1CR5A

N-terminal domain of sec18p
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
178
Chain Sequence
TRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIIIDNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVATGIETKGILTKQTQINFFKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC18P (RESIDUES 22 - 210)
publication title Crystal structure of the Sec18p N-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
total genus 51
structure length 178
sequence length 185
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cr5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cr5A02
1Q16A 1H5NA 3QQ8A 2R93A 2JA5A 4GA6A 1QDNA 5T5MD 1KQFA 1TWGA 5FTJA 4QIWA 4CRYG 2EEOB 5EPPA 4D7ZB 1Y1VA 2VUMA 1AA6A 1Y5IA 5T5ID 2WB1A 4KODA 4AZDA 2NVYA 4AYBA 3QQ7A 1WLFA 1EU1A 2KI8A 2V45A 2NYAA 1TMOA 2C45A 1PYQA 3IR5A 1PYUB 1DMSA 2VPZA 1CR5A 1TWHA 1YLEA 1PQHA 4KO8A 3HU2A 1E5VA 1FDIA 4AAYA 1S3SA 1QCSA 1E60A 3HKZA 2PMZA 4AONB 1DMRA 2WAQA 5GLFA 2R7ZA 1PT1A 1E32A 4KDIA 4AOKB 1Y4ZA 1UHEA 3HU1A 3GTLA 1OGYA 2E2HA 1R7RA 3GTGA 2JIQA 2DMRA 3CQZA 2Y0SA 3TIWA 2R92A 1FDOA 2VPXA 2E2IA 2VPYA 3DMRA 1H0HA 2NVXA 1Y1WA 1UHDA 3GTKA 1IW7D 2JIPA 2IV2X 1WCMA 3GTPA 3GTMA 5FTMA 1E61A 1PQEA 4DMRA 1G8JA 1TWFA 2JA7A 5FTNA 1PQFA 2JV2A 3O5AA 4CRZA 5FTLA 4GA5A 1CZ5A 1SFOA 5DYGA 1PPYA 2V3VA 1I50A 1G8KA 2JA6A 2VPWA 1KQGA 1TWCA 1SIWA 2E7ZA 1TWAA 3CF2A 1VC3B 3IR7A 4KDLA 1K83A 4KLNA 1R27A 3IR6A 4RV0A 5B6CA 1I3QA 3FKIA 3QWZA 2PJHB 3TM7B 3PLXB 1AW8B 3GTOA 3ML1A 5FTKA 3H0GA 3OUGA 2JIMA 5C1BA 2YUJA 1CZ4A 2JIOA 5DYIA 4CS0A 2JIRA 3HU3A 3GTJA 1E18A 2NAPA 1PT0A 4C2MA 2B63A 3QC8A 1ZC1A 2YU9A 3GTQA 5C18A 1R9TA
chains in the Genus database with same CATH superfamily
4FFTA 4CQNA 1Q16A 1H5NA 3QQ8A 2R93A 2A6ED 4GA6A 5GLXA 2JA5A 1QDNA 5T5MD 1L8FA 1TWGA 3ENGA 5FTJA 3X2HA 1KQFA 4QIWA 4CRYG 3X2IA 2EEOB 5EPPA 3SUMA 4D7ZB 1OA7A 1Y1VA 4ZM7A 2VUMA 2B25A 1AA6A 1Y5IA 3ZGZA 5T5ID 2WB1A 4KODA 2ENGA 4AZDA 2NVYA 4AYBA 2GAEA 3QQ7A 2GF7A 1WLFA 1EU1A 2KI8A 3SUJA 2G5DA 2V45A 1BW4A 3FPTA 3X2GA 4FIBA 5D6WA 4JP6A 5EQJB 3ZJTA 4FG4A 2NYAA 1TMOA 1YNND 2C45A 2BE5D 1PYQA 3IR5A 2A68D 3SUKA 1PYUB 1DMSA 2VPZA 4AVRA 2QQSA 3FPUA 1CR5A 1TWHA 1YLEA 1PQHA 4KO8A 3MB5A 3HU2A 3X2MA 1E5VA 2YVLA 1FDIA 4FERA 4AAYA 1S3SA 