1CR5A

N-terminal domain of sec18p
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
178
Chain Sequence
TRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIIIDNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVATGIETKGILTKQTQINFFKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC18P (RESIDUES 22 - 210)
publication title Crystal structure of the Sec18p N-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
total genus 51
structure length 178
sequence length 185
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cr5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cr5A02
2WB1A 1I3QA 1E32A 1K83A 1UHDA 3GTJA 4AOKB 1PQEA 5FTJA 1KQFA 1PT1A 2E2HA 2VPZA 2YUJA 2PJHB 3IR7A 1G8JA 2VUMA 2KI8A 2R92A 5FTMA 2C45A 4D7ZB 2R7ZA 4KDLA 4DMRA 5GLFA 1TWAA 3GTPA 3TM7B 1SIWA 2JIRA 3CQZA 2VPWA 1OGYA 3HU3A 1R7RA 1YLEA 1R27A 2NYAA 5DYGA 1UHEA 1I50A 4CRYG 1E60A 1TWFA 3QWZA 4C2MA 3PLXB 5C18A 1PYQA 1VC3B 3H0GA 2JA5A 3HKZA 4CRZA 1KQGA 4AAYA 2DMRA 4AONB 1QCSA 5DYIA 4CS0A 5FTLA 3QQ7A 3GTQA 4KO8A 1DMRA 2R93A 2Y0SA 1ZC1A 2VPXA 1H0HA 1CZ4A 1PPYA 3OUGA 1PQHA 4AZDA 2JIPA 4RV0A 1Y5IA 1WLFA 1EU1A 1TWHA 2JIMA 3GTOA 1TWCA 3ML1A 2JIQA 1DMSA 3O5AA 2YU9A 2E2IA 2JIOA 1Q16A 4GA6A 4GA5A 5B6CA 1E18A 3HU1A 1IW7D 1PT0A 2NVXA 3HU2A 5FTKA 3GTLA 1TWGA 1H5NA 2E7ZA 2NAPA 2B63A 1E61A 3FKIA 4AYBA 1FDIA 3CF2A 4KLNA 1G8KA 4KODA 3QC8A 1Y1VA 2IV2X 1Y1WA 1R9TA 1FDOA 3IR6A 1QDNA 1SFOA 1Y4ZA 3TIWA 1CR5A 4QIWA 1WCMA 1AA6A 5EPPA 5T5MD 1S3SA 3GTGA 1AW8B 3DMRA 5T5ID 2JV2A 4KDIA 2V45A 2VPYA 3QQ8A 1CZ5A 1PYUB 1TMOA 2PMZA 2NVYA 2JA7A 5FTNA 2V3VA 3GTKA 1E5VA 2EEOB 3IR5A 2JA6A 2WAQA 3GTMA 5C1BA 1PQFA
chains in the Genus database with same CATH superfamily
2WB1A 3BQBA 3X2HA 1E32A 1I3QA 1K83A 1UHDA 3GTJA 5ERGB 3D30A 4AOKB 2CW0D 3X2KA 1PQEA 5FTJA 3FPTA 1KQFA 1PT1A 3X2JA 2VPZA 2E2HA 1BW3A 2MM0A 2YUJA 2PJHB 4JJOA 3X2NA 3IR7A 2PNWA 1G8JA 4L48A 4FG4A 2VUMA 3X2MA 2KI8A 2R92A 2PJJA 5FTMA 2C45A 4D7ZB 4NOHA 2R7ZA 4UC4A 4KDLA 2PWYA 3ZJTA 4DMRA 5GLFA 1TWAA 2G6GA 3GTPA 4AVRA 2Q19X 5D6WA 2BH0A 1OA9A 4ZM7A 3TM7B 1SIWA 2JIRA 3CQZA 2VPWA 2LW6A 1OGYA 3HU3A 1I9GA 1R7RA 1YLEA 1R27A 3LHDA 2KQAA 2NYAA 5H4UA 1ZYRD 2QQSA 3X2IA 4JP7A 3SUJA 5DYGA 1UHEA 2KY9A 1I50A 3MB5A 5D6YA 4CRYG 4CQNA 3SULA 4AQ7A 1E60A 1TWFA 3QWZA 4C2MA 