748) from thermotoga maritima at 1.65 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
266
structure length
265
Chain Sequence
HHHVGKVADTLKPGDRVLLSFEDESEFLVDLEKDKKLHTHLGIIDLNEVFEKGPGEIIRTSAGKKGYILIPSLIDEIMNMKRTQIVYPKDSSFIAMMLDVKEGDRIIDTGVGSGAMCAVLARAVGSSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEGFDEKDVDALFLDVPDPWNYIDKCWEALKGGGRFATVCPTTNQVQETLKKLQELPFIRIEVWESLFRPYKPVPERLRPVDRMVAHTAYMIFATKVCRREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent O-methyltransferase
publication title Crystal structure of SAM-dependent O-methyltransferase (TM0748) from Thermotoga maritima at 1.65 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 79
structure length 265
sequence length 266
ec nomenclature ec 2.1.1.-:
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1o54A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1o54A02
3OU7A 3HM2A 4UOEA 4RTQA 3DMFA 2HWKA 5EHIA 2YXLA 4YUWA 1YB2A 2YXEA 3B3JA 1JQDA 3GU3A 3JWGA 3TFWA 5K05A 5H02A 5E9QA 3LGAA 1XJ5A 2WA2A 3GNLA 2G1PA 4BLVA 2HR1A 5LQJA 4RTMA 2XVMA 1R74A 5EEGA 2G8NA 3VC2A 1ORIA 1YZHA 1AQJA 1R8YA 1X1BA 3HVJA 4GBED 4DZRA 4YUXA 5BXYA 4QDJA 3P8ZA 5KVAA 1M6EX 3TLJA 2IBTA 2XYQA 5E9JA 2YVLA 3DUWA 3P97A 2PT9A 4RSRA 1PRYA 3UA3A 5ICGA 3BUSA 5K0EA 1R18A 3IV6A 4RVFA 3PB3A 5LSAA 5FHQA 3HCCA 1ZHFA 3BWYA 2PX5A 3CJQA 4CKCA 5EIFA 3ORHA 5CD1A 2GLUA 3OU6A 4EK9A 2VZ9A 2AVNA 3BWCA 2R6ZA 1ORHA 4RTRA 2AOTB 3FZGA 1PJZA 2OBFA 2HNKA 2QRVA 5T64A 2CWWA 4Z2YA 1SQFA 2V7EA 4PYOA 3SSOA 3HCEA 1EAMA 1ZKDA 1D2HA 2AOUA 4DCGA 3UJ7A 3EEOA 4PGGA 4R8RA 2BR4A 1JQEA 3HA7A 3THSA 1RI2A 5EC8A 2AS0A 2GB4A 3KQYA 3FTDA 3NTVA 2PWPA 2YUIA 4CTJA 5KS2A 5EHGA 3OE4A 4P7FA 5HIIA 1U2ZA 1T43A 3DLIA 3ME5A 4X63A 3SSNA 1DCTA 3KQQA 1XDZA 3DR5A 5FTWA 2PKWA 3FRIA 3FUVA 3ER9A 1N7JA 1SQGA 3BXOA 4QTTB 1NW8A 3ID6C 4POOA 3EEYA 1JTFA 4BY9E 2AZTA 4DQ0A 3A26A 3PTAA 2P1DA 2UYQA 3BWMA 4YMHA 2BR5A 2B2CA 3E23A 4E2YA 3P2KA 4ER5A 4E30A 2OXTA 4V0RA 4FR0A 3KR1A 2PXXA 4X60A 3UBTA 3EVFA 4GOMD 3SMQA 1SUIA 1SUSA 4P58A 3SGLA 1V39A 3G2PA 1P91A 2OZVA 5CIYA 2PSSA 4RTJA 1M6YA 3GRRA 3HVHA 4PYMA 2ZBQA 5K03A 2NP7A 5FCDA 2G71A 4QQKA 2EG5A 3P9IA 3G8BA 1G8SA 4FP9A 4QPPA 4QQNA 4FS8A 4GUAA 2K4MA 3BGIA 5EMKA 5F2OA 3QOWA 2ZLBA 5HOQA 9MHTA 3SR4A 5FA5A 1YFLA 2GPYA 3B3GA 5HIKA 4KW7A 2JHPA 5CVEA 3TKYA 1Y8CA 5D1HA 1JQ3A 1TPYA 3C3PA 4FSXA 4FSDA 4YV2A 2NXNA 3LBYA 1QAMA 3FTFA 3PFGA 2AOTA 4KWCA 1WZNA 4IV0A 1KR5A 4GF5A 1YUBA 1IY9A 1KPIA 4DKJA 2P3QA 2B78A 2EX4A 4GQBA 4QDKA 5EMLA 5KQSA 4CXMA 2YR0A 4EQZA 5K0JA 1WY7A 5M5BA 2ONYA 3GGDA 2Z6AA 1ZGJA 2HMYB 4OQDA 3PX2A 3AXSA 5E2AA 4JXJA 4R6XA 3EVAA 5CVJA 5EZQA 1EJ6A 3LX6A 5E1BA 2BM8A 2BM9A 4KIFA 4GEKA 1RJGA 3UA4A 3EVBA 2O05A 3O7WA 1KXZA 3Q7EA 5DSXA 4PNEA 5K0LA 5GOZA 3FTEA 2AOWA 5F2KA 3T7TA 1XCJA 3MHTA 2P41A 4DF3A 2OKCA 2PGXA 2C7OA 3R6TA 1JTEA 3CJRA 4C04A 4DM3A 5GIPE 4ISCA 1DUSA 3DMHA 1KHHA 3KQPA 3SM3A 3DP7A 3EPPA 3HCFA 5DPMA 4KRGA 4PCLA 3GXOA 1RJEA 3HA3A 5MHTA 4GOND 3MCTA 3P9KA 2P35A 5EMMA 2EFJA 4LECA 5DRTA 4GC9A 3BGDA 4YMGA 4E2ZA 1F38A 3MTEA 4ER0A 5DXJA 2XVAA 4EKIA 5LQAA 2UYHA 1ZQ9A 3DLCA 1G38A 3M6VA 2ZVJA 5DSTA 3I9FA 5FULA 2XBMA 1L3CA 3EVCA 5U4XA 1RI4A 1XTPA 3BKWA 3GRZA 3GRVA 1NBHA 2BR3A 1O54A 3G2MA 2QE6A 5C1IA 2ZW9A 4X41A 3QV2A 3SSMA 4CKEA 2WA1A 1UFKA 2ZCJA 3O31A 2PWYA 3F4KA 3FPFA 1I1NA 3OCJA 4QVKA 5ICEA 2IH4A 1MJFA 2VDWA 3DOUA 3KQMA 1VLMA 3IEIA 5JUWA 2FRXA 1N2XA 1VL5A 3EGIA 4O29A 2O0LA 2YX1A 1NE2A 3A4TA 3LDFA 5CUQA 1RI5A 1EQAA 2DULA 3HTXA 1XVAA 5HIMA 4LWOA 4RTLA 4PYNA 4PCAA 3ELDA 3TPZA 3ELYA 5CVUA 4PINA 1YF3A 5GM1A 2ZIFA 3ERCA 2AN3A 3TQSA 3KPWA 3I53A 4OA5A 5DTRA 4GC5A 3KPJA 4OBWA 2OYRA 3KR2A 3LCUA 2BH2A 5FQNA 2P8JA 2IFTA 5EOVA 5BW5A 4MIKA 2Y1XA 3I5UA 3LDUA 3NDJA 5IKMA 3CBGA 3D2LA 3NWEA 4PYIA 5EEHA 2AN4A 4KDRA 5E1MA 5GM2A 2QM3A 5DTMA 3DXZA 1NKVA 4R05A 3UWPA 4E2WA 2ERCA 3GRUA 3BWBA 4HSGA 2P40A 5DX1A 2IIPA 3TM4A 2UZ4A 3QOXA 5BW4A 4HGZA 4QTUB 3FUUA 3ELUA 4AUKA 2CL5A 2ADMA 5HFJA 2HV9A 3UJCA 3KQOA 3G7UA 3EVGA 4FT2A 5DM1A 4PONA 3BKXA 4HGYA 1Q0SA 4PYQA 2ZZKA 2IP2A 3A25A 3G88A 5GIOE 3FPEA 2YXDA 3KQVA 5K0FA 5GINE 3GWZA 5ERGB 1G8AA 3DTNA 5FHRA 4AZTA 4YV1A 5B1SA 1FJXA 3RW9A 3AWIA 2GH1A 5JR3A 2NYUA 5LQNA 1DL5A 1D2GA 1TW3A 3AJDA 4XUDA 4KIGA 3PVCA 1I4WA 3OU2A 4U7TB 3SX0A 2PJDA 2ZBPA 3HCDA 4PYKA 1AQIA 4RV9A 5CVDA 5EZSA 4LWPA 5FWDA 3JWIA 4M36A 4DMGA 4Y30A 5K0CA 3A7EA 4XCXA 3LDGA 4C06A 4NECA 3I64A 4YUZA 4WXHA 4ER6A 3JWHA 5HEKA 1G60A 1TW2A 4E33A 5BP7A 4RTPA 1X1DA 3OPNA 5LR6A 3C0KA 3LBFA 3PFHA 3TOSA 3PLAE 2PLWA 3A7DA 3KQTA 4MTLA 4RYLA 3U81A 3BZBA 3B3FA 4AX8A 4P7JA 5LQCA 5EVJA 4BP1A 2JHCA 4RWZA 4E70A 2JHAA 4F85A 4PYLA 1JSXA 4F84A 2IDJA 2ZTHA 3ANXA 3GDHA 5HIJA 4AZWA 2OB2A 5E9WA 3DULA 1R8XA 2HTEA 3V8VA 4YUVA 2Z6QA 2JJQA 2EJUA 3CCFA 3G89A 1L3BA 4Y2HA 4PYJA 3TM5A 3P2IA 2NXJA 3EVDA 2ESRA 3R3HA 4P7KA 2JH8A 3K6RA 2G72A 3E05A 4E31A 5DM2A 3B89A 5DM0A 1JG4A 1P1CA 1FP1D 2PT6A 2ZBRA 3JWJA 5ICCA 3EGVA 2OPBA 3E8SA 3KR0A 2FPOA 2P3LA 1QZZA 1VIDA 3TMAA 4C08A 4MHTA 1KYWA 1VQ1A 2OB1A 3MQ2A 1YZ3A 3UJ9A 3DMGA 4XUCA 4PWYA 3KKZA 2H11A 5C0OE 1QAQA 5K0BA 2ZZMA 4FT4A 3UJDA 4C4AA 3GCZA 2CMGA 5KYGA 4CTKA 1XCLA 5CCXA 