1I9GA 1QCSA 5D6YA 1E60A 3HKZA 2PMZA 4UC4A 1ZYRD 4AQ7A 4AONB 4JP7A 1DMRA 1O54A 1WC2A 2WAQA 5GLFA 1HD5A 2QQRA 2R7ZA 2MM0A 2Q1CX 1PT1A 1E32A 4KDIA 2XDPA 4AOKB 2LW6A 3M3GA 1Y4ZA 1UHEA 5CCXA 3HU1A 3GTLA 3BQBA 1OA9A 1OGYA 2E2HA 1R7RA 3GTGA 2JIQA 2DMRA 3CQZA 2Q18X 2BH0A 4JCWA 2Y0SA 2PJJA 3TIWA 2R92A 3LGAA 1FDOA 2HCZX 2VPXA 2E2IA 2VPYA 3DMRA 4ARIA 2KY9A 2A6HD 1H0HA 2NVXA 1Y1WA 1UHDA 3GTKA 3SULA 1IW7D 3X2KA 2JIPA 2IV2X 1WCMA 4NOHA 3GTPA 3GTMA 5FTMA 1E61A 1PQEA 4DMRA 4AS1A 3X2LA 1G8JA 1TWFA 3CZBA 4JS7A 2JA7A 5FTNA 1PQFA 4JJOA 5GM9A 2JV2A 3O5AA 4CRZA 5FTLA 4GA5A 1CZ5A 1SFOA 5DYGA 1PPYA 2V3VA 2CW0D 5CD1A 1I50A 1BW3A 1G8KA 2JA6A 2VPWA 1KQGA 1TWCA 2G6GA 1SIWA 2E7ZA 1TWAA 2PICA 1VC3B 3CF2A 3X2PA 3IR7A 2Q1DX 4KDLA 1K83A 2PI8A 3X2NA 3ZJVA 5CCBA 1N10A 4KLNA 1R27A 2Q1AX 3IR6A 4RV0A 5B6CA 1I3QA 5ERGB 3ZJUA 3FKIA 1SMYD 3QWZA 2PJHB 3TM7B 3PLXB 1AW8B 3GTOA 3ML1A 2Q19X 5FTKA 2A69D 3H0GA 3OUGA 2GFAA 2JIMA 3LHDA 3X2OA 2PNWA 2YUJA 5C1BA 2O5JD 2PWYA 1CZ4A 2JIOA 3X2JA 5DYIA 4CS0A 2JIRA 3HU3A 4ENGA 3GTJA 4L48A 2MM2A 1E18A 2NAPA 2AE0X 1YNJD 5H4UA 2KQAA 4FG2A 1PT0A 4C2MA 2B63A 3FPRA 3QC8A 3D30A 5GLYA 1ZC1A 2YU9A 5D6XA 4ARCA 3GTQA 5C18A 1R9TA
chains in the Genus database with same CATH topology
4CQNA 1Q16A 1H5NA 3QQ8A 2R93A 2A6ED 4GA6A 2JA5A 1QDNA 5T5MD 1KQFA 1TWGA 5FTJA 4QIWA 4CRYG 2EEOB 5EPPA 4D7ZB 1Y1VA 2VUMA 2B25A 1AA6A 1Y5IA 3ZGZA 5T5ID 2WB1A 4KODA 4AZDA 2NVYA 4AYBA 2GAEA 3QQ7A 2GF7A 1WLFA 1EU1A 2KI8A 4FIBA 2G5DA 2V45A 3FPTA 5D6WA 3ZJTA 5EQJB 2NYAA 1TMOA 1YNND 2C45A 2BE5D 1PYQA 3IR5A 2A68D 3FPUA 1PYUB 1DMSA 2VPZA 2QQSA 3MB5A 1CR5A 1TWHA 1YLEA 1PQHA 4KO8A 3HU2A 1E5VA 2YVLA 1FDIA 5D6YA 4AAYA 1S3SA 1I9GA 1QCSA 1E60A 3HKZA 2PMZA 4UC4A 1ZYRD 4AQ7A 4AONB 1DMRA 1O54A 2WAQA 5GLFA 2QQRA 2R7ZA 2MM0A 2Q1CX 1PT1A 1E32A 4KDIA 2XDPA 4AOKB 2LW6A 1Y4ZA 1UHEA 5CCXA 3HU1A 3GTLA 3BQBA 1OGYA 2E2HA 1R7RA 3GTGA 2JIQA 2DMRA 3CQZA 2Q18X 2Y0SA 2PJJA 3TIWA 2R92A 3LGAA 1FDOA 2VPXA 2E2IA 2VPYA 3DMRA 4ARIA 2KY9A 2A6HD 1H0HA 2NVXA 1Y1WA 1UHDA 3GTKA 1IW7D 2JIPA 2IV2X 1WCMA 4NOHA 3GTPA 3GTMA 5FTMA 1E61A 1PQEA 4DMRA 4AS1A 1G8JA 1TWFA 3CZBA 2JA7A 5FTNA 1PQFA 2JV2A 3O5AA 4CRZA 5FTLA 4GA5A 1CZ5A 1SFOA 5DYGA 1PPYA 2V3VA 2CW0D 5CD1A 1I50A 1G8KA 2JA6A 2VPWA 1KQGA 1TWCA 2G6GA 1SIWA 2E7ZA 