2A6ED 3PLXB 5C18A 1WC2A 4AS1A 1PYQA 2Q18X 1VC3B 3X2OA 3H0GA 2PICA 2JA5A 4JS7A 3HKZA 4CRZA 1KQGA 3ZJVA 4AAYA 2DMRA 4FFTA 2XDPA 2YVLA 3LGAA 4AONB 1QCSA 1HD5A 5DYIA 4CS0A 5FTLA 2QQRA 3QQ7A 3GTQA 4KO8A 1DMRA 2R93A 1O54A 2Y0SA 2B25A 1ZC1A 2VPXA 5GLXA 3FPRA 2Q1AX 2A69D 1OA7A 1H0HA 2Q1DX 1CZ4A 2A6HD 1PPYA 3OUGA 5CCXA 1PQHA 3SUKA 4AZDA 2JIPA 4RV0A 4FG2A 4ARCA 1Y5IA 5CCBA 1WLFA 3ZGZA 1EU1A 1TWHA 2JIMA 3GTOA 2AE0X 1TWCA 3ML1A 2JIQA 1DMSA 3O5AA 2YU9A 2G5DA 2E2IA 2JIOA 4FIBA 1Q16A 4GA6A 4GA5A 1BW4A 5B6CA 1E18A 3HU1A 1IW7D 3X2PA 1PT0A 2NVXA 2PI8A 3HU2A 4JP6A 1YNND 5FTKA 3GTLA 5GM9A 3SUMA 3ZJUA 1TWGA 4ENGA 1H5NA 2E7ZA 2NAPA 2B63A 5EQJB 1E61A 3FKIA 4AYBA 1FDIA 5D6XA 3CF2A 4KLNA 2Q1CX 1G8KA 4KODA 3QC8A 2GAEA 1Y1VA 2O5JD 2IV2X 1Y1WA 1L8FA 1R9TA 1FDOA 1N10A 1QDNA 3IR6A 4FERA 1Y4ZA 1SFOA 2GF7A 1SMYD 3TIWA 3M3GA 1CR5A 4JCWA 4QIWA 2MM2A 3FPUA 1WCMA 1AA6A 5EPPA 5T5MD 1S3SA 3GTGA 1AW8B 3DMRA 5GLYA 5T5ID 2A68D 2JV2A 4KDIA 5C1BA 2V45A 3X2GA 5CD1A 2HCZX 2VPYA 3QQ8A 1CZ5A 1PYUB 3X2LA 1TMOA 2PMZA 1YNJD 2GFAA 4ARIA 2NVYA 2JA7A 5FTNA 2ENGA 2V3VA 3GTKA 1E5VA 2EEOB 3ENGA 3IR5A 2JA6A 2WAQA 3GTMA 3CZBA 2BE5D 1PQFA
chains in the Genus database with same CATH topology
2WB1A 3BQBA 1I3QA 1E32A 1K83A 1UHDA 3GTJA 5ERGB 4AOKB 2CW0D 1PQEA 5FTJA 3FPTA 1KQFA 1PT1A 2E2HA 2VPZA 2MM0A 2YUJA 2PJHB 3IR7A 2PNWA 1G8JA 2VUMA 2KI8A 2R92A 2PJJA 5FTMA 2C45A 4D7ZB 4NOHA 2R7ZA 4UC4A 4KDLA 2PWYA 3ZJTA 4DMRA 5GLFA 1TWAA 2G6GA 3GTPA 2Q19X 5D6WA 3TM7B 1SIWA 2JIRA 3CQZA 2VPWA 2LW6A 1OGYA 3HU3A 1I9GA 1R7RA 1YLEA 1R27A 3LHDA 2NYAA 1ZYRD 2QQSA 5DYGA 1UHEA 2KY9A 1I50A 3MB5A 5D6YA 4CRYG 4CQNA 4AQ7A 1E60A 1TWFA 3QWZA 4C2MA 2A6ED 3PLXB 5C18A 4AS1A 1PYQA 2Q18X 1VC3B 3H0GA 2PICA 2JA5A 3HKZA 4CRZA 1KQGA 3ZJVA 4AAYA 2DMRA 2XDPA 2YVLA 3LGAA 4AONB 1QCSA 5DYIA 4CS0A 5FTLA 2QQRA 3QQ7A 3GTQA 4KO8A 1DMRA 2R93A 1O54A 2Y0SA 2B25A 1ZC1A 2VPXA 3FPRA 2Q1AX 2A69D 1H0HA 2Q1DX 1CZ4A 2A6HD 1PPYA 3OUGA 5CCXA 1PQHA 4AZDA 2JIPA 4RV0A 4ARCA 1Y5IA 5CCBA 1WLFA 3ZGZA 1EU1A 1TWHA 2JIMA 3GTOA 2AE0X 1TWCA 3ML1A 2JIQA 1DMSA 3O5AA 2YU9A 2G5DA 2E2IA 2JIOA 4FIBA 1Q16A 4GA6A 4GA5A 5B6CA 1E18A 3HU1A 1IW7D 1PT0A 2NVXA 2PI8A 3HU2A 1YNND 5FTKA 3GTLA 3ZJUA 1TWGA 1H5NA 2E7ZA 2NAPA 2B63A 5EQJB 1E61A 3FKIA 4AYBA 1FDIA 5D6XA 3CF2A 4KLNA 2Q1CX 1G8KA 4KODA 