2P7IA 3HEMA 3LL7A 4GOOD 5DWQA 2ZZNA 1FPQA 5T6BA 3REOA 3ER8A 2C7RA 1RI1A 1SG9A 3FRHA 5DM4A 5T67A 3PS9A 3MTIA 4B17A 3EGEA 4HH4A 4E2XA 4X1OA 2Q41A 2CMHA 3KQSA 3LECA 5E8JA 3TKAA 4R8SA 2E5WA 1P1BA 2B9EA 2CKDA 1ZG3A 5DTQA 2FHPA 3KU1A 4XUEA 5D1NA 1SKMA 1RJFA 2FCAA 1KP9A 1HNNA 1JSZA 1NBIA 5K01A 3OE5A 1JG1A 2I7CA 4U7PB 2PY6A 4ZTBA 5E2BA 3SVZA 1IM8A 3LKDA 4OX9Y 4EKGA 2PXAA 3RODA 2I9KA 1XDUA 4EVIA 1X1CA 3LSTA 4AZVA 4E32A 3HP7A 1X1AA 2AR0A 2XYVA 1NV8A 1QANA 3GJYA 3UZUA 4RX1A 4IV8A 1HMYA 2AOXA 2NXCA 4C05A 4M7RA 5HZMA 1BHJA 3T0IA 3UFBA 2B25A 3P71T 4YV0A 1BKYA 1Q0TA 3M33A 4M38A 3C6KA 3MAGA 4HRAA 3S68A 4PIPA 4ER7A 2DPMA 3CJTA 1R00A 3DH0A 1NW7A 3IYLW 1ZGAA 5EMJA 3UJAA 1VP9A 1O9GA 3X0DA 3DXYA 3EVEA 2YTZA 3HCBA 2ZSUA 1INLA 3FPJA 3KQWA 5EKUA 1D2CA 1O9HA 3OFJA 3KHKA 5DT2A 3GO4A 3LPMA 2B3TA 3WSTA 3R24A 2XYRA 3B7PA 2O07A 1MHTA 4QVGA 3OFKA 3EVZA 3C6MA 3FYDA 3M6WA 2Z6UA 3ELWA 3RIEA 5EQJB 4BP3A 1G55A 2ZIGA 1EJ0A 3C3YA 5CCBA 5IH3A 3CKKA 1I9GA 4ER3A 1QYRA 2I6GA 2KW5A 4OBXA 1JG3A 5G02A 3AXTA 3BGVA 5E1OA 2O06A 1B42A 3G2OA 3FPGA 2NNWB 3O4FA 3IHTA 3PT9A 3VC1A 4F86A 1KIAA 3G5TA 2GA9A 4HTFB 1R6AA 1RI3A 2AOVA 4KVZA 4RTOA 1KPHA 4QPNA 3THRA 2C7PA 4MWZA 3FUXA 3HCAA 5EPEA 1JR4A 3P2EA 5GWXA 2A14A 2JG3A 1AF7A 3KPUA 3HA5A 4LG1A 4C07A 1X19A 5DRYA 2UYCA 2VDUE 3EMBA 5HILA 2BZGA 3FUTA 3UJ8A 4IKPA 2IBSA 1KYZA 3A27A 1FP2A 2IH2A 3I58A 4X61A 4ATNA 3M70A 2OO3A 3NMUF 2Y1WA 3AY0A 2PVCA 3GRYA 3NJRA 1VP3A 1F3LA 2H1RA 2YQZA 3EMDA 3LCVB 4FZVA 2PX4A 3NW9A 4WVLA 3P9NA 2NXEA 2GS9A 3M6XA 4RTNA 1VPTA 1WXXA 1XXLA 2AN5A 4HC4A 2ORED 3FUWA 1BC5A 3MERA 4IWNA 2AVDA 4RVGA 4CKBA 4YUYA 2H00A 3NVMB 3UJ6A 3LKZA 3TRKA 1G6Q1 8MHTA 2VDVE 3FTCA 3M4XA 4R6WA 5FADA 2ONZA 3LCCA 3VYWA 4GOLD 5GP1A 3NWBA 2ZULA 1P39A 5FA8A 3G8AA 3NDIA 4V0QA 5EGSA 1WXWA 3CGGA 5CM2Z 2ZFUA 4M37A 3HVIA 2ZIEA 1WG8A 3R0QA 5EIWA 5ICFA 3KR9A 1EIZA 2ZWVA 2PV0A 4KDCA 4A6DA 2R3SA 1JG2A 1VE3A 5FQOA 4RTSA 1UIRA 4RTKA 1NW3A 1L3IA 5F2NA 5K0GA 2VP3A 4RVHA 1AV6A 3P9CA 1VBFA 3LHDA 3DXXA 1M0EA 1SVUA 2JH9A 1FBNA 1NV9A 2UYOA 3CC8A 2VS1A 2G70A 2PX2A 4C03A 3Q87B 4OQEA 4BLWA 4HG2A 3HNRA 2QYOA 5FUBA 3G5LA 4HTFA 4CWAA 5E8RA 1N7IA 3G2QA 5EG5A 5EKXA 5K0NA 2FYTA 3M6UA 2IGTA 2O57A 3MGGA 3T7RA 2NP6A 2F8LA 3OZSA 1IXKA 3FYCA 1QAOA 2PBFA 1YFJA 5FWAA 2P7HA 1H1DA 2QY6A 7MHTA 3GIWA 1L9KA 4OA8A 3MCZA 3UJBA 3H2BA 3KPVA 5KQRA 1UWVA 4PIMA 3V97A 2QRVB 5LQKA 3B5IA 3HVKA 3FPHA 2PXCA 2OY0A 1OR8A 2FK7A 3L8DA 5E1DA 2C7QA 3SXJA 2AOUB 2I62A 5LQRA 1L1EA 10MHA 3VSEA 3PX3A 2GAFA 4RVDA 1NW5A 2FK8A 3MB5A 4MQ4A 4P7GA 1RJDA 4A6EA 5C9ZA 2EJTA 2PX8A 1Z3CA 1BOOA 5P8WA 3OZRA 3KPYA 3OZTA 5K8VA 1KPGA 5CVVA 3NVKI 1NW6A 1WS6A 4FGZA 4L7VA 2IPXA 5DX0A 3T7SA 4AZSA 4BLUA 3BT7A 3R9XB 4DCMA 2P3OA 2IH5A 1EG2A 2N47A 2WK1A 4EMSA 5LQUA 3E7PA 1XDSA 2V74B 1NT2A 4K6MA 4PGHA 5DXAA 5DX8A 3K0BA 5K09A 2IDKA 3TR6A 2LD4A 4H0NA 4DA4A 2ZWAA 3CVOA 4G56A 5DLYA
chains in the Genus database with same CATH superfamily
2EFDB 1S8NA 1ZVQA 3DEFA 4NZYA 3VR2A 3V34A 3VV2A 3U5ZB 2E21A 2JIOA 1CYDA 2YXLA 4MR8B 5D2CA 3ZY2A 4ASUA 4BZZA 5LYJB 3O1IC 4KEAA 4TMWA 4R2JA 5B3KA 4KIJA 1JIJA 1H6BA 3DBHA 4KV7A 4MYCA 4ZEOA 2WUWE 4CDGA 3TLKA 2O5VA 4AO8A 1L5HB 3HVJA 1NUSA 2J32A 2RC6A 2WG0A 4BXOA 3ORYA 2UUPA 2D7JA 2IBTA 1RXYA 4OBEA 4RSRA 2LUOA 3F8WA 3I9MA 1ZCFA 3IDOA 1Z22A 4X0EA 3WLQA 1FDOA 2B8NA 2QN9A 1Z0JA 2WT9A 4AY2A 4J49A 3FI0A 1DXOA 1RPAA 1E8MA 1T1SA 2QLFA 5FRDA 3VDRA 1Z7BA 4K2AA 1N2ZA 5I9SA 4WNAB 2RARA 2QRVA 1IQPA 1T1JA 3NEAA 3CVUA 2BI7A 4RW0A 3EH2A 4QOEA 4E4RA 3M6AA 5L3ZA 1JU3A 1K6JA 1VB5A 4JP2A 1Z2DA 1XD9A 3D4BA 1KEKA 4EP1A 3BXXA 1QFJA 4L5JA 4TYPA 1V6AA 5BSUA 4BS9A 2CMKA 5BR8B 4EPTA 4MCAA 5IH7A 2RJ3A 2JK1A 4B40A 3TI7A 3ZZNA 3O91A 4FGUA 3TDNA 3DT6A 5H3LA 1U6KA 4QNRA 4G2TA 2D5IA 1P1IA 1V3QE 4PF1A 1B2LA 1T43A 2O3UA 3WLHA 1Z8FA 2VQFB 1DCTA 2OC4A 2ZE5A 4W9RA 4I50B 1T25A 2VZLA 4C4YA 3ER9A 1SQGA 2ECPA 5AK6A 3OC6A 3ZV4A 5AW2A 3E4DA 3FJOA 2OILA 2WV9A 4PLPA 1JTFA 2G5CA 2C03A 3PUXA 3OZFA 4XXHA 2WJZB 3KBBA 1F6BA 5H1YA 5IXYA 1B15A 3EZ2A 1H0HA 3G2HA 4HL6A 4MVJF 1KZ1A 1JEQA 1Q7EA 1U1FA 1UT6A 2I6TA 2XQGA 3FZQA 3PXEA 3ROEA 1DAKA 4JLKA 2HRDA 1VL0A 4ZU6X 3PFBA 4YP5A 1QQBA 4P4SA 3UXMA 4N18A 1S8OA 4HQFA 1GNLA 1NUHA 4PC6A 4QEDA 4DIFA 1Q3TA 4D81A 3WJAA 2Q3BA 3OZUA 1EG7A 5ESRA 2VF4X 3VUFA 1ZK1A 3T9AA 4QTYA 3BMNB 2FMIA 4MUBA 4QQKA 4TWRA 2IWRA 5BN4B 2O7QA 3BDVA 4LDQA 3UMVA 2K4MA 2VNHA 9MHTA 1VHDA 3QYAA 2YJ5A 5FWXB 1WSBA 3TKYA 3C3PA 1VFPA 3PZRA 1ZS9A 2WSBA 3WL3A 3LD9A 3FTFA 4U63A 2OV6A 4AF7A 2EFYA 3QUAA 2XMGA 1R0KA 4YGXB 2PUFA 1X7XB 2IHBA 1P18A 4GQBA 4L74A 3ZDYB 5D8DA 3R7FA 1TYAE 1GP2A 3WE7A 2YXNA 2FW0A 2GN2A 4Y2QA 2YNMC 2GPTA 2HOQA 4RH1A 5K0JA 5M5BA 1HY3A 5FBVB 3TTYA 1ZD5A 2QE7A 3NFRA 5E2AA 2XCQA 4KXQA 3IIMA 1RMQA 1J8DA 4ZQGA 5EJ4A 4P08A 2ZI6A 3H9GA 3QBEA 3UA4A 2XGGA 2FU5C 1KMCA 1U7WA 5H8WA 3NBAA 3O7WA 2BGUA 3L7AA 4PNEA 1OFUX 4TTAA 2FCRA 5C1OA 3AKDA 2HO5A 4LI0A 5DEIA 2XNJA 1EE2A 3A06A 2ZBEA 2R5FA 3EUAA 4QOSA 2CXQA 1ZL0A 5D3MB 3UWMA 5AVSA 5FAKA 9ATCA 4C2UA 3OZBA 3PNSA 3H11A 4M76B 1PEYA 2B5OA 2BEUB 2ECKA 1OILA 1TC2A 2EBWA 4XIFA 2I66A 2QJTA 3TCNA 2G7MC 3TB4A 4HDQB 3PPYA 2QTFA 1NRXA 3OQVA 3UG6A 1NJ5A 