1TWAA 2PICA 1VC3B 3CF2A 3IR7A 2Q1DX 4KDLA 1K83A 2PI8A 3ZJVA 5CCBA 4KLNA 1R27A 2Q1AX 3IR6A 4RV0A 5B6CA 1I3QA 5ERGB 3ZJUA 3FKIA 1SMYD 3QWZA 2PJHB 3TM7B 3PLXB 1AW8B 3GTOA 3ML1A 2Q19X 5FTKA 2A69D 3H0GA 3OUGA 2GFAA 2JIMA 3LHDA 2PNWA 2YUJA 5C1BA 2O5JD 2PWYA 1CZ4A 2JIOA 5DYIA 4CS0A 2JIRA 3HU3A 3GTJA 2MM2A 2NAPA 1E18A 2AE0X 1YNJD 1PT0A 4C2MA 2B63A 3FPRA 3QC8A 1ZC1A 2YU9A 5D6XA 4ARCA 3GTQA 5C18A 1R9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q16 A;  1H5N A;  3QQ8 A;  2R93 A;  2JA5 A;  4GA6 A;  1QDN A;  5T5M D;  1KQF A;  1TWG A;  5FTJ A;  4QIW A;  4CRY G;  2EEO B;  5EPP A;  4D7Z B;  1Y1V A;  2VUM A;  1AA6 A;  1Y5I A;  5T5I D;  2WB1 A;  4KOD A;  4AZD A;  2NVY A;  4AYB A;  3QQ7 A;  1WLF A;  1EU1 A;  2KI8 A;  2V45 A;  2NYA A;  1TMO A;  2C45 A;  1PYQ A;  3IR5 A;  1PYU B;  1DMS A;  2VPZ A;  1CR5 A;  1TWH A;  1YLE A;  1PQH A;  4KO8 A;  3HU2 A;  1E5V A;  1FDI A;  4AAY A;  1S3S A;  1QCS A;  1E60 A;  3HKZ A;  2PMZ A;  4AON B;  1DMR A;  2WAQ A;  5GLF A;  2R7Z A;  1PT1 A;  1E32 A;  4KDI A;  4AOK B;  1Y4Z A;  1UHE A;  3HU1 A;  3GTL A;  1OGY A;  2E2H A;  1R7R A;  3GTG A;  2JIQ A;  2DMR A;  3CQZ A;  2Y0S A;  3TIW A;  2R92 A;  1FDO A;  2VPX A;  2E2I A;  2VPY A;  3DMR A;  1H0H A;  2NVX A;  1Y1W A;  1UHD A;  3GTK A;  1IW7 D;  2JIP A;  2IV2 X;  1WCM A;  3GTP A;  3GTM A;  5FTM A;  1E61 A;  1PQE A;  4DMR A;  1G8J A;  1TWF A;  2JA7 A;  5FTN A;  1PQF A;  2JV2 A;  3O5A A;  4CRZ A;  5FTL A;  4GA5 A;  1CZ5 A;  1SFO A;  5DYG A;  1PPY A;  2V3V A;  1I50 A;  1G8K A;  2JA6 A;  2VPW A;  1KQG A;  1TWC A;  1SIW A;  2E7Z A;  1TWA A;  3CF2 A;  1VC3 B;  3IR7 A;  4KDL A;  1K83 A;  4KLN A;  1R27 A;  3IR6 A;  4RV0 A;  5B6C A;  1I3Q A;  3FKI A;  3QWZ A;  2PJH B;  3TM7 B;  3PLX B;  1AW8 B;  3GTO A;  3ML1 A;  5FTK A;  3H0G A;  3OUG A;  2JIM A;  5C1B A;  2YUJ A;  1CZ4 A;  2JIO A;  5DYI A;  4CS0 A;  2JIR A;  3HU3 A;  3GTJ A;  1E18 A;  2NAP A;  1PT0 A;  4C2M A;  2B63 A;  3QC8 A;  1ZC1 A;  2YU9 A;  3GTQ A;  5C18 A;  1R9T A; 
#chains in the Genus database with same CATH topology
