1CR5A

N-terminal domain of sec18p
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
178
Chain Sequence
TRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIIIDNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVATGIETKGILTKQTQINFFKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords SEC18P (RESIDUES 22 - 210)
publication title Crystal structure of the Sec18p N-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 178
sequence length 185
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cr5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cr5A02
1E32A 2C45A 1ZC1A 3HKZA 3QC8A 1K83A 1PYUB 2YUJA 4CS0A 4CRZA 1G8JA 1FDOA 4RV0A 4KLNA 2V3VA 3HU3A 3GTGA 3GTMA 1SIWA 1H0HA 1E60A 2WB1A 1PQFA 3IR6A 4KDLA 3QQ8A 2JIQA 1PQHA 3GTPA 2R92A 1PPYA 5DYIA 1TWGA 1WLFA 2E2IA 1E18A 2JIPA 5EPPA 5DYGA 1EU1A 2NVYA 2JA5A 3QWZA 3PLXB 1TWFA 2DMRA 2VUMA 1Y1WA 3CQZA 3HU2A 4KODA 4C2MA 3ML1A 1I50A 2JIOA 1AW8B 4GA5A 5FTMA 3GTKA 3FKIA 1UHEA 1PT0A 5T5ID 1VC3B 1WCMA 3GTQA 3O5AA 1Y5IA 2E2HA 1TWCA 4DMRA 1AA6A 1R27A 2PMZA 4D7ZB 5FTNA 1TWHA 2JA6A 1SFOA 3QQ7A 4AOKB 3GTJA 1Y4ZA 1Y1VA 3HU1A 2VPWA 3GTLA 3GTOA 3H0GA 2KI8A 2PJHB 2NYAA 5FTLA 2JA7A 1G8KA 3OUGA 1PT1A 1Q16A 1H5NA 4AZDA 1PYQA 1YLEA 4QIWA 2JV2A 1OGYA 4AAYA 5B6CA 1E5VA 2R93A 1CZ5A 2IV2X 5GLFA 2R7ZA 1I3QA 1CZ4A 2B63A 1QCSA 1QDNA 1KQGA 4GA6A 1CR5A 1DMRA 3TIWA 1IW7D 1R7RA 1R9TA 1S3SA 2NVXA 1DMSA 2VPZA 4AONB 1TWAA 5C1BA 1FDIA 2VPYA 2EEOB 4CRYG 3IR5A 2V45A 3DMRA 2Y0SA 3CF2A 1UHDA 3IR7A 5FTJA 2VPXA 5C18A 2NAPA 5FTKA 4KO8A 4AYBA 3TM7B 2JIRA 1TMOA 1PQEA 2E7ZA 1KQFA 2YU9A 2WAQA 4KDIA 5T5MD 2JIMA 1E61A
chains in the Genus database with same CATH superfamily
1E32A 2C45A 2XDPA 1ZC1A 3HKZA 3QC8A 2PWYA 1K83A 1PYUB 2YUJA 4CS0A 3ZJVA 4CRZA 1G8JA 1FDOA 4RV0A 4KLNA 2V3VA 3SUKA 3HU3A 3X2IA 3GTGA 3GTMA 1SIWA 1H0HA 1I9GA 5ERGB 1E60A 2A6ED 5CCXA 2WB1A 1PQFA 3IR6A 4KDLA 3QQ8A 2JIQA 3FPUA 1PQHA 3ZJUA 3GTPA 2A68D 1PPYA 3SULA 5DYIA 2R92A 1TWGA 4FIBA 4FERA 1WLFA 1OA9A 2E2IA 1E18A 3LHDA 3X2HA 2JIPA 2GAEA 2MM0A 4ARIA 2AE0X 5EPPA 2HCZX 5DYGA 2KY9A 1EU1A 2NVYA 4L48A 3BQBA 2BE5D 2KQAA 2JA5A 3QWZA 3PLXB 2QQSA 1TWFA 2DMRA 4JCWA 2VUMA 1Y1WA 3CQZA 3HU2A 4KODA 4C2MA 3ML1A 3LGAA 1SMYD 3SUMA 2JIOA 1HD5A 1AW8B 4GA5A 5FTMA 1I50A 3FKIA 3GTKA 4ARCA 