3U7FB 2GYUA 1WU8A 1B3RA 2P35A 1WCYA 5EWJA 3WWCA 4PQGA 2D59A 2X5OA 3OEWA 2QYHA 1C14A 2WD7B 5AKIA 3WL5A 4LJ4A 4QG3A 1OXMA 5K9ZA 5DHSA 4A82A 1UAAA 4J0IA 3KJGA 1NNEA 4KXFB 5I4KA 1VKRA 4MVJH 3WGYA 2HBZA 3AUXA 3NUGA 3G2MA 4U3JA 3CLHA 2WHQA 5C1IA 1U3DA 4D9HA 3OFND 3KXDA 2QN7A 1TNDA 3TYXA 3DE6X 2COUA 4BWGA 1UT8A 2LR0A 5A3QA 4JYPA 3H2JA 1TCAA 4DQDA 4BNWA 2D0IA 4PZUA 2E49A 2JI4A 4FINA 1SBYA 2FPUA 2P4EA 3GP8A 2CVFA 1I0IA 1D4ZA 2G6BA 4WZBB 1PFVA 1OBVA 1KY5A 2VJLA 3QUCA 1V47A 1TIKA 1ENYA 4MRAA 2H4HA 3DV2A 2QORA 1XALA 3DC7A 1T1IA 4LWOA 1EVQA 3SCZA 5DCWA 2QX9A 3ELYA 4D7AA 4J9UE 1I7LA 4RZQA 1NVTA 4L7QA 4DKXA 1BWPA 2B8EA 1N2CE 3BFXA 4IBOA 2OYRA 4YPOA 1UBFA 5L3QA 4X97A 4LF9B 1E2QA 1PFQA 4FHZA 3O3NB 4NWIA 2FPRA 1GG5A 3D2LA 2WSMA 3EQZA 3NOQA 3S2FA 1E2PA 5BSGA 5GTDA 4C0SA 5AKHA 4ZICA 3HNOA 4K9PA 3GQVA 3MBKA 3UWSA 1FUYB 3TUZC 2QM3A 1TZCA 1NKVA 4MW4A 2ERCA 3EFOB 2P40A 3F47A 4MKIA 2XRFA 2XITA 5IT4A 2JAWA 2WWTA 2XODA 3BH6A 1BO6A 2Q21A 3EWSA 1DQYA 3L6BA 4HGZA 3GNTA 4Z0HO 1GTL1 1W35A 2VPIA 3FUUA 1K6XA 1JMVA 1SA0B 1Q0QA 2HIMA 3ELUA 3N2KB 4JA2A 1ZN8A 2CJWB 4PVDA 4Z3DA 4BAGA 2RGAA 3ULKA 3SQDA 3X1MA 1UKBA 4A0FA 4AW9A 1I1QB 2WDPA 3J7TA 3JYPA 2C07A 3K1JA 1EFLA 3L8HA 1QRRA 2EFCB 4J0QA 1UMDA 2P9YA 2ZZKA 2JAXA 3K9CA 4K86A 1EH5A 2A9JA 4US1R 4ARBA 3NT2A 3KQVA 1NQUA 2IOYA 3ROGA 3DTNA 4YJFB 2GJ9A 4EVQA 4IUCS 5CEEA 4DCOA 1CF4A 1Z0SA 4EPYA 5JR3A 1AF4A 3VZDA 2MWMA 4MW7A 2CFTA 3B1VA 3CX8A 4RABA 1K7SN 3SX0A 3VZBA 4AN0A 1AGYA 4OXXA 2HQRA 1MNQA 2AK3A 3JWIA 4EB0A 3NWPA 3A7EA 3C87A 4WJZA 2C5LA 1Q16A 2GFIA 1KAMA 3MAJA 4OKIA 3SSAA 2VT2A 4ENPA 2F3PA 1CLUA 1I51A 4MQFA 4UM9B 5GY7A 3SC6A 1ORWA 4J07A 1G0OA 2QLBA 2BGMA 2XF2A 3GCWA 5IFLA 2PA3A 3B78A 4HX2A 2PQ0A 1PDWA 1RE0A 1T2EA 2OCGA 1SO8A 1IEXA 1RLIA 4MS3A 1Q15A 4BAZA 5FYQA 2CY0A 1NVVR 2IZ5A 1XLTC 2JAPA 4FFLA 3G89A 1BWRA 4COOA 3Q9UA 3KAJA 4IVNA 3E2IA 3DFZA 4Q00A 2I99A 3U1VA 3U80A 3NEJA 2QK4A 4DA9A 3Q4GA 3IQEA 4TTRA 3WIDA 3LLVA 4UUQA 4E31A 1KAHA 3KJFA 2ZE7A 3VOAA 1GSAA 1P1CA 4KP7A 3R76A 5BR4A 1D7OA 4TV9A 2F3RA 2IXAA 1L7AA 3HC7A 4U2EA 3T35A 5CFPA 2ZITA 4H3KB 3G8DA 3BSFA 2IPAB 3BWDD 4JGBA 3QEOA 821PA 1QR6A 1HZJA 1CBUA 5AKZA 3UJ9A 2IX3A 4CN8A 1ZWLA 2NO7A 3A6EA 3KKZA 2XWJI 1ATIA 2C3MA 2H11A 3ITDA 4WBNF 5IK2D 5KTNA 3H8WA 3AB3A 1WCXA 4BLRA 3SBDA 4FYMA 1XCLA 2BHLA 2ZZNA 1A0OA 2Q6IA 3QPUA 1FPQA 2NO6A 4E46A 4IIXA 4BJ1A 3RC8A 4QBIA 1KNQA 1PHPA 4U02A 4YJGB 5EZYA 5LYYA 4B3CA 3ZD6A 2I4LA 2IL1A 3LOQA 3NETA 3O95A 2ZCVA 1ZRMA 3AM4A 1ML4A 3GUZA 2W2KA 3M1AA 4HH4A 4JCCA 3VUEA 2C2KA 3G0BA 4QFDA 4RZIA 4KIWA 4E2XA 4E5KA 3FWPA 4URXR 3NWJA 3GN1A 4ADSG 3CWQA 1TTTA 3CLSC 5COAA 4QLOA 4MJ3A 4M8NE 2FP4B 2V97A 2VP5A 2Z56A 4YJ2F 4AMUA 4B75A 5KX5F 3KU1A 1ZMRA 4M99A 2QG4A 3K0AB 2X77A 3JYQA 1X77A 1KE2A 2AYZA 3EIXA 4YRFA 1WU7A 2JEYA 3CWCA 4G1MB 4X3CA 4ZTBA 1EXVA 3DLPX 1X42A 3EISA 3LYAA 3DVQX 3F2IA 4UM9D 4OGGA 2XQVA 3B1YA 1YDGA 1GN8A 2HU7A 3BB4A 4TS4A 1MJGA 3DL0A 1L8XA 3I2YX 4KYIB 2R6DA 2OGZA 2HA4A 1V7CA 3QFRA 3W5JA 3K1TA 5KQPA 1G7CA 2AMYA 4ZDWA 3G2NA 4P3OA 1Q0TA 5BUZA 2EGHA 1UK8A 3FZNA 1W19A 2BFPA 3JWEA 4MWSA 4OB8A 4P92A 5G0TA 3CJTA 4U7JA 2PUCA 1WB6A 4LI3X 2DKOA 2PUDA 5JAIA 1SQ6A 3L02A 1RQPA 5EVCA 3H3FA 3ONDA 1O9GA 3NTQA 3OECA 4W9NC 4OO3A 3X0DA 3TJRA 2X8AA 2JKYA 2XBLA 3A6GA 3AETA 1ECJA 1GPMA 1JSRA 3DPSA 3WGGA 5YASA 5C8YB 3E82A 1KC1A 1WSDA 2O14A 3QWAA 2JBAA 2Y4NA 2FKNA 4Z4GA 2XMDA 1S2IA 1U9IA 1YS7A 4PGFA 3RIEA 5ALNA 4I9HA 4A0RA 4EEZA 2Y1DA 4MO9A 2OT3B 1UBGA 4PM4A 5JLJA 2JFXA 4GKBA 2W4MA 3E03A 2IW1A 3N07A 3L40A 3UANA 2FR0A 3G9XA 1JG3A 4L6CA 5LZ9A 2BGGA 4E4TA 2O06A 3L2OB 4EKDA 2OO5A 2HMAA 4D0SA 3RVSA 1ZK4A 2GAAA 5G0UA 1NW4A 3WLAA 4ZIRA 1UKCA 4H17A 1MO2A 1VPVA 2PU7A 2Z1NA 3D6NB 1MABB 3GGOA 5DWDA 1GPAA 1Y4AE 2GDZA 4LHZA 5BT9A 1QHFA 4RSGA 2H2DA 3OP4A 3W2IA 1GG8A 4HB4A 1TVKB 4H18A 4AS1A 1YZUA 3TZQA 5DRYA 4B74A 4ZCRA 2Q5LA 2W8BA 3FUTA 1J1IA 1AXRA 4M9ZA 3HY6A 4RHYA 5AUNB 4ATNA 2ZDGA 4Y7CA 1E8NA 2OO3A 5G1PA 3RSOA 3U7QB 2GPAA 2HT6A 3KYIB 2AWOA 3GVPA 2GF7A 2HRRA 2I7VA 2J3KA 5IXJA 2PSDA 4P3KA 2OFWA 4GBMA 5TGTA 4HAXA 4IG9A 4C9BA 1IN4A 5BMVB 1IZ8A 1JLMA 2DE0X 4GRIA 1XTRA 3CSUA 2VP6A 3TLXA 4D4JA 3GJ7A 2PUGA 1SC4A 1HXHA 2BFBB 2CLCX 4WLEA 5EXEA 1JT9A 2XTJA 1PAUA 4RXMA 4GOLD 2I3ZA 2OL4A 2GZHA 4PRLA 3SQXA 4AJ4A 2FLKA 2ZT8A 3MJEA 1OB2A 4OI2A 1T1GA 4CM3A 3R20A 2Z8YM 4YAKA 1Y1LA 5BVGB 5CNJA 3DBRA 4KWIA 5K99A 5EIWA 4FFBB 1WG8A 2GXUA 3RGGA 4DF3A 2ZWVA 3EQ9A 4B6QA 1E0SA 4EJSA 4HLQB 3OT1A 1VE3A 4UTNA 1G8MA 3H5WA 1Y37A 1U2GA 2BTQB 1KDVA 3PU6A 4A16A 2YL2A 1OPXA 3JQAB 4TV8B 1WB9A 1IBKB 1IK4A 1Y8ZA 1Q57A 1N5KA 3DXXA 3OTGA 4JWKA 3PDCA 2O8CB 1WDWB 1HNWB 2ZDHA 4KUEA 2QM8A 4N3GA 3SS9X 4Z49A 2QYSA 1HRDA 2PX2A 2QQ5A 3C24A 3ED5A 1KP2A 1LDMA 3KALA 4UUBA 4A0QA 4EGAA 1AS2A 4ND2A 5TX7A 2VT6A 1LVHA 2BIFA 5A62A 4JKYA 3BICA 1FYVA 5BYAA 1UZUA 1E2IA 3R8XA 1H93A 3GNQA 4QVIA 4D3SA 2W2LA 3UB3A 2Y99A 3HLTA 4OI4A 3ZVKA 1WNFA 1D0SA 1L7DA 2YV1A 3CFYA 3QWIA 1QAOA 3AYXB 5CYFA 2GZ3A 4IMRA 4N0DA 4NICA 2IHNA 1VECA 1C7ZA 3CX6A 3GOQA 3IXLA 3LT2A 4YRDA 2PE5A 1L9KA 2MR6A 4OA8A 5CJPA 3U9TA 1U9YA 2FMXA 3NBUA 1ODJA 3H2BA 3W0LB 5AW0A 3H5LA 4NIMA 1VLQA 1IYZA 4DSOA 4HCJA 