 4FFT A;  4CQN A;  1Q16 A;  1H5N A;  3QQ8 A;  2R93 A;  2A6E D;  4GA6 A;  5GLX A;  2JA5 A;  1QDN A;  5T5M D;  1L8F A;  1TWG A;  3ENG A;  5FTJ A;  3X2H A;  1KQF A;  4QIW A;  4CRY G;  3X2I A;  2EEO B;  5EPP A;  3SUM A;  4D7Z B;  1OA7 A;  1Y1V A;  4ZM7 A;  2VUM A;  2B25 A;  1AA6 A;  1Y5I A;  3ZGZ A;  5T5I D;  2WB1 A;  4KOD A;  2ENG A;  4AZD A;  2NVY A;  4AYB A;  2GAE A;  3QQ7 A;  2GF7 A;  1WLF A;  1EU1 A;  2KI8 A;  3SUJ A;  2G5D A;  2V45 A;  1BW4 A;  3FPT A;  3X2G A;  4FIB A;  5D6W A;  4JP6 A;  5EQJ B;  3ZJT A;  4FG4 A;  2NYA A;  1TMO A;  1YNN D;  2C45 A;  2BE5 D;  1PYQ A;  3IR5 A;  2A68 D;  3SUK A;  1PYU B;  1DMS A;  2VPZ A;  4AVR A;  2QQS A;  3FPU A;  1CR5 A;  1TWH A;  1YLE A;  1PQH A;  4KO8 A;  3MB5 A;  3HU2 A;  3X2M A;  1E5V A;  2YVL A;  1FDI A;  4FER A;  4AAY A;  1S3S A;  1I9G A;  1QCS A;  5D6Y A;  1E60 A;  3HKZ A;  2PMZ A;  4UC4 A;  1ZYR D;  4AQ7 A;  4AON B;  4JP7 A;  1DMR A;  1O54 A;  1WC2 A;  2WAQ A;  5GLF A;  1HD5 A;  2QQR A;  2R7Z A;  2MM0 A;  2Q1C X;  1PT1 A;  1E32 A;  4KDI A;  2XDP A;  4AOK B;  2LW6 A;  3M3G A;  1Y4Z A;  1UHE A;  5CCX A;  3HU1 A;  3GTL A;  3BQB A;  1OA9 A;  1OGY A;  2E2H A;  1R7R A;  3GTG A;  2JIQ A;  2DMR A;  3CQZ A;  2Q18 X;  2BH0 A;  4JCW A;  2Y0S A;  2PJJ A;  3TIW A;  2R92 A;  3LGA A;  1FDO A;  2HCZ X;  2VPX A;  2E2I A;  2VPY A;  3DMR A;  4ARI A;  2KY9 A;  2A6H D;  1H0H A;  2NVX A;  1Y1W A;  1UHD A;  3GTK A;  3SUL A;  1IW7 D;  3X2K A;  2JIP A;  2IV2 X;  1WCM A;  4NOH A;  3GTP A;  3GTM A;  5FTM A;  1E61 A;  1PQE A;  4DMR A;  4AS1 A;  3X2L A;  1G8J A;  1TWF A;  3CZB A;  4JS7 A;  2JA7 A;  5FTN A;  1PQF A;  4JJO A;  5GM9 A;  2JV2 A;  3O5A A;  4CRZ A;  5FTL A;  4GA5 A;  1CZ5 A;  1SFO A;  5DYG A;  1PPY A;  2V3V A;  2CW0 D;  5CD1 A;  1I50 A;  1BW3 A;  1G8K A;  2JA6 A;  2VPW A;  1KQG A;  1TWC A;  2G6G A;  1SIW A;  2E7Z A;  1TWA A;  2PIC A;  1VC3 B;  3CF2 A;  3X2P A;  3IR7 A;  2Q1D X;  4KDL A;  1K83 A;  2PI8 A;  3X2N A;  3ZJV A;  5CCB A;  1N10 A;  4KLN A;  1R27 A;  2Q1A X;  3IR6 A;  4RV0 A;  5B6C A;  1I3Q A;  5ERG B;  3ZJU A;  3FKI A;  1SMY D;  3QWZ A;  2PJH B;  3TM7 B;  3PLX B;  1AW8 B;  3GTO A;  3ML1 A;  2Q19 X;  5FTK A;  2A69 D;  3H0G A;  3OUG A;  2GFA A;  2JIM A;  3LHD A;  3X2O A;  2PNW A;  2YUJ A;  5C1B A;  2O5J D;  2PWY A;  1CZ4 A;  2JIO A;  3X2J A;  5DYI A;  4CS0 A;  2JIR A;  3HU3 A;  4ENG A;  3GTJ A;  4L48 A;  2MM2 A;  1E18 A;  2NAP A;  2AE0 X;  1YNJ D;  5H4U A;  2KQA A;  4FG2 A;  1PT0 A;  4C2M A;  2B63 A;  3FPR A;  3QC8 A;  3D30 A;  5GLY A;  1ZC1 A;  2YU9 A;  5D6X A;  4ARC A;  3GTQ A;  5C18 A;  1R9T A; 