1UHEA 3FPRA 1PT0A 4FG4A 2B25A 3X2LA 4AQ7A 5T5ID 1VC3B 1WC2A 4UC4A 5GM9A 2PNWA 1WCMA 3GTQA 3O5AA 1Y5IA 2E2HA 2GFAA 4JS7A 2YVLA 1TWCA 4DMRA 1AA6A 1R27A 2PMZA 4D7ZB 5FTNA 1TWHA 2JA6A 1O54A 2A6HD 1SFOA 5EQJB 5CCBA 1OA7A 3QQ7A 4AOKB 3GTJA 1Y4ZA 1Y1VA 1ZYRD 3HU1A 4AVRA 2CW0D 2VPWA 3X2MA 3GTLA 3CZBA 3GTOA 2Q1CX 3MB5A 3H0GA 3X2JA 2KI8A 2A69D 2PJHB 4JJOA 3SUJA 2NYAA 5GLYA 4ENGA 5FTLA 3M3GA 2JA7A 5GLXA 1G8KA 3OUGA 1PT1A 1Q16A 2Q1AX 1H5NA 2PJJA 4AZDA 4ZM7A 2PICA 3ENGA 1PYQA 1YLEA 4QIWA 2JV2A 1OGYA 2ENGA 4AAYA 5B6CA 1E5VA 4FG2A 2R93A 1CZ5A 2Q18X 3X2GA 2PI8A 2IV2X 3ZJTA 5GLFA 2GF7A 1YNJD 2R7ZA 2O5JD 1I3QA 2Q19X 2G6GA 1CZ4A 2B63A 1QCSA 1QDNA 1KQGA 1L8FA 1YNND 4GA6A 2LW6A 1CR5A 3D30A 5D6YA 1DMRA 3TIWA 1IW7D 4NOHA 5CD1A 1R7RA 1R9TA 1S3SA 2NVXA 1DMSA 4AS1A 2VPZA 4AONB 1TWAA 5C1BA 5H4UA 1FDIA 2VPYA 2EEOB 2Q1DX 3X2PA 4CRYG 5D6XA 1BW4A 2MM2A 3IR5A 3FPTA 2V45A 4FFTA 3DMRA 2Y0SA 3CF2A 1UHDA 3IR7A 1BW3A 5FTJA 2VPXA 2BH0A 2G5DA 3X2NA 2NAPA 5FTKA 5C18A 4KO8A 4AYBA 3TM7B 2JIRA 1TMOA 3ZGZA 1PQEA 5D6WA 2E7ZA 1KQFA 1N10A 4JP7A 2YU9A 3X2KA 2WAQA 4KDIA 3X2OA 2QQRA 4JP6A 4CQNA 5T5MD 2JIMA 1E61A
chains in the Genus database with same CATH topology
1E32A 2C45A 2XDPA 1ZC1A 3HKZA 3QC8A 2PWYA 1K83A 1PYUB 2YUJA 4CS0A 3ZJVA 4CRZA 1G8JA 1FDOA 4RV0A 4KLNA 2V3VA 3HU3A 3GTGA 3GTMA 1SIWA 1H0HA 1I9GA 5ERGB 1E60A 2A6ED 5CCXA 2WB1A 1PQFA 3IR6A 4KDLA 3QQ8A 2JIQA 3FPUA 1PQHA 3ZJUA 3GTPA 2A68D 1PPYA 2R92A 5DYIA 4FIBA 1TWGA 1WLFA 2E2IA 1E18A 3LHDA 2JIPA 2GAEA 2MM0A 4ARIA 2AE0X 5EPPA 5DYGA 2KY9A 1EU1A 2NVYA 3BQBA 2BE5D 2JA5A 3QWZA 3PLXB 2QQSA 1TWFA 2DMRA 2VUMA 1Y1WA 3CQZA 3HU2A 4KODA 4C2MA 3ML1A 3LGAA 1SMYD 1I50A 2JIOA 1AW8B 4GA5A 5FTMA 3GTKA 3FKIA 4ARCA 1UHEA 3FPRA 1PT0A 2B25A 4AQ7A 5T5ID 1VC3B 4UC4A 2PNWA 1WCMA 3GTQA 3O5AA 1Y5IA 2E2HA 2GFAA 2YVLA 1TWCA 4DMRA 1AA6A 1R27A 2PMZA 4D7ZB 5FTNA 1TWHA 2JA6A 1O54A 2A6HD 1SFOA 5EQJB 5CCBA 3QQ7A 4AOKB 3GTJA 1Y4ZA 1Y1VA 1ZYRD 3HU1A 2Q1CX 2CW0D 2VPWA 3GTLA 3CZBA 3GTOA 3MB5A 3H0GA 2KI8A 2A69D 2PJHB 2NYAA 5FTLA 2JA7A 1G8KA 3OUGA 1PT1A 1Q16A 2Q1AX 1H5NA 2PJJA 4AZDA 2PICA 1PYQA 1YLEA 4QIWA 2JV2A 1OGYA 4AAYA 5B6CA 1E5VA 2R93A 1CZ5A 2Q18X 2PI8A 2IV2X 3ZJTA 5GLFA 2GF7A 1YNJD 2R7ZA 2O5JD 1I3QA 2Q19X 2G6GA 1CZ4A 2B63A 1QCSA 1QDNA 1KQGA 1YNND 4GA6A 2LW6A 1CR5A 5D6YA 