2HQOA 3HEBA 5DBIA 5CB8A 5SV2A 1TYZA 1ZEMA 2ZWOA 3OQIB 4IS3A 1L1EA 3DV0A 4CIVA 2YHIA 2BFCA 2G1KA 3N5KA 3ZQ6A 4DLUA 2ZREA 1R0WA 2CDAA 3CR7A 2H8KA 5CU7A 4B47A 5IUNC 3CKYA 2HBQA 1TL7C 4N5DA 1NN5A 5D6WA 2RAVA 3AWDA 4D5EA 5JOQA 4RL4A 4G5OA 1S0UA 5FBHA 5LWHA 2IYSA 4UOZA 3V4SA 1EFPA 5LBIA 4HO1X 5I7UA 3ZQUA 1NVAA 1WW3A 2TECE 3WC4A 3T99A 3ZW8A 5LQUA 3KSBC 2PZAA 1TAUA 1ECLA 3LX8A 1PL6A 2GEDA 1FF9A 2EBUA 2XTZA 5KWVA 2E4ZA 1E62A 4E03A 3QJYA 4AY6A 3O4RA 4EG7A 4YMVA 5B37A 2ODBA 4LDAA 1PJRA 4RHUA 3OU7A 2FUG6 4BV8A 5LVAA 3DMPA 1I14A 1G2IA 1XCPA 2CLFB 2FRDC 3ANLA 5JS2A 4CFSA 2PVPA 1DP4A 1N3LA 4EI9A 3V2GA 4DLYA 1SHKA 3JQAD 1Z62A 3NHPA 1TQ2A 2JFZA 4Y2RA 4NK5A 1U2QA 2I2AA 1ADFA 2PEZA 1ODTC 2OXCA 1N4AA 1VKHA 2DWOA 2FW9A 1WVIA 4Y2TA 1ORIA 5LM3A 4GI5A 1K92A 1IL0A 5JBQA 5JRJA 3DUWA 2XUFA 1XTIA 2NQ2C 3KLOA 5JCZA 3MRTA 1R18A 2XNDA 2UUBB 4EPWA 1WXGA 4B9EA 2AC2A 4JBYA 1HLFA 3CJQA 4PZCA 1ZKMA 4R4JA 4UC4A 4ZVRA 2YWCA 3IOEA 1CNMA 5CH3A 3H4TA 3Q12A 3CLTD 1CFZA 3G2LA 3PUJA 4MDEA 2GM3A 2GK4A 4MA4A 5ECWA 3U4CA 5KMGB 1UZNA 1VCIA 2XMQA 4JR1A 5I7OA 3LKVA 1IXRC 2XDYA 3R7AA 3SSOA 4OVKA 4YMWA 1ADYA 4QRDA 2Q1AX 2EF1A 3T9EA 2R1UA 4CGYA 5KHLB 1ODCA 5F9HA 3SZMA 2LW7A 4ZVOA 1EWRA 1KBOA 5TRTA 1WKVA 4J75A 4TTIA 1F5NA 1GAJA 1PT7A 1FX1A 4DLBA 1C3OA 3EIUA 2PUEA 3DLIA 4XWYA 3ME5A 2VHYA 4FYVA 5DK4A 2IYLD 2Q62A 3F5DA 1A3CA 1YBFA 3CT6A 2ZJBA 4BVFA 1O77A 1YVRA 2X0RA 4DLPA 2AGVA 2EGUA 2QTAA 4QTTB 2ZI5A 4YP9A 3U2QA 1OY1A 5CDTA 5L3SA 2BKVA 4IQ4A 5DSZA 3W2TA 1MZPA 3PHGA 5LZ5A 3JRWA 3L7MA 3DQZA 1CNEA 3OF5A 3QU7A 4NZNA 1KSGA 1KIFA 5L9AA 1KVSA 1H2BA 2IYYA 3D9QX 2TYSB 2PQ6A 3BFVA 2RGXA 3JX9A 4RELA 5ALOA 4E2YA 3R2JA 1O6BA 1JLLB 3TQTA 4ER5A 2Y1FA 3DHNA 4OIFA 1CP2A 1LZLA 3W3AA 5H0IA 3SMQA 5KOJB 3FOFC 2Y0PA 4B6OA 4JI6B 2OA0A 3BJMA 2F8SA 1DC5A 4JZYA 2NP7A 1MB0A 3G59A 1PL7A 1W49A 4ES6A 3ZWNA 2JLRA 2DTDA 4YI3A 1E66A 1YIOA 3AF0A 5AM5A 2A33A 4AQYB 2Z2JA 5HOQA 1RLJA 1Y6JA 3FOWA 2DLNA 2QXUA 2XUGA 3FNEA 3MLAA 5FBQB 5L7YA 3EF0A 2JHPA 1IHUA 2FGJA 1KJWA 2KM1A 1C7JA 1UJBA 3EXHB 3EGWA 4XDZA 5ALZA 3WGIA 1GGFA 2Z6UA 2VL7A 2AW5A 3A6LA 2AOTA 2CMFA 1ZI8A 4ZHQA 1NP7A 4GF5A 3WMGA 4BNIA 4DG5A 1ZAYA 5EAIA 4OHKA 4PHFA 4FS3A 5EMLA 3S7ZA 3T7CA 3AUFA 3ESRA 3S44A 4A1OA 3JQFC 5GVRA 1CETA 4R8VA 5JYCA 2ONYA 1TUGA 3CPJB 3L7KA 4FBLA 4EELA 5CA0F 3R23A 3AXSA 3FNQA 3D3EA 1SELA 1TMKA 4Q9IA 2OAQ1 5EQDA 4EHLA 5IM4A 3GFFA 1C9MA 4MV4A 2X15A 4K88A 1IWOA 1JR3A 3G17A 3ZHUA 5CDHA 4H7DA 3H8VA 1UC5B 4RKRA 1OMOA 4GL2A 1Y1PA 3H2IA 1T15A 4MYUA 2PRIA 2IA5A 4J0FA 4X1IB 1IWPB 4XJSA 1U8UA 2FMHA 1ZD9A 3BHMA 5EZ6B 1D5WA 2DHQA 4EQ6B 4C04A 4EJ6A 5KO2A 3V1TC 1MC5A 2JLUA 2Q99A 3Q9NA 4M7OA 4RF2A 1W7AA 1T5HX 1YONA 3FM9A 2OHJA 4GKAA 4JVNA 2C4NA 2VTDA 4KRGA 4CFZA 4I9FA 4IHAA 1K8QA 3HA3A 2XT9A 4RXUA 1EGAA 4LSGA 3P0FA 4DV4B 4CT5A 1WDKA 1CZLA 1K7XB 5D6XA 2V54A 5JPIA 2G7ZA 4AXXA 3ZDCA 2WTNA 4CT4B 4AZ0A 4Z2AA 4WK4B 1KWKA 4O8CA 4EKIA 1Y7HA 3TL3A 2UYHA 1DCFA 1XZGA 1NOIA 1D5CA 1B0PA 1Y48E 2ADOA 3BS4A 3I9FA 3OICA 1SIOA 3QPCA 4M9CA 4S1PA 3DE1X 5FULA 1F8GA 4XCQA 3QVXA 5A3JA 4OQLA 3PTZA 2JIDA 4CKXA 1DADA 1FB5A 2H4YA 3VSCA 2YNMA 1SCBA 2R47A 2BLLA 5LJIA 1Z2PX 3BF8A 2UUAB 3F9CA 4G8CA 3I8XA 4YB8A 2JJ2D 1XRJA 3FPFA 3RFTA 2V65A 2VO1A 4D42A 4DIUA 4R31A 2YVAA 5IG2A 4DYHA 3HJBA 3L1KA 3UNXA 5HRUA 3QM1A 4PG8A 1JR2A 2CN1A 4J0JA 2RHMA 3U3OA 2NO1A 1VCOA 2C99A 1NLMA 4RQTA 4X1KB 1UMBA 2YX1A 4BTEA 2CXUA 3SDSA 3OMLA 2REOA 3VTAA 3JQBA 2WF5A 3KYBA 4DXAA 3VTFA 4F3YA 3N2GB 5LU9A 4OYHA 3IT1A 2JI7A 1PS9A 4KN5A 4RD0A 4LTNA 2JFUA 2DHDA 2GHRA 4M87A 1CS4C 2DCMA 4IKOA 4OA5A 2X6RA 4FMCF 3P32A 4DA7A 4NCAA 1RHJA 4BJ3A 1Y4SA 3JVVA 3C5HA 2P8JA 3KKKA 3RYCB 1QGUA 2B8WA 2QT0A 2V4ZA 4JDUA 3RKUA 2NV6A 3I5UA 4UBKA 1JE0A 4RKEA 3T3PB 3U4AA 4DCCA 1WQ4A 4FMDF 3FBTA 4QFCA 2PRJA 1V4BA 1OWNA 5HBGA 4G5QA 5E1MA 4AY4A 1JTVA 1QFSA 3RF7A 3RUAA 2PL5A 3DXZA 4NLLA 5JQGB 4HAOA 5E6UB 4YCNA 4BNJA 3IPYA 3MCVA 3TM4A 1MA3A 1MDBA 2UZ4A 2W4IA 2DPHA 2O1WA 4J0HA 1BX3A 4KE9A 1HA3A 4GICA 2A9RA 4OJTA 4QGBA 3T1VA 1COWD 1ESEA 3RS8A 2NYAA 2QTBA 3LXXA 1GD1O 5J1TB 3ZIAD 3OZ7A 4E5MA 1L5WA 4RIEA 2EP7A 4LHWA 4DW8A 5IHXA 1WMEA 2BEWA 3LPCA 4KXMA 2O3RA 2OR3A 5I4BA 1Q0SA 3H04A 3S3TA 4MCJA 3A25A 4FILA 2WJWA 2ZAYA 4MMYB 3TMYA 3ZQKA 5K8LA 3SWWA 5FHRA 3AIIA 4AZTA 1FJXA 4DPKA 3MEQA 4RGQA 5EP3A 5IZCC 4Q7QA 1DAFA 3SXPA 2WM3A 1WVMA 2J8ZA 4E08A 4IDQA 1I13A 4P36A 5TGDA 4EVRA 4BMDA 1WPGA 1YQXA 1RPTA 3AM5A 3W5BA 1UODA 2FPLA 4I9GA 1TW2A 1Z5WA 1ICEA 1GPYA 3UFXA 4MIYA 3HYNA 4EFLA 1MTZA 1JAIA 2K7ZA 3LWDA 4Y2XA 2PLWA 5AVTA 2VXCA 2HZ7A 4XWAA 3CEPB 1IZZA 1DFGA 1QIJA 2OGSA 3HP4A 3Q3VA 4HI0E 1A9ZA 3SLKA 3UQZA 2IDJA 2BP7B 5I7FA 1JNYA 1U9JA 5E9WA 1MO3A 4D2IA 4IIYA 2IYNA 3JQRA 4EG6A 3PA6A 5EQFA 1E7SA 1I6KA 2YZ2A 2ZP1A 1GRQA 2V7QD 4ENWA 2DYKA 1OX5A 3I3SR 1VL1A 3KWMA 3OIUA 1CZ5A 4U2KA 4E1AA 4F11A 3INNA 1JDSA 1Z6QA 1A9SA 5E0OA 4CEIA 1N1MA 2I7TA 5DM0A 1T4BA 1X2EA 5CLHA 2VHCA 2GFHA 2G9ZA 3OLVA 3RVLA 1JA0A 5GVSA 3GDWA 2DFKB 3FOCA 5A1JA 5K6AC 1I3CA 5EP2A 5AK3A 1MDFA 1ESNA 3PI6A 2DH5A 1RBYA 2LGJA 3I39X 4IUDS 1TYCA 3PZBA 4QXPA 4WA7A 3DR3A 1QAQA 4MAAA 4Z4EA 5JAMA 2JFHA 1W6UA 5ERYA 1IQUA 4KMSA 4GX2A 1O4WA 2VWQA 1ZIDA 