3QC8A 2GAEA 1Y1VA 2O5JD 2IV2X 1Y1WA 1R9TA 1FDOA 3IR6A 1QDNA 1SFOA 2GF7A 1Y4ZA 5CD1A 1SMYD 3TIWA 3FPUA 1CR5A 4QIWA 2MM2A 1WCMA 1AA6A 5EPPA 5T5MD 1S3SA 3GTGA 1AW8B 3DMRA 5T5ID 2A68D 2JV2A 4KDIA 5C1BA 2V45A 2VPYA 3QQ8A 1CZ5A 1PYUB 1TMOA 2PMZA 1YNJD 2GFAA 4ARIA 2NVYA 2JA7A 5FTNA 2V3VA 3GTKA 1E5VA 2EEOB 3IR5A 2JA6A 2WAQA 3GTMA 3CZBA 2BE5D 1PQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 A;  1I3Q A;  1E32 A;  1K83 A;  1UHD A;  3GTJ A;  4AOK B;  1PQE A;  5FTJ A;  1KQF A;  1PT1 A;  2E2H A;  2VPZ A;  2YUJ A;  2PJH B;  3IR7 A;  1G8J A;  2VUM A;  2KI8 A;  2R92 A;  5FTM A;  2C45 A;  4D7Z B;  2R7Z A;  4KDL A;  4DMR A;  5GLF A;  1TWA A;  3GTP A;  3TM7 B;  1SIW A;  2JIR A;  3CQZ A;  2VPW A;  1OGY A;  3HU3 A;  1R7R A;  1YLE A;  1R27 A;  2NYA A;  5DYG A;  1UHE A;  1I50 A;  4CRY G;  1E60 A;  1TWF A;  3QWZ A;  4C2M A;  3PLX B;  5C18 A;  1PYQ A;  1VC3 B;  3H0G A;  2JA5 A;  3HKZ A;  4CRZ A;  1KQG A;  4AAY A;  2DMR A;  4AON B;  1QCS A;  5DYI A;  4CS0 A;  5FTL A;  3QQ7 A;  3GTQ A;  4KO8 A;  1DMR A;  2R93 A;  2Y0S A;  1ZC1 A;  2VPX A;  1H0H A;  1CZ4 A;  1PPY A;  3OUG A;  1PQH A;  4AZD A;  2JIP A;  4RV0 A;  1Y5I A;  1WLF A;  1EU1 A;  1TWH A;  2JIM A;  3GTO A;  1TWC A;  3ML1 A;  2JIQ A;  1DMS A;  3O5A A;  2YU9 A;  2E2I A;  2JIO A;  1Q16 A;  4GA6 A;  4GA5 A;  5B6C A;  1E18 A;  3HU1 A;  1IW7 D;  1PT0 A;  2NVX A;  3HU2 A;  5FTK A;  3GTL A;  1TWG A;  1H5N A;  2E7Z A;  2NAP A;  2B63 A;  1E61 A;  3FKI A;  4AYB A;  1FDI A;  3CF2 A;  4KLN A;  1G8K A;  4KOD A;  3QC8 A;  1Y1V A;  2IV2 X;  1Y1W A;  1R9T A;  1FDO A;  3IR6 A;  1QDN A;  1SFO A;  1Y4Z A;  3TIW A;  1CR5 A;  4QIW A;  1WCM A;  1AA6 A;  5EPP A;  5T5M D;  1S3S A;  3GTG A;  1AW8 B;  3DMR A;  5T5I D;  2JV2 A;  4KDI A;  2V45 A;  2VPY A;  3QQ8 A;  1CZ5 A;  1PYU B;  1TMO A;  2PMZ A;  2NVY A;  2JA7 A;  5FTN A;  2V3V A;  3GTK A;  1E5V A;  2EEO B;  3IR5 A;  2JA6 A;  2WAQ A;  3GTM A;  5C1B A;  1PQF A; 
#chains in the Genus database with same CATH topology