1DMRA 3TIWA 1IW7D 4NOHA 5CD1A 1R7RA 1R9TA 1S3SA 2NVXA 1DMSA 4AS1A 2VPZA 4AONB 1TWAA 5C1BA 1FDIA 2VPYA 2EEOB 2Q1DX 4CRYG 5D6XA 2MM2A 3IR5A 3FPTA 2V45A 3DMRA 2Y0SA 3CF2A 1UHDA 3IR7A 5FTJA 2VPXA 2G5DA 5C18A 2NAPA 5FTKA 4KO8A 4AYBA 3TM7B 2JIRA 1TMOA 3ZGZA 1PQEA 5D6WA 2E7ZA 1KQFA 2YU9A 2WAQA 4KDIA 2QQRA 4CQNA 5T5MD 2JIMA 1E61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E32 A;  2C45 A;  1ZC1 A;  3HKZ A;  3QC8 A;  1K83 A;  1PYU B;  2YUJ A;  4CS0 A;  4CRZ A;  1G8J A;  1FDO A;  4RV0 A;  4KLN A;  2V3V A;  3HU3 A;  3GTG A;  3GTM A;  1SIW A;  1H0H A;  1E60 A;  2WB1 A;  1PQF A;  3IR6 A;  4KDL A;  3QQ8 A;  2JIQ A;  1PQH A;  3GTP A;  2R92 A;  1PPY A;  5DYI A;  1TWG A;  1WLF A;  2E2I A;  1E18 A;  2JIP A;  5EPP A;  5DYG A;  1EU1 A;  2NVY A;  2JA5 A;  3QWZ A;  3PLX B;  1TWF A;  2DMR A;  2VUM A;  1Y1W A;  3CQZ A;  3HU2 A;  4KOD A;  4C2M A;  3ML1 A;  1I50 A;  2JIO A;  1AW8 B;  4GA5 A;  5FTM A;  3GTK A;  3FKI A;  1UHE A;  1PT0 A;  5T5I D;  1VC3 B;  1WCM A;  3GTQ A;  3O5A A;  1Y5I A;  2E2H A;  1TWC A;  4DMR A;  1AA6 A;  1R27 A;  2PMZ A;  4D7Z B;  5FTN A;  1TWH A;  2JA6 A;  1SFO A;  3QQ7 A;  4AOK B;  3GTJ A;  1Y4Z A;  1Y1V A;  3HU1 A;  2VPW A;  3GTL A;  3GTO A;  3H0G A;  2KI8 A;  2PJH B;  2NYA A;  5FTL A;  2JA7 A;  1G8K A;  3OUG A;  1PT1 A;  1Q16 A;  1H5N A;  4AZD A;  1PYQ A;  1YLE A;  4QIW A;  2JV2 A;  1OGY A;  4AAY A;  5B6C A;  1E5V A;  2R93 A;  1CZ5 A;  2IV2 X;  5GLF A;  2R7Z A;  1I3Q A;  1CZ4 A;  2B63 A;  1QCS A;  1QDN A;  1KQG A;  4GA6 A;  1CR5 A;  1DMR A;  3TIW A;  1IW7 D;  1R7R A;  1R9T A;  1S3S A;  2NVX A;  1DMS A;  2VPZ A;  4AON B;  1TWA A;  5C1B A;  1FDI A;  2VPY A;  2EEO B;  4CRY G;  3IR5 A;  2V45 A;  3DMR A;  2Y0S A;  3CF2 A;  1UHD A;  3IR7 A;  5FTJ A;  2VPX A;  5C18 A;  2NAP A;  5FTK A;  4KO8 A;  4AYB A;  3TM7 B;  2JIR A;  1TMO A;  1PQE A;  2E7Z A;  1KQF A;  2YU9 A;  2WAQ A;  4KDI A;  5T5M D;  2JIM A;  1E61 A; 
#chains in the Genus database with same CATH topology