3DVAA 3NGLA 4IDFA 4BATA 4X6UA 4HT3B 1GL9B 5TV2A 1S2NA 1TFUA 4EHFA 3GLTA 2WAXA 3I76A 3LOPA 1Z7YA 2BMVA 4OI1A 4BNDB 4WECA 3NTXA 1OREA 4PLFA 4WN9B 4X1OA 2PR7A 4X3OA 2XOXA 2O2EA 3SX2A 2H17A 3KXLA 2IPNA 2WW8A 5AOAA 3I1FA 4A6PA 4QGSA 1MV5A 2B9EA 1YL5A 5IC5A 3D6AA 3OHSX 5DTQA 2VRCD 3HDGA 4KBFA 1LPNA 5CHEA 2YZMA 5HX7A 4RY2A 5K01A 1FOEB 3BORA 1V7PC 2W93A 4OU4A 4HWKA 5AMXA 2PMEA 3ZBQA 2E18A 1SN7A 1R3UA 1IM8A 1PKXA 1DPFA 5B6PA 1P8AA 3IELA 2HA0A 2IYQA 4MW1A 4TLEA 1GSIA 1M7GA 4XAQA 3RYIA 1HWYA 2JKZA 5F78A 2BKLA 5CD9A 5KTKA 2YUJA 5SZKB 4ZYTA 4D8VA 5JRZA 4IAOA 3VPDA 1DIBA 4TS1A 3ZU4A 1NASA 1KFKB 1MXHA 4OXKA 3LYLA 2YYAA 1E2MA 4RZ3A 1G20A 4E2FA 3H7AA 2Z8XA 4BVGA 4YQFA 4Z7QB 3AB7A 3H3JA 2YS7A 3U0BA 1K6MA 1LPBB 5ALYA 2R8BA 1N2SA 3I1YA 2Q9BA 3WFIA 3GO4A 2QQ0A 1XJQA 1I4OA 3OJWA 3U9LA 4IZHA 2B0JA 1L7VC 3GYGA 3BOSA 4C4ZA 3ZCQA 4Z1MA 3SF8A 1DOZA 2ZIXA 2C82A 4FGWA 4JEUA 1I9CA 1XX6A 1ZLYA 3QYPA 2ONKA 3RU3A 1TT5A 1V8OA 1X7ZB 5C8ZA 1J8FA 5AVVA 1WR8A 2IYAA 3ZC3A 2H1WA 8ABPA 1AM4D 1X1QA 1NUQA 4EB6A 4Y0AA 4RCZA 1UXIA 1Q3KA 3W90A 5A9SB 4M1SA 2J9ZB 3OE7A 5M04A 1IUPA 3HSSA 4MGYR 4UQPA 1RI3A 1U4NA 1ADCA 4B8WA 1KPHA 3JXEA 4WNCA 4MHOA 1L7OA 3K30A 1XWWA 4KMOA 5CXSA 3P2EA 3OETA 1RXCA 2C7VA 2DSTA 1Z5NA 1P62B 3BPSA 4UVDA 4EBFA 2XZOA 3F3MA 4E5NA 1EKXA 4EA9A 2H4ZA 1X8LA 3KZVA 1CUXA 2QTCA 2AWNA 2R5NA 4HN2A 1QHXA 4LDNA 5A6SA 1OH8A 4HNAA 1H69A 5DCUA 5GZ6A 3TRIA 1RXSA 4RNCA 2X22A 1J70A 3KLBA 2QVYX 2VHZA 1IOLA 3KQLA 1Z07A 2SECE 3UOAB 3QA9A 1CCWA 3QKWA 3MJSA 4O4IF 4YCLA 4O4HB 1H2HA 2FWBA 1UBRS 3RG8A 3GJRA 4EJFA 4EB8A 2C31A 3C85A 2AXQA 3H1FA 2QMHA 1KAGA 4YFYA 4FLEA 1PG2A 3WJ1A 3GHYA 3GJXC 3DZJA 2VDVE 5JAHA 2V98A 3MFQA 1ELOA 3LCCA 4KQWA 3IVMA 4RTQA 1KVRA 5DV9A 5J43A 2VYVD 1N77A 5C5DA 2FFHA 1X3LA 4RFSA 3GDFA 1ID8A 4G84A 1KQPA 2I2DA 3PICA 4EGSA 1QWSA 2BELA 5BQOA 4C7OB 5ICFA 3E3MA 4QX6A 3ILVA 1WY5A 3L0PA 3TX6A 5IYZA 1JG2A 3DDZX 3T5BA 3X1ZA 4RM2A 4Y6RA 1IXZA 2A8YA 5ALJA 4RTKA 1GFSA 1PDOA 1J0XO 1Z2AA 3HB1A 4IINA 3I12A 2CSUA 5DXFA 4PNZA 4RJJA 3K4QA 3EEFA 4TKVA 3Q72A 1YE8A 2ODTX 3T4EA 3CC8A 4AJ1A 1B6GA 2VWGA 2G70A 1E9SA 1T5TA 3KZ1E 5FNVA 4R83A 4QFMA 5JE8A 3KWJA 1HDOA 2ZWPA 3DLBA 2G9QA 1RWQA 2Q3DA 1PLKA 2DTEA 3JQ9C 5E8RA 1IZ7A 1LWNA 2BY4A 3FB4A 4G81A 4UHFA 3AJ9A 4XM1A 4EB6B 2IGTA 1NI5A 2JAHA 2UXDB 3OHPA 1R6BX 1KFBB 1F48A 3OZSA 2IHYA 4XOUA 3TNJA 4TN5A 1W36B 3X1YA 4P0PB 1NXOA 3SFZA 1J0EA 1IAVA 1HQDA 1SBTA 2ID8A 3O2NA 4PG6A 4V0LA 4YDSA 4YRIA 3GIWA 3VA7A 1RHMA 1W9MA 5BVHB 3F9IA 2EFEB 1REQA 1URPA 4ZEWA 4LZAA 1G5PA 5JS6A 4QPZA 1JJFA 4H35A 4PV7A 1OH7A 3TRJA 4HBZA 1T0UA 1YJAA 1LRJA 1LPSA 4CQLA 2I62A 1SHTX 3TVYA 4J7AA 3OM8A 4R0MA 5BN3A 5AOBA 4OHOA 1CDOA 3SPXA 4AYTA 4DCTA 3L1IA 5CEJA 1L5GB 3Q98A 4LHSA 2GFQA 1L6RA 4J2OA 3ZTYA 2WP8J 2X2PA 4L6AA 3I8OA 4A23A 1BOOA 4R2IA 2QTZA 4ZYYA 1EDOA 2O2CA 1NG9A 5EUCA 1WS6A 2IPXA 2A92A 4Q21A 4AXBA 5CAEA 4YMTA 4ZAVA 3KVOA 2CL6X 4ZAGA 5ED4A 2QPLA 3AZOA 4JCOA 4K6MA 3PGXA 4IIJF 2FPXA 2G5PA 4INZA 5IWCA 2Z1MA 2ZWMA 1BXZA 2ZWAA 3H5AA 3P97A 1UEJA 3UW1A 5GONA 3C6YA 3BQ9A 3CN7A 1CUJA 1QJCA 2B35A 1OVMA 1NU6A 1DBSA 1Y1QA 3B3JA 3MFYA 4JQZA 3UXHA 5HK9A 1W5SA 5IJ0B 5LIPA 3BQNB 1OW3B 3HR4A 2VJDA 3HZHA 1SRQA 2O23A 4ZT2A 2A1TR 2N1BA 3GNLA 1EVYA 3PQCA 3BSWA 3F4LA 1Z34A 2P11A 1YZHA 3H6GA 4HWPA 3DDUA 3EFBA 4BV9A 4YX9A 5D85A 3C1TA 3EASA 3I52A 4DNXA 1WJGA 1EWKA 1JPNA 1XDDA 1XO1A 3QFFA 4X6YA 2Y1CA 3PNOA 2V9ZA 4TZ0A 4QUIA 3QVGA 3DHWC 1S3FA 1A1SA 1M6WA 2WAMA 4OHCA 1O08A 2IUFA 3H19A 4IV5A 4RK6A 1YJCA 2Z04A 3K20A 2V7PA 1W36D 1D0IA 4WBNB 1LY1A 2HNKA 2UYYA 4KNVA 2ZI4A 1QZTA 2E9SA 2AUMA 3HH8A 1IHOA 1RWMA 2QB5A 4L50A 3I1IA 2NQTA 5FEMA 5FKJA 5IBQA 4Z7NB 4OUDA 3KKLA 3SBOA 5KWSA 2WILA 3USES 3VNUA 4E3WA 1K0FA 3E9ZA 2XXAB 3JCZA 4R1NA 4UUMA 4XSGA 5ILQA 2AHRA 1M2HA 1NIPA 1JQEA 2CUKA 4RMIA 5F1KA 3TSYA 3BD7A 1FVXA 3UJ3X 2D00A 5EC8A 4HUTA 2RK4A 1DZ3A 2RH9B 4X3PA 3KVRA 3K9LA 3CISA 3K6SB 3DE7X 5DTIA 3IUMA 1E2KA 5K3SA 1VHLA 2VJKA 4NCNA 2FUG1 3D64A 3ND6A 1AO0A 3RJZA 4IP0A 3S28A 1FZTA 1AS0A 3EEYA 4C4SA 1VJGA 1YRLA 1NMEA 4BWYA 4HH1A 4OIMA 1TD9A 1MB9A 4B2IA 2P1DA 5A4IS 4WLUA 4ZMBA 3ANYB 4MR7B 4YUAA 1Y1SA 3COWA 3ZV6A 5ER9A 2F1OA 4JJAA 5H7XA 1M0WA 3O03A 1Y3HA 3OFVA 1KDOA 1EESA 3C8ZA 2OXTA 4PVCA 2PGAA 1QG2A 1MO5A 4H0FA 1N5MA 4L4UA 1P3DA 4JYMA 4N7JA 5TT1A 3T5DA 4ENTA 4P58A 4HATA 2OKGA 3SGLA 4WZAE 2Z43A 2RHWA 1IZ9A 2XOKA 3TLCA 4F4FA 1RZRA 3ABRB 1LKZA 3HVHA 3EAFA 4PLCA 1Q14A 3WHPA 1UAGA 4H7IA 2XPCA 5K03A 2KSQA 2IRWA 4QQNA 1G4UR 3E9DA 4X66B 3NALA 4FI3C 5KKAA 1K5PA 3U3DA 2WVJA 1Y8CA 1UJ6A 1KK2A 3NPMA 4FSDA 2NU6B 3DXFA 4PAGA 4XJXA 2FZLA 2PAAA 5EL0A 4OKNA 1VJCA 2J3HA 5A9TA 4JGIA 1WBDA 1MCZA 2P62A 1GITA 5D3KA 1BFDA 5DK6A 2R0QC 4MGEA 4IVQA 4CXMA 2HFKA 4UQOA 4EQZA 4LV8B 4QT0A 3PUHA 3HJAA 3KG2A 1QP7A 4MR9A 1NFQA 4BFXA 3I04M 4N01A 1L7XA 1WW2A 2NQ8A 1A95A 1PZHA 4R6XA 3O0TA 3KOZA 4YC7A 1X74A 1HQKA 1V37A 2HCJB 4IX1A 1RPZA 2ONCA 3Q7EA 1ZW6A 2JGIA 1GXSA 1Q7CA 2V03A 5LA6A 1P2SA 1TE2A 1I4TD 2LKCA 1MAAA 1JQJC 4ZXFA 2EWMA 2PGIA 2IYWA 3E18A 4FR5A 1JTEA 1MIHA 1AKYA 4RPLA 3V8MA 1TUBA 1QB8A 1S4QA 3FLBA 1JHMA 3MF4A 1CRQA 1HNXB 1E59A 2VZEA 3TQRA 1NFRA 3T5PA 3ZJYA 4BKPA 3C3DA 