 2WB1 A;  3BQB A;  3X2H A;  1E32 A;  1I3Q A;  1K83 A;  1UHD A;  3GTJ A;  5ERG B;  3D30 A;  4AOK B;  2CW0 D;  3X2K A;  1PQE A;  5FTJ A;  3FPT A;  1KQF A;  1PT1 A;  3X2J A;  2VPZ A;  2E2H A;  1BW3 A;  2MM0 A;  2YUJ A;  2PJH B;  4JJO A;  3X2N A;  3IR7 A;  2PNW A;  1G8J A;  4L48 A;  4FG4 A;  2VUM A;  3X2M A;  2KI8 A;  2R92 A;  2PJJ A;  5FTM A;  2C45 A;  4D7Z B;  4NOH A;  2R7Z A;  4UC4 A;  4KDL A;  2PWY A;  3ZJT A;  4DMR A;  5GLF A;  1TWA A;  2G6G A;  3GTP A;  4AVR A;  2Q19 X;  5D6W A;  2BH0 A;  1OA9 A;  4ZM7 A;  3TM7 B;  1SIW A;  2JIR A;  3CQZ A;  2VPW A;  2LW6 A;  1OGY A;  3HU3 A;  1I9G A;  1R7R A;  1YLE A;  1R27 A;  3LHD A;  2KQA A;  2NYA A;  5H4U A;  1ZYR D;  2QQS A;  3X2I A;  4JP7 A;  3SUJ A;  5DYG A;  1UHE A;  2KY9 A;  1I50 A;  3MB5 A;  5D6Y A;  4CRY G;  4CQN A;  3SUL A;  4AQ7 A;  1E60 A;  1TWF A;  3QWZ A;  4C2M A;  2A6E D;  3PLX B;  5C18 A;  1WC2 A;  4AS1 A;  1PYQ A;  2Q18 X;  1VC3 B;  3X2O A;  3H0G A;  2PIC A;  2JA5 A;  4JS7 A;  3HKZ A;  4CRZ A;  1KQG A;  3ZJV A;  4AAY A;  2DMR A;  4FFT A;  2XDP A;  2YVL A;  3LGA A;  4AON B;  1QCS A;  1HD5 A;  5DYI A;  4CS0 A;  5FTL A;  2QQR A;  3QQ7 A;  3GTQ A;  4KO8 A;  1DMR A;  2R93 A;  1O54 A;  2Y0S A;  2B25 A;  1ZC1 A;  2VPX A;  5GLX A;  3FPR A;  2Q1A X;  2A69 D;  1OA7 A;  1H0H A;  2Q1D X;  1CZ4 A;  2A6H D;  1PPY A;  3OUG A;  5CCX A;  1PQH A;  3SUK A;  4AZD A;  2JIP A;  4RV0 A;  4FG2 A;  4ARC A;  1Y5I A;  5CCB A;  1WLF A;  3ZGZ A;  1EU1 A;  1TWH A;  2JIM A;  3GTO A;  2AE0 X;  1TWC A;  3ML1 A;  2JIQ A;  1DMS A;  3O5A A;  2YU9 A;  2G5D A;  2E2I A;  2JIO A;  4FIB A;  1Q16 A;  4GA6 A;  4GA5 A;  1BW4 A;  5B6C A;  1E18 A;  3HU1 A;  1IW7 D;  3X2P A;  1PT0 A;  2NVX A;  2PI8 A;  3HU2 A;  4JP6 A;  1YNN D;  5FTK A;  3GTL A;  5GM9 A;  3SUM A;  3ZJU A;  1TWG A;  4ENG A;  1H5N A;  2E7Z A;  2NAP A;  2B63 A;  5EQJ B;  1E61 A;  3FKI A;  4AYB A;  1FDI A;  5D6X A;  3CF2 A;  4KLN A;  2Q1C X;  1G8K A;  4KOD A;  3QC8 A;  2GAE A;  1Y1V A;  2O5J D;  2IV2 X;  1Y1W A;  1L8F A;  1R9T A;  1FDO A;  1N10 A;  1QDN A;  3IR6 A;  4FER A;  1Y4Z A;  1SFO A;  2GF7 A;  1SMY D;  3TIW A;  3M3G A;  1CR5 A;  4JCW A;  4QIW A;  2MM2 A;  3FPU A;  1WCM A;  1AA6 A;  5EPP A;  5T5M D;  1S3S A;  3GTG A;  1AW8 B;  3DMR A;  5GLY A;  5T5I D;  2A68 D;  2JV2 A;  4KDI A;  5C1B A;  2V45 A;  3X2G A;  5CD1 A;  2HCZ X;  2VPY A;  3QQ8 A;  1CZ5 A;  1PYU B;  3X2L A;  1TMO A;  2PMZ A;  1YNJ D;  2GFA A;  4ARI A;  2NVY A;  2JA7 A;  5FTN A;  2ENG A;  2V3V A;  3GTK A;  1E5V A;  2EEO B;  3ENG A;  3IR5 A;  2JA6 A;  2WAQ A;  3GTM A;  3CZB A;  2BE5 D;  1PQF A; 