 1E32 A;  2C45 A;  2XDP A;  1ZC1 A;  3HKZ A;  3QC8 A;  2PWY A;  1K83 A;  1PYU B;  2YUJ A;  4CS0 A;  3ZJV A;  4CRZ A;  1G8J A;  1FDO A;  4RV0 A;  4KLN A;  2V3V A;  3SUK A;  3HU3 A;  3X2I A;  3GTG A;  3GTM A;  1SIW A;  1H0H A;  1I9G A;  5ERG B;  1E60 A;  2A6E D;  5CCX A;  2WB1 A;  1PQF A;  3IR6 A;  4KDL A;  3QQ8 A;  2JIQ A;  3FPU A;  1PQH A;  3ZJU A;  3GTP A;  2A68 D;  1PPY A;  3SUL A;  5DYI A;  2R92 A;  1TWG A;  4FIB A;  4FER A;  1WLF A;  1OA9 A;  2E2I A;  1E18 A;  3LHD A;  3X2H A;  2JIP A;  2GAE A;  2MM0 A;  4ARI A;  2AE0 X;  5EPP A;  2HCZ X;  5DYG A;  2KY9 A;  1EU1 A;  2NVY A;  4L48 A;  3BQB A;  2BE5 D;  2KQA A;  2JA5 A;  3QWZ A;  3PLX B;  2QQS A;  1TWF A;  2DMR A;  4JCW A;  2VUM A;  1Y1W A;  3CQZ A;  3HU2 A;  4KOD A;  4C2M A;  3ML1 A;  3LGA A;  1SMY D;  3SUM A;  2JIO A;  1HD5 A;  1AW8 B;  4GA5 A;  5FTM A;  1I50 A;  3FKI A;  3GTK A;  4ARC A;  1UHE A;  3FPR A;  1PT0 A;  4FG4 A;  2B25 A;  3X2L A;  4AQ7 A;  5T5I D;  1VC3 B;  1WC2 A;  4UC4 A;  5GM9 A;  2PNW A;  1WCM A;  3GTQ A;  3O5A A;  1Y5I A;  2E2H A;  2GFA A;  4JS7 A;  2YVL A;  1TWC A;  4DMR A;  1AA6 A;  1R27 A;  2PMZ A;  4D7Z B;  5FTN A;  1TWH A;  2JA6 A;  1O54 A;  2A6H D;  1SFO A;  5EQJ B;  5CCB A;  1OA7 A;  3QQ7 A;  4AOK B;  3GTJ A;  1Y4Z A;  1Y1V A;  1ZYR D;  3HU1 A;  4AVR A;  2CW0 D;  2VPW A;  3X2M A;  3GTL A;  3CZB A;  3GTO A;  2Q1C X;  3MB5 A;  3H0G A;  3X2J A;  2KI8 A;  2A69 D;  2PJH B;  4JJO A;  3SUJ A;  2NYA A;  5GLY A;  4ENG A;  5FTL A;  3M3G A;  2JA7 A;  5GLX A;  1G8K A;  3OUG A;  1PT1 A;  1Q16 A;  2Q1A X;  1H5N A;  2PJJ A;  4AZD A;  4ZM7 A;  2PIC A;  3ENG A;  1PYQ A;  1YLE A;  4QIW A;  2JV2 A;  1OGY A;  2ENG A;  4AAY A;  5B6C A;  1E5V A;  4FG2 A;  2R93 A;  1CZ5 A;  2Q18 X;  3X2G A;  2PI8 A;  2IV2 X;  3ZJT A;  5GLF A;  2GF7 A;  1YNJ D;  2R7Z A;  2O5J D;  1I3Q A;  2Q19 X;  2G6G A;  1CZ4 A;  2B63 A;  1QCS A;  1QDN A;  1KQG A;  1L8F A;  1YNN D;  4GA6 A;  2LW6 A;  1CR5 A;  3D30 A;  5D6Y A;  1DMR A;  3TIW A;  1IW7 D;  4NOH A;  5CD1 A;  1R7R A;  1R9T A;  1S3S A;  2NVX A;  1DMS A;  4AS1 A;  2VPZ A;  4AON B;  1TWA A;  5C1B A;  5H4U A;  1FDI A;  2VPY A;  2EEO B;  2Q1D X;  3X2P A;  4CRY G;  5D6X A;  1BW4 A;  2MM2 A;  3IR5 A;  3FPT A;  2V45 A;  4FFT A;  3DMR A;  2Y0S A;  3CF2 A;  1UHD A;  3IR7 A;  1BW3 A;  5FTJ A;  2VPX A;  2BH0 A;  2G5D A;  3X2N A;  2NAP A;  5FTK A;  5C18 A;  4KO8 A;  4AYB A;  3TM7 B;  2JIR A;  1TMO A;  3ZGZ A;  1PQE A;  5D6W A;  2E7Z A;  1KQF A;  1N10 A;  4JP7 A;  2YU9 A;  3X2K A;  2WAQ A;  4KDI A;  3X2O A;  2QQR A;  4JP6 A;  4CQN A;  5T5M D;  2JIM A;  1E61 A; 