1PK9A 5LQRA 2EP5A 2VF5X 1R27A 1V25A 2O3TA 2QMUA 5JSKA 4B8ZA 1BHO1 3ZN2A 3ZCRA 1EAYA 1EHCA 1NT4A 5KB3A 2VUSA 3OMXA 3O8QA 2YY6A 4QAJA 4BFSA 4DJAA 2ZAGA 5BT8A 3GUCA 2QRJA 3GZNA 1QGAA 3RRMA 1ZU5A 3H17A 2V1XA 4IOJA 2PUAA 5ICEA 1XJCA 3OURA 2RGRA 4JSTA 2V4UA 4MS4A 3I5YA 3D6VA 4WX2B 1A7JA 2UZ1B 4JC5A 2QZPA 3HJCA 3JAKB 4PBRA 5LWQA 4RKFA 1LLQA 3TAUA 2B7CA 5T57A 1NSTA 2YN4A 1VL5A 2WZBA 3UWKA 1CE8A 4O29A 3SHVA 4ETMA 5CUQA 4CM1A 3W5VA 1GKYA 4KO1S 3TNLA 2ZUEA 3TD9A 1IOVA 1YS6A 1JN0A 1XVAA 4B3JA 4E5DA 2PK3A 2YCLA 3J80A 2QZSA 4G5HA 4KBGA 4OLHA 3WYFA 4UASA 5KC8A 3KPWA 3ZHZA 3A10A 1R10A 3VI4B 4B3SB 5JECA 1G21E 1V1MA 1W47A 1XRRA 1OIXA 1TMGE 3EHEA 4P38A 4QHSA 4JEIA 5IKMA 4FLFA 3A9WA 3O4IA 1KQNA 4WOPA 1IXYA 5L53A 3L8CA 1VPWA 4M2LA 3DYVA 4GMKA 2W5UA 4U9HS 2Q5CA 4CV3A 1XZPA 2BEKA 4ON9A 1MQAA 1P75A 2BFOA 1LX7A 3G1UA 1KEEB 1RM3A 1VSQA 2JJMA 2WHPA 2ZIVB 3CNOA 3IKLA 5HQ3B 1OLSB 1PR2A 4Z7JA 2WTXA 1ZIXA 2FWJA 3N0RA 4G0XA 1TF7A 3KDPA 3ZWDA 2HV9A 3R6DA 4JBHA 5EXTA 1E7YA 2IELA 1IY1A 3KQOA 3ZH2A 4BQEA 3VOSA 5J23A 1SGWA 2BE7A 1XMIA 1Y3FE 1PGJA 5I7VA 2PD3A 2TMDA 1A2BA 3BKXA 4ZU1X 4RZSA 1GSOA 1O9BA 2O2JA 3CN9A 1KJZA 3GFPA 1PX2A 3OOYA 1ZEJA 4J0KA 4RNDB 2H1LA 4LJRA 1G8AA 2TMYA 3D7KA 5HDBB 3AWIA 3T54A 3KV1A 1BE1A 2H59A 4PAOA 5GV7A 2H52A 4GXNA 3JD0A 4O3MA 2E89A 4HRVA 2CVHA 3KB1A 5A3RA 3ZJVA 2C1XA 1T29A 3PWKA 3OU2A 1OX4B 1Q83A 4U7TB 3NEYA 3JAMA 3DBVO 3PIIA 1NTRA 4PGMA 2ATEA 4RACA 5F12A 1RM5A 5FWDA 1FP4A 3S6JA 2WF9A 3UJPA 1U28C 5BQPA 1VE5A 1KL7A 5E7JA 5TQ2B 4XGNA 3FW1A 1N3BA 5KEIA 2Q45A 4C88A 3INGA 4LMAA 4YRAA 2FPPB 4CRWB 5BORA 3MJHA 4BB6A 1D9ZA 2ZTMA 3EAQA 3BIFA 4R2KA 4QUAA 1N9ZA 1UZMA 5T41A 4GXTA 4AZWA 2BBTA 1TMOA 4B5KA 3BXGA 3IR5A 4GFDA 3THYA 1N3YA 4P4TA 1P74A 2HTEA 1XAGA 3V8VA 1E20A 4F4DA 3LTNC 2Z6QA 1IMOA 2W0SA 3HBAA 4ZOCA 5TDHA 4Q1AA 4QGGA 1LK7A 3UHOA 2F1HA 2GM4A 3K70B 1WF3A 5JAQA 1L5VA 3VR5D 2JH8A 4KRXA 4PPQA 4B6PA 1DKRA 3NIDB 4XVHA 4C6TB 2XGJA 2O8FB 1UZLA 1XMQB 5G2OA 1Z4JA 4CLOB 4ZEVA 3CVJA 3A11A 6YASA 3LVRE 3KKMA 4UMEA 5LNK6 4LKOA 1VDZA 5ECYA 4QM6A 1HLGA 1PSWA 1ZM4A 2P9BA 2R60A 3BFJA 3JQEA 2NZYA 4ETNA 5IZCA 1EK2A 2QPAA 3RFUA 1JZTA 3GG2A 4URVR 4X85A 3SU8A 4F3RA 2XSZD 4NJOA 1EUCA 3UJDA 4IDBA 5GZ3A 3BRQA 1JDZA 2P7IA 2WSSD 1OGYA 1QHYA 2QW1A 4DFDA 4KXWA 1XNQB 1BKSB 2HK9A 3IQDB 1LDGA 4GXQA 3HG7A 1WHSA 4Q18A 3H9QA 1SG9A 4LW8A 3H6KA 3GRCA 1D07A 2QTVA 4GP7A 5ABPA 3BD6A 4FFOA 1OA1A 2ZSKA 4YRBA 1XE3A 1QCCA 5JNUA 2J3DA 2ODPA 3CRRA 2BMAA 1KMMA 1Y8QA 3CLTC 3DE3X 4H3HB 2VJOA 5AFSA 1CPYA 3D7SA 4GG1A 2A30A 2GKGA 4JEMA 4UW9A 2LW6A 2Q2WA 3ZHOA 1RYHA 5IASA 1ZH4A 5AKYA 1SUFA 3UYKA 5DYWA 2Y0EA 1N5DA 5E2BA 4R1TA 4UHBA 4EY5A 4CF3A 5F3DA 1UQUA 2P79A 3EW7A 4RGVA 3F6CA 3VPGA 4IQGA 2GZMA 2QVXX 4PO9A 1ZIPA 3ZWMA 4BMZA 1T0PA 1EIWA 1LI7A 2AR0A 1EP3B 2GDJA 3IT3A 5FH9A 3KQKA 3UZUA 4Q4AB 4K9SA 2CZQA 1H8ED 1HMYA 2AOXA 4QQRA 2P6PA 2B25A 3P71T 5K3AA 2Q1TA 4JC0A 3O8OB 1YQWA 1E89A 2BDTA 3DWFA 1BQEA 1EGMB 4EYQA 2OXRA 2PFSA 2C2WA 2VPXA 3VR0A 1JFFA 4DSTA 4DRXB 5JYBA 2BEVB 1WXQA 2PCJA 1FYDA 3CRZA 3P0JA 5KQLA 1JECA 2F1RA 1QQAA 5DU2A 5KQGA 5KYVA 4CM5A 1NZDA 1UBKS 4ZZ3A 4EECA 4XSHA 2QKYA 1JDUA 5HTKA 1O9HA 3QVLA 4P83A 1T9GR 3IFSA 1BH2A 4RSHA 3WSTA 4ZYXA 5CA0B 1SD5A 2GESA 4G9EA 5LP6B 1U2DC 4S1VA 3CY6A 3NV7A 3OO0A 4G25A 4D5GA 1W0KA 2QD5A 3W8RA 1KI6A 1F4VA 4UVHA 4QEKA 2IUYA 1XZ8A 5ED0A 4J0EA 5BXQC 1JILA 2VLBA 4YBRA 2O48X 3IV9A 3JARA 5DHRA 2BHSA 3AUAA 4C76A 3VHXA 4IDPA 1YRQA 3E1GA 1DKMA 5B1EA 1PZFA 2A5YB 1TJ5A 3VR4D 3AONB 1VZ2A 4ESHA 3PT9A 5L95A 4UATA 2GZ1A 1Z0IA 4S24A 2FN9A 3L1VA 4OP1A 2XR1A 2Z5VA 3F5MA 5FUYA 2BONA 4MIOA 3VR6A 4B73A 5B1HA 3QF7A 3ZWXA 4RY8A 4MWZA 5B2FA 5KREA 1SCKA 5F2EA 3PHCA 4O3FA 4NBWA 3HA5A 5L7WA 4ZI7A 3Q0IA 1PYDA 4OMDA 1QHSA 4BB9A 5BSVA 1KYZA 2QW0X 1H94A 1H9BA 4YAJA 3HYLA 2VHUA 4ZO6A 3WA6A 1RXWA 1MEJA 3Q6MA 4WSOA 3SJZA 2CYBA 4F21A 4YIHA 4AZ3A 1H2YA 3W8FA 1N9GA 2PSFA 3AIOA 1H8HA 2CVOA 1V11A 2BM0A 2IUTA 1WDTA 3FJ1A 5A5VA 5THKA 1WZ2A 4IRUB 4CKBA 4ZYVA 3RYTC 3QX8A 1RFLA 1KWGA 1OJ7A 4H9GA 3HXQA 3KSZO 3D4IA 3E4CA 2B4YA 2R4UA 4GDFA 1OAOC 3EQ7A 3NEPX 2J9RA 3HJRA 5FO1A 2E82A 4LRQA 4ZMSA 4NZOA 4JLNA 3F3YA 3L4BC 4YRMA 2Y93A 1KK0A 2HMTA 2JFFA 2ZAIA 1SCAA 3IOCA 1VIYA 1CZUA 4C0AC 4F3NA 1P6UA 3HVIA 2NO9A 1I6LA 5DP1A 2V4MA 1W88A 2MSKA 3Q5EA 4WVFA 3WNBA 1QGYA 2BOVA 2CWDA 2EW8A 4JIMA 1L5HA 3ZS9A 1TJYA 5IVDA 4ARVA 5B12A 4OGWA 5F2NA 1G3RA 5KOIA 2LCQA 3DHEA 4RVHA 1EGVB 3FPBA 3P9CA 1FMJA 3IUSA 4QO7A 4XLTA 1LC0A 3EFHA 4UU0A 4DM7A 4JVLA 3LX4A 2WD9A 1DV2A 5CURA 4EW6A 3MELA 3ZHBA 1RYEA 2F3QA 2DY1A 2HK6A 3CWZA 4ZOLB 3WJ7A 4BLWA 5FBWB 4FFWA 2QJOA 5AK0A 5K3FA 3RAFC 3G13A 1LJUA 3V1LA 2ZR9A 5EE0A 2WOJA 1ULZA 3GQBA 3G2QA 3Q11A 4HDCA 4JA0A 4NHOA 5EKXA 3MGGA 4KPFC 1FYXA 4RJLA 5B6IA 5KPJA 2P9CA 3FFXA 3ZD8A 3EXHC 5JXWA 2XMSA 4YGYA 2LCIA 3A9VA 3ONFA 2XMCA 3K09C 2IOFK 2WJJA 2XYPA 4EY3A 2ZATA 2BYTA 4HNSA 3ENKA 5KQRA 3EK2A 2DUNA 1HFEL 4EI8A 1BDJA 4AP6A 3OLQA 1N1EA 5CLFA 1V1RA 2I3DA 4JJ8A 1ARZA 1WSAA 2RIRA 3CA8A 1JHZA 1XLUA 2R8ZA 4FFMA 4G41A 4Q4DA 5BV0A 2PMCA 4IJ6A 5HJEA 1YR9A 2H2GA 2ISQA 4BO2A 4HEHA 1XTUA 4LVNA 2HSJA 2FZCA 3WLOA 4C78A 4LY9A 3H4MA 3BXZA 1SBZA 5K2OA 1QORA 