#chains in the Genus database with same CATH homology
 4CQN A;  1Q16 A;  1H5N A;  3QQ8 A;  2R93 A;  2A6E D;  4GA6 A;  2JA5 A;  1QDN A;  5T5M D;  1KQF A;  1TWG A;  5FTJ A;  4QIW A;  4CRY G;  2EEO B;  5EPP A;  4D7Z B;  1Y1V A;  2VUM A;  2B25 A;  1AA6 A;  1Y5I A;  3ZGZ A;  5T5I D;  2WB1 A;  4KOD A;  4AZD A;  2NVY A;  4AYB A;  2GAE A;  3QQ7 A;  2GF7 A;  1WLF A;  1EU1 A;  2KI8 A;  4FIB A;  2G5D A;  2V45 A;  3FPT A;  5D6W A;  3ZJT A;  5EQJ B;  2NYA A;  1TMO A;  1YNN D;  2C45 A;  2BE5 D;  1PYQ A;  3IR5 A;  2A68 D;  3FPU A;  1PYU B;  1DMS A;  2VPZ A;  2QQS A;  3MB5 A;  1CR5 A;  1TWH A;  1YLE A;  1PQH A;  4KO8 A;  3HU2 A;  1E5V A;  2YVL A;  1FDI A;  5D6Y A;  4AAY A;  1S3S A;  1I9G A;  1QCS A;  1E60 A;  3HKZ A;  2PMZ A;  4UC4 A;  1ZYR D;  4AQ7 A;  4AON B;  1DMR A;  1O54 A;  2WAQ A;  5GLF A;  2QQR A;  2R7Z A;  2MM0 A;  2Q1C X;  1PT1 A;  1E32 A;  4KDI A;  2XDP A;  4AOK B;  2LW6 A;  1Y4Z A;  1UHE A;  5CCX A;  3HU1 A;  3GTL A;  3BQB A;  1OGY A;  2E2H A;  1R7R A;  3GTG A;  2JIQ A;  2DMR A;  3CQZ A;  2Q18 X;  2Y0S A;  2PJJ A;  3TIW A;  2R92 A;  3LGA A;  1FDO A;  2VPX A;  2E2I A;  2VPY A;  3DMR A;  4ARI A;  2KY9 A;  2A6H D;  1H0H A;  2NVX A;  1Y1W A;  1UHD A;  3GTK A;  1IW7 D;  2JIP A;  2IV2 X;  1WCM A;  4NOH A;  3GTP A;  3GTM A;  5FTM A;  1E61 A;  1PQE A;  4DMR A;  4AS1 A;  1G8J A;  1TWF A;  3CZB A;  2JA7 A;  5FTN A;  1PQF A;  2JV2 A;  3O5A A;  4CRZ A;  5FTL A;  4GA5 A;  1CZ5 A;  1SFO A;  5DYG A;  1PPY A;  2V3V A;  2CW0 D;  5CD1 A;  1I50 A;  1G8K A;  2JA6 A;  2VPW A;  1KQG A;  1TWC A;  2G6G A;  1SIW A;  2E7Z A;  1TWA A;  2PIC A;  1VC3 B;  3CF2 A;  3IR7 A;  2Q1D X;  4KDL A;  1K83 A;  2PI8 A;  3ZJV A;  5CCB A;  4KLN A;  1R27 A;  2Q1A X;  3IR6 A;  4RV0 A;  5B6C A;  1I3Q A;  5ERG B;  3ZJU A;  3FKI A;  1SMY D;  3QWZ A;  2PJH B;  3TM7 B;  3PLX B;  1AW8 B;  3GTO A;  3ML1 A;  2Q19 X;  5FTK A;  2A69 D;  3H0G A;  3OUG A;  2GFA A;  2JIM A;  3LHD A;  2PNW A;  2YUJ A;  5C1B A;  2O5J D;  2PWY A;  1CZ4 A;  2JIO A;  5DYI A;  4CS0 A;  2JIR A;  3HU3 A;  3GTJ A;  2MM2 A;  2NAP A;  1E18 A;  2AE0 X;  1YNJ D;  1PT0 A;  4C2M A;  