#chains in the Genus database with same CATH homology
 1E32 A;  2C45 A;  2XDP A;  1ZC1 A;  3HKZ A;  3QC8 A;  2PWY A;  1K83 A;  1PYU B;  2YUJ A;  4CS0 A;  3ZJV A;  4CRZ A;  1G8J A;  1FDO A;  4RV0 A;  4KLN A;  2V3V A;  3HU3 A;  3GTG A;  3GTM A;  1SIW A;  1H0H A;  1I9G A;  5ERG B;  1E60 A;  2A6E D;  5CCX A;  2WB1 A;  1PQF A;  3IR6 A;  4KDL A;  3QQ8 A;  2JIQ A;  3FPU A;  1PQH A;  3ZJU A;  3GTP A;  2A68 D;  1PPY A;  2R92 A;  5DYI A;  4FIB A;  1TWG A;  1WLF A;  2E2I A;  1E18 A;  3LHD A;  2JIP A;  2GAE A;  2MM0 A;  4ARI A;  2AE0 X;  5EPP A;  5DYG A;  2KY9 A;  1EU1 A;  2NVY A;  3BQB A;  2BE5 D;  2JA5 A;  3QWZ A;  3PLX B;  2QQS A;  1TWF A;  2DMR A;  2VUM A;  1Y1W A;  3CQZ A;  3HU2 A;  4KOD A;  4C2M A;  3ML1 A;  3LGA A;  1SMY D;  1I50 A;  2JIO A;  1AW8 B;  4GA5 A;  5FTM A;  3GTK A;  3FKI A;  4ARC A;  1UHE A;  3FPR A;  1PT0 A;  2B25 A;  4AQ7 A;  5T5I D;  1VC3 B;  4UC4 A;  2PNW A;  1WCM A;  3GTQ A;  3O5A A;  1Y5I A;  2E2H A;  2GFA A;  2YVL A;  1TWC A;  4DMR A;  1AA6 A;  1R27 A;  2PMZ A;  4D7Z B;  5FTN A;  1TWH A;  2JA6 A;  1O54 A;  2A6H D;  1SFO A;  5EQJ B;  5CCB A;  3QQ7 A;  4AOK B;  3GTJ A;  1Y4Z A;  1Y1V A;  1ZYR D;  3HU1 A;  2Q1C X;  2CW0 D;  2VPW A;  3GTL A;  3CZB A;  3GTO A;  3MB5 A;  3H0G A;  2KI8 A;  2A69 D;  2PJH B;  2NYA A;  5FTL A;  2JA7 A;  1G8K A;  3OUG A;  1PT1 A;  1Q16 A;  2Q1A X;  1H5N A;  2PJJ A;  4AZD A;  2PIC A;  1PYQ A;  1YLE A;  4QIW A;  2JV2 A;  1OGY A;  4AAY A;  5B6C A;  1E5V A;  2R93 A;  1CZ5 A;  2Q18 X;  2PI8 A;  2IV2 X;  3ZJT A;  5GLF A;  2GF7 A;  1YNJ D;  2R7Z A;  2O5J D;  1I3Q A;  2Q19 X;  2G6G A;  1CZ4 A;  2B63 A;  1QCS A;  1QDN A;  1KQG A;  1YNN D;  4GA6 A;  2LW6 A;  1CR5 A;  5D6Y A;  1DMR A;  3TIW A;  1IW7 D;  4NOH A;  5CD1 A;  1R7R A;  1R9T A;  1S3S A;  2NVX A;  1DMS A;  4AS1 A;  2VPZ A;  4AON B;  1TWA A;  5C1B A;  1FDI A;  2VPY A;  2EEO B;  2Q1D X;  4CRY G;  5D6X A;  2MM2 A;  3IR5 A;  3FPT A;  2V45 A;  3DMR A;  2Y0S A;  3CF2 A;  1UHD A;  3IR7 A;  5FTJ A;  2VPX A;  2G5D A;  5C18 A;  2NAP A;  5FTK A;  4KO8 A;  4AYB A;  3TM7 B;  2JIR A;  1TMO A;  3ZGZ A;  1PQE A;  5D6W A;  2E7Z A;  1KQF A;  2YU9 A;  2WAQ A;  4KDI A;  2QQR A;  4CQN A;  5T5M D;  2JIM A;  1E61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...