4A1FA 4GX1A 1NVKA 3ZU5A 2IS1A 2PRYA 3HA2A 4UTVA 1GUZA 4LQ4A 1BGXT 1EX7A 1VJ5A 3L7CA 1KPGA 4ESEA 3NVKI 2FEXA 1N6OA 2NTVA 3G5MA 3TNYA 4NR0A 1OAKA 4L7VA 4CF5A 2APJA 2JJYA 5JJCA 5KSYA 1PNRA 4BO5A 1Z68A 3D8BA 3IC5A 4R0NA 2Z2YA 1SM4A 1OE0A 4QYMA 3RK0A 3KJXA 2PWAA 3SYLA 1GYPA 4IDHA 4JUDX 4GR5A 5CNIA 3SQOA 4EG3A 1Z4MA 4WLVA 5FA6A 5A1TA 4JJFA 5ALDA 1Q44A 2YHUA 4R3UC 1AHNA 1CY6A 1JGTA 1VE7A 4Y6QA 1YCFA 3HMKA 2XA9A 1DAHA 1X13A 3ER6A 3K35A 1IZYA 1JFLA 4J0DA 3VKUA 5I9BA 3LLUA 4OHMA 2CNBA 1PYOA 4WCFB 5DNDA 5TY0A 3WZMA 5B7QA 5AVXA 3CH7A 3U6KA 3ZY4A 1SVWA 1TGYA 1R74A 4IDOA 2HT1A 1C9DB 2WSYB 4L16A 2HHAA 1XBTA 4D9FA 1R5OA 3GRFA 3OJCA 3C5EA 3IUPA 4NBKA 1M6EX 4FOLA 5ALLA 4YWJA 3SP1A 1II0A 1S9DA 3AIKA 3TLYA 5H9WA 5ICGA 1UBSB 2NAPA 2CJYA 3IV6A 1RT9A 3WISA 3HQ4O 4QSMA 3UKJA 4AICA 4DTIA 4M0PA 3C8DA 1R1DA 1XZQA 3BWYA 4NCHA 1J90A 3ISTA 3S2UA 2WR8A 1GKKA 3B9PA 4RTRA 3MTJA 3MVEA 2HQSA 4TZ6A 4M3NA 2EKBA 2NSJA 4G37A 4KPUA 5ITVA 4I9NA 3G7SA 2MYUA 2P2LA 4AYXA 1M75A 2J6CA 4K81B 4QHTA 3BXPA 3G2JA 3JD1A 2CFIA 2MSNA 3BVPA 2IEZA 1X1RA 1LNSA 3EEOA 2BEUA 4EUKA 1JHOA 1PR5A 3E9MA 3DZIA 2VHJA 3BQMB 4D9NA 1E5LA 5DIZA 1Y63A 2I71A 3KQYA 4LF5B 2H7XA 2WAYA 4M22A 1CY7A 3VKWA 4CTJA 4F04A 3H75A 1VG9B 3NTOA 2RHLA 3PNVA 4FNAA 5E6RB 3PJFA 2GK3A 3KQQA 2EXXA 5ILGA 1FSFA 2PSJA 3K5IA 4RF4A 4F4IA 2CL7X 1Z47A 3QBDA 4AKHA 2JGDA 1V95A 3T15A 1M8GA 1I01A 5GADl 4MCHA 3KYCA 1CJBA 4LDZA 4BY9E 2GN0A 3R5FA 3BFPA 1LDNA 5IUKC 7MDHA 3D54D 1W73A 3DKRA 2CXOA 3IKVA 5AIAA 1QDNA 2DKFA 2WVGA 2Q0HA 3HJHA 5H16A 3C45A 1NBOA 3M5PA 2PXXA 4AC9A 3IRVA 3E5NA 3PR2B 5IW8A 2Q6VA 4ROTA 4DN6A 4I7EA 4MMXB 4H1HA 3EULA 1XKQA 4PYMA 2VK2A 2PZ8A 2ZBQA 5AM3A 2FEMA 4DG8A 5JBIA 4J03A 1W44A 1FC0A 5DN6D 2ZLBA 4XPZA 3R3WA 5BNFA 4DV0B 3D3WA 1LV7A 3IP7A 1MOQA 5CVEA 1YNSA 5D1HA 3EDOA 3IOMA 2VH1A 2DPYA 5FTKA 2PUVA 4G89A 3RM3A 4A7PA 1IOWA 4XYLA 4PZLA 1P19A 2PGLA 2ENUA 2XUDA 4LGCA 1CY8A 3EIHA 1C3LA 1XFAA 3H4VA 1XT6A 4R1OA 1II8A 1B2RA 1Z12A 3R8FA 2D6FA 3E9QA 3NORA 5JI3E 1NR7A 4IEEA 3PX2A 4OQDA 4IW3B 4XDHA 1TQ4A 3L0ZA 1E3LA 4QASA 1FFCA 2ZYWX 3ILYA 3O1JC 4C0HA 5CFRA 2JLWA 1BJRE 1PJ3A 2PRZA 4B5LA 2Y67A 2ZSFA 3ET4A 5IFKA 3E61A 5I7WA 1KXZA 5BN5A 3QELB 1K6EA 4KYTA 3KXIA 1KMHB 1KJ9A 5IK2A 5HRCA 2YIJA 3N2KA 3C39A 4BQPA 1DNPA 3AEZA 2CJWA 3IMFA 4UULA 4DMMA 3CVXA 1CP3A 2PGXA 2Y1EA 4F71A 2G08A 1AQYA 3SHTA 4RANA 1KHHA 1MIOB 5AW3A 2RKBA 4K9OA 4I55B 2WYHA 3B6KA 3MD9A 3QKSB 5KNBA 2JBHA 3PFNA 4GSKA 1V7QA 4EY7A 4RENA 1AZLA 9LDBA 5IPFA 4YJFA 1JKXA 3MCTA 3NHAA 2IZ6A 3L4SO 2QRUA 2CE2X 5JMWA 4Y2PA 1OYWA 1EWYA 2WWVD 4LVOA 3SZ3A 1GZ4A 1UEXC 4ZJUA 3MLEA 4NNOA 1E2FA 5HZHA 1VHQA 2XVAA 2PMBA 4I6EA 3T52A 5LQAA 3JZFA 2DHEA 3FFWA 2C2HA 4CGZA 4H15A 3REQB 2J9GA 1SHJA 2PKYX 1UBCA 1RMTA 3L8YA 4KYUA 2HMSA 4RHCA 4JS0A 1C2TA 3CUUA 2CUTA 3W8EA 1NBHA 3RYHB 2IYXA 2A1UB 3AL2A 1U5BB 2D4AA 1MV8A 4DLXA 4C30A 1FTGA 5CBKA 2HA3A 3C4JA 4Q1VA 1TEZA 4YXWA 1ITZA 4UHDA 4QA9A 1R4MB 1AGNA 4Q5IA 4LEIA 1AMOA 5IF9A 3AFIA 4EL5A 4IZIA 4N7MA 4O1HA 3IHKA 4GZ5A 5I47A 2QP3A 2GN8A 3FCEA 4NX2A 2W2PA 3VC3A 3VPAA 4KFTA 3HTXA 2E6UX 4RTLA 5HUJA 1VOTA 2WKSA 2GFAA 1QVRA 1DIHA 3EZLA 2NWQA 1JEOA 1E5VA 4K9DA 4LYHA 3WGNA 4F1KA 4GI3A 1GPUA 3FF1A 1H66A 3D7LA 4BO4A 4UJ3A 1E2NA 1RLTA 3SQMA 3R7DA 3GX1A 3JSXA 2YKGA 2IIBA 2GETA 4LC9A 4P5PA 3LCUA 5JO0A 5FQNA 3FHOA 5A5EA 2GAJA 1XKXA 4Y9DA 2Y1XA 1K3UB 4E4YA 5TNXA 4O1IA 4OGKA 4RL6A 1MAVA 4CEJB 1I24A 3FVQA 4IHJB 4WDQA 1YAJA 2QVGA 2X19A 5DTMA 3EIEA 2O8DB 4E2WA 3TW8A 4DBLC 1TF2A 3PIDA 4YV7A 4CMHA 3UKDA 1DLIA 3QEMA 1M10A 1QR2A 1RTTA 3C7DB 4F72A 3L9XA 4RDXA 3QXHA 4G1FA 2IP1A 3C8UA 3HRIA 4O4LB 3LOUA 3Q3HA 2CL5A 4PXYA 2O5EA 2VC2B 3E58A 1EX6A 3EPRA 1TAGA 3MTDA 4LBWA 3ORRA 4PANA 3FKSA 4NMMA 1SVNA 4J1QA 5CB4A 4FT2A 1PV4A 1QCZA 3BXHA 3O82A 4FW9A 1JAZA 4QFBA 3DCYA 5D01A 1EWVA 3ESAA 3U61B 2O8VA 1XP5A 4LISA 1F0YA 3K0AA 1DQPA 2ICAA 1EFRD 2CBXA 3O47A 3C3XA 1AKTA 1P9RA 1WMFA 1EX9A 1SIWA 4JHLA 1W5EA 4GM1A 4TQUS 3OUUA 1ACLA 1GQQA 2QRHA 2RG7A 1F8YA 1L1QA 1T8RA 1OLUB 2NYUA 4C01A 3K0SA 1D2GA 1AH2A 2PMWB 4OTZA 4UAVA 5FPQA 3P1JA 3IBTA 2BGLA 3D3JA 3V1NA 4R40A 1DC3A 2NZUG 3HCDA 2HLHA 5KOHB 2VDMB 1QGZA 1DO8A 3WLEA 2HK7A 3OIDA 2HUPA 3I64A 1WMBA 4JLDA 3GEGA 4M54A 4NECA 4GRAA 4ND8B 4E33A 3A1UA 1C8LA 2BRUC 2X4DA 5JNRA 3OAAD 4MRPA 2QMYA 5B58T 2FSGA 1QNLA 1JBEA 4MB2A 5TMBA 4GI2A 1NF9A 2ZQ5A 4XB6B 2P5UA 3B3FA 4D80A 4OL0A 4E70A 2BFFB 2ZYDA 3ZWKA 1XZJA 2MSWA 2VH2A 3BXFA 4ZPXA 3IAFA 2FEPA 2G8LA 3WNQA 2QBYB 1C0PA 2HWYA 4YMSA 3OSUA 2QU7A 3O8NA 1HLDA 3ENNA 2XHEA 1ZD4A 5FPYA 1P6QA 1Z4PX 1Z6AA 2ESRA 4IEFB 4M89A 4U9UA 1E77A 3IBCA 4R7TA 3KOWA 4YFVA 1JFTA 1YCDA 5CG2A 3FSGD 2LP4Y 1Y0BA 3JALA 1JDPA 3JQ6A 4MKRA 4C87A 5L4LA 1FVHA 2IY9A 2G0TA 2ZBRA 3JWJA 4G07A 4HUJA 3ANSA 4ENRA 2WVAA 1KIMA 1PDVA 2R2AA 3LQ1A 1YZVA 2B2XA 4FQ8A 4X6LA 2HHHB 4PFKA 4I8IA 1R5JA 3CVYA 1LLFA 3BGWA 3C6XA 5EYPB 4ZHQF 3UHPA 1SCQA 3WMRA 3L0OA 2NUPA 4IF6A 3B13B 3GCZA 4C4AA 1U28A 2EZUA 4KODA 3FHLA 4MP8A 3SEQA 5C51B 2JA1A 1SKYB 1QZ3A 2ZI9A 3LKBA 4YCCA 3KKOA 5J4VA 3DEYX 4RE6A 4W5WA 4J3NA 4AX4A 3GLFA 1DKQA 3FPLA 3LUJA 3ZHYA 2PFGA 5KAMA 1P3Y1 1UFVA 2GEJA 2ZRQA 3GY0A 3S4YA 3U0VA 5IULC 4K2HA 