#chains in the Genus database with same CATH homology
 2WB1 A;  3BQB A;  1I3Q A;  1E32 A;  1K83 A;  1UHD A;  3GTJ A;  5ERG B;  4AOK B;  2CW0 D;  1PQE A;  5FTJ A;  3FPT A;  1KQF A;  1PT1 A;  2E2H A;  2VPZ A;  2MM0 A;  2YUJ A;  2PJH B;  3IR7 A;  2PNW A;  1G8J A;  2VUM A;  2KI8 A;  2R92 A;  2PJJ A;  5FTM A;  2C45 A;  4D7Z B;  4NOH A;  2R7Z A;  4UC4 A;  4KDL A;  2PWY A;  3ZJT A;  4DMR A;  5GLF A;  1TWA A;  2G6G A;  3GTP A;  2Q19 X;  5D6W A;  3TM7 B;  1SIW A;  2JIR A;  3CQZ A;  2VPW A;  2LW6 A;  1OGY A;  3HU3 A;  1I9G A;  1R7R A;  1YLE A;  1R27 A;  3LHD A;  2NYA A;  1ZYR D;  2QQS A;  5DYG A;  1UHE A;  2KY9 A;  1I50 A;  3MB5 A;  5D6Y A;  4CRY G;  4CQN A;  4AQ7 A;  1E60 A;  1TWF A;  3QWZ A;  4C2M A;  2A6E D;  3PLX B;  5C18 A;  4AS1 A;  1PYQ A;  2Q18 X;  1VC3 B;  3H0G A;  2PIC A;  2JA5 A;  3HKZ A;  4CRZ A;  1KQG A;  3ZJV A;  4AAY A;  2DMR A;  2XDP A;  2YVL A;  3LGA A;  4AON B;  1QCS A;  5DYI A;  4CS0 A;  5FTL A;  2QQR A;  3QQ7 A;  3GTQ A;  4KO8 A;  1DMR A;  2R93 A;  1O54 A;  2Y0S A;  2B25 A;  1ZC1 A;  2VPX A;  3FPR A;  2Q1A X;  2A69 D;  1H0H A;  2Q1D X;  1CZ4 A;  2A6H D;  1PPY A;  3OUG A;  5CCX A;  1PQH A;  4AZD A;  2JIP A;  4RV0 A;  4ARC A;  1Y5I A;  5CCB A;  1WLF A;  3ZGZ A;  1EU1 A;  1TWH A;  2JIM A;  3GTO A;  2AE0 X;  1TWC A;  3ML1 A;  2JIQ A;  1DMS A;  3O5A A;  2YU9 A;  2G5D A;  2E2I A;  2JIO A;  4FIB A;  1Q16 A;  4GA6 A;  4GA5 A;  5B6C A;  1E18 A;  3HU1 A;  1IW7 D;  1PT0 A;  2NVX A;  2PI8 A;  3HU2 A;  1YNN D;  5FTK A;  3GTL A;  3ZJU A;  1TWG A;  1H5N A;  2E7Z A;  2NAP A;  2B63 A;  5EQJ B;  1E61 A;  3FKI A;  4AYB A;  1FDI A;  5D6X A;  3CF2 A;  4KLN A;  2Q1C X;  1G8K A;  4KOD A;  3QC8 A;  2GAE A;  1Y1V A;  2O5J D;  2IV2 X;  1Y1W A;  1R9T A;  1FDO A;  3IR6 A;  1QDN A;  1SFO A;  2GF7 A;  1Y4Z A;  5CD1 A;  1SMY D;  3TIW A;  3FPU A;  1CR5 A;  4QIW A;  2MM2 A;  1WCM A;  1AA6 A;  5EPP A;  5T5M D;  1S3S A;  3GTG A;  1AW8 B;  3DMR A;  5T5I D;  2A68 D;  2JV2 A;  4KDI A;  5C1B A;  2V45 A;  2VPY A;  3QQ8 A;  1CZ5 A;  1PYU B;  1TMO A;  2PMZ A;  1YNJ D;  2GFA A;  4ARI A;  2NVY A;  2JA7 A;  5FTN A;  2V3V A;  3GTK A;  1E5V A;  2EEO B;  3IR5 A;  2JA6 A;  2WAQ A;  3GTM A;  3CZB A;  2BE5 D;  1PQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...