3STWA 2VK1A 2OO7A 4OGFA 4BHTA 2CF5A 5BSHA 4O2AF 3EGCA 5D1NA 2VZ8A 2I1WA 3KAPA 4N5HX 5J5VA 2BFDA 5FWYB 1L4EA 1W36C 1QVWA 3ZYZA 3UAYA 1UXJA 5CG1A 4LXGA 3DZHA 2HEGA 3DDWA 5C7OO 4R54A 1N36B 4A10A 1FS6A 1UPTA 3JQ7A 3ML1A 4TM7A 5T4BA 4D56A 1BW9B 3QE3A 3ZGOA 2FFBA 2WIAA 2X5JO 2IXBA 2UAGA 3F9RA 1DKUA 3I9KA 3IEUA 1IAQA 3NV9A 3LO5A 4GMGA 4XD2A 2C88A 2OCYC 2IEIA 2NXWA 2ZYRA 1QANA 4KLZA 5BVGA 5I7HA 3UGTA 3G0DA 3OEEA 1XMSA 4MUJA 4WGGA 4TWZA 3VH1A 1XQ1A 4GLBA 1GQRA 4B2PA 4MUFA 1EFVA 4WFIA 2WJ4A 3OWXA 3UAXA 4WK0B 3N8DA 4NBLA 3JS5A 2QRMA 3ACBA 1CUAA 4PO3X 1CB0A 3GLHA 3DMYA 3DBOB 3IDQA 1HF3A 1E3DA 3TTTA 4G01B 3ES9A 2C5EA 1DC6A 2AXEA 4FKMA 1KH3A 3GPCA 2VBFA 3L46A 1AXEA 2E5FA 3OFJA 4AQ7A 1J7JA 2YZKA 1PD1A 1N57A 4K05A 4K6CA 3RVKA 4NU5A 5BPHA 3GVIA 4QVGA 1SXPA 3UV7A 2D0OB 1QU2A 4PSCA 3AVTA 3VU0A 4A26A 3T12A 4MVJG 2OK7A 1C9NA 1NOKA 4O5AA 3AU9A 4YALA 2AF4C 4YNBA 2Z2ZA 1K5GA 5CX1B 1XTVA 2ETVA 3FGPA 2YOGA 2DQ4A 3HUFA 3ZI7A 3G2OA 4AYWA 1EP9A 3QP9A 3KVNA 1B3BA 2C98A 2L0XA 5HE9A 1YDFA 4P33A 2VAXA 4KO3S 1PR1A 5CT9A 1CIVA 1V2GA 3TX2A 1CJTC 2H54A 3DT9A 4J4TA 4S05A 2NVWA 1MMFB 1WF6A 3FLAA 2A14A 4E11A 4DSNA 1CF9A 1MRSA 2R6GA 1JB9A 4BLSA 4IL5A 2ARKA 4CLRA 2BZGA 3CZ9A 1KEZA 4HYQA 4WXEA 5L4SA 1FUEA 3HGMA 2D1QA 4KVAA 1YS1X 4DDKA 3QUBA 5COQA 2IODA 3D5QA 1TK3A 4MWCA 2WC1A 1F3LA 2WQ6A 4HSEA 1E64A 3GJ8A 3ETJA 3LCVB 3IUYA 4WVLA 4ZTZB 2F8TA 2ALJA 4DMKA 3WAGA 4IIUA 4EKNB 4Z8XA 5TPWB 1DTWB 4B44A 2ORED 3HMQA 3OJXA 1CZKA 3K9GA 4DCNA 3M2PA 1FDIA 2CHUA 1U2DA 2ZKIA 2QM7A 4R01A 1G6Q1 3PQ2A 4GS5A 2XUZA 1DINA 1RCTE 1M2VB 4QC2A 3TNFA 4AMGA 4D97A 1GCGA 1UP4A 2DBRA 3HDVA 4WASA 4YMIA 2ILTA 2YDYA 5M7EA 3NDIA 1DI0A 1WXWA 2PL9A 4XB2A 4KACA 3PXAA 4CYMA 3CEHA 4XLLA 4PLGA 5ELXA 4LVUA 4YRTA 1LCIA 3OKFA 3RNLA 5IC4A 3G1TA 1UDAA 2J5KA 2ZRPA 4TL7A 4KQXA 3WO1A 3AFHA 3Q7PA 3WLPA 1NW3A 1T9CA 3KSRA 3TS1A 2PKXA 4MQEA 3QHPA 2HUNA 3FBWA 2CF6A 3UT0A 3OTOB 2ANCA 2IXFA 3DMRA 2NU8B 1BU8A 1P4RA 4FOTA 3QKTA 1OXUA 1K27A 2DFNA 1EA5A 4OAOA 3ZPXA 1MC8A 1VYVA 2MTBA 4UBIA 5THXA 5CFMA 4NOJA 3FTQA 1PK7A 1TA9A 2YFYA 2GWRA 1P7VA 1Z29A 2RHGB 3NC4A 3OKAA 5EG5A 4FHDA 5F3RA 4DEXA 3IEMA 3BEDA 1K5DA 3I6IA 4JQOA 2NVUB 4PSVA 5K4GA 1NXQA 1XGKA 5F7XA 1P4GA 1PR4A 3OH8A 2DMRA 4UDNA 2ID4A 4N5IX 3DV9A 4B2LA 5CHYA 5B64A 1PV1A 1OAOA 4FYJA 2QRVB 4F5YA 1Z16A 3FPHA 4KLAA 1K6IA 2OY0A 4J0CA 3W8NA 1P6XA 5E1DA 3SXJA 3EY4A 3FDIA 3IJPA 3EARA 4MEAA 4UCXA 3JQGA 2XVXA 2FZEA 3ZUGA 1DX6A 2NNLD 4O4JF 1RDFA 2O2ZA 2XZLA 3ZNOA 2FUNB 4PR0A 2PX8A 2XCLA 1W96A 3GT7A 3RS0A 4QXMA 3WLJA 3A1EA 1H5NA 1EZ1A 2RGEA 5JCXA 1OGJA 5DLPA 2RAUA 4L2IA 2FSUA 4L1KA 1F06A 3WYDA 4MVJM 3AY7A 4PAWA 5DXAA 3ZCVA 3MTBA 1EJ2A 1PVDA 2IDKA 1MNAA 1G41A 5DLYA 5DIFA 2QTNA 2R7NA 1JEQB 1DO2A 4FJ2A 4OQZA 3W7AA 3HHPA 5H02A 2PT5A 3B1FA 4KREA 2Q1WA 4U7WA 2WA2A 4P4SB 5KNDH 5KJFA 2HHCA 1QOPB 2G1PA 4IMJB 3AOEA 1JXOA 5AW7A 2G8NA 1L5SA 1P7WA 2EVWX 1YZGA 1XVTA 5KYTA 1G3IA 5DCYA 1NR1A 3RUCA 4R84A 4YUXA 1AQJA 3P8ZA 2W6NA 4HAYA 4MPRA 4XFJA 5F5XA 3W2HA 4DQUA 4KFSA 2XX3A 4MW2A 4ZPJA 2DFDA 3TN7A 2AN9A 3PXDA 3FUCA 1E0AA 3UT6A 2Z4TA 5EJ5A 4B7AA 1FLAA 3HCCA 3PD0A 1G2QA 1IU9A 3RT1A 4BMXA 4JYBA 3ZV3A 1MT3A 1WCWA 2VHEA 4JN6B 2I7XA 4LV5B 1U0EA 4OY3A 2VJQA 4LYJA 1JPUA 4OOFA 5ETJA 4O5OA 1GZUA 1ZYUA 2DQKA 3GJ5A 1XQVA 4HAUA 4CM9D 1ECCA 5AQ1A 5FUQA 1R66A 1PR6A 1HGXA 2AMFA 1E9EA 3HCEA 2UUCB 1HQCA 5CPBA 2XCUA 1ZUHA 3Q9LA 2E4VA 3MWDA 2X9GA 3TVDA 6REQB 4D44A 2EHJA 2H1CA 1JPJA 2QNBA 1COWA 4WDRA 3A05A 1MFZA 3U60B 4RV4A 3SEAA 3L82B 2PN1A 3HBMA 4UEQA 3ZIAA 5BV8A 1APBA 2VJAA 1H42A 1KJYA 2RAFA 4D9BA 1XRQA 4N3BA 4DUZB 1C3JA 1R4ZA 2A5JA 2XI4A 3D6TB 1HSOA 4JMPA 4FM9A 4DUPA 4IIBA 1GU7A 5DTEA 3SSNA 5JNVA 3H5RA 4PFQA 4ALJA 4CDNA 3B38A 2J3JA 3PF8A 1E1KA 1NQAO 5C7LO 2FDCA 3G6WA 4NQZA 4J90A 5U9CA 4IJMA 4P2BA 3H11B 1YWGO 4UBLA 4X8MA 2VDJA 2Y05A 3R6LA 3LQRA 2GZSA 4FEEA 4I4TA 4M86A 3ZW9A 4F4HA 5C53B 5E95A 1YR7A 4O2LA 1QZUA 1QP4A 2G04A 5EWJB 5F7ZA 3K9WA 5K45A 3EVNA 2VP4A 3LW7A 4V0RA 2VHVA 1TA0A 3OBBA 3DO5A 4AULA 1ECBA 2D3WA 1N5OX 4JGGA 3MWKA 5I6DA 2QVBA 3IO3A 3UBTA 3L4KA 1EP1B 2WUEA 4IFTA 4JOSA 4KI0A 4J3FA 4LYYA 3G2PA 4BFVA 3FCCA 4E1BA 2RGBA 4Q3OA 2NN3C 3NHSA 1G8SA 2TSYB 4NYIQ 4TZTA 4U3JB 4Y2SA 1E1RD 1NX6A 3C6QA 5AXAA 3PCTA 4Q93A 4L73A 3S0JA 1V45E 3EVTA 3P2JA 5AJYA 2B37A 3L43A 4YV2A 1E3IA 3CMCO 1M2JA 3T3MB 1IN6A 3BHIA 2J0SA 1FXWA 1T8UA 1RQLA 1OI4A 3ESQA 2IQ5A 4JDPA 2V7QA 4PG4A 5EJ2A 4DIMA 4V02A 5EIAA 1GNRA 1ZNQO 3HDQA 4A4DA 2R7MA 4ZAFA 4EFNA 2X4IA 5EI5A 1TMYA 5HE8A 5J40A 1OOEA 5JVDF 2Z6AA 1E1YA 2HMYB 5J3JA 1GZ7A 4HEQA 3DT8A 5I3ZA 5FI3A 1PK8A 1MHPA 4UEWA 5H5JA 3Q40A 1ZRHA 5HGJA 3LX6A 4RCYA 4BX9A 3HJUA 2HSZA 2BM9A 2D2FA 3HWSA 4DZTA 1U31A 4GI1A 4FZ3A 4BDSA 2QE7D 3G0GA 4GAEA 1M8FA 5L3QB 3QU2A 3QKRA 1C4WA 1GGNA 1PQPA 2F62A 3X1KA 4L22A 1PLJA 4GNKA 2KX7A 4G0ZA 4PX2A 3ANTA 3RBVA 1LC3A 4C3ZA 3K70C 1LQ2A 1PBTA 5GGXA 3B8EA 3KUCA 4MW6A 1XEAA 1AURA 2BHTA 1DUSA 2ENWA 2QR3A 5GIPE 3AY6A 1JNXX 4P3YA 4OHZA 1GDHA 4UNPA 5CA1F 2F17A 1D4FA 3EGDA 1Z15A 1ZJYA 1YQGA 2FSPA 1TVEA 1THZA 3EJWA 2NU7A 3H65A 4U6NA 1Y9AA 1XZCA 2PIDA 3TIGA 4B0OA 1HDYA 4NE2A 4MI3A 5CBPB 1OA0A 3QMPA 4LECA 2I4TA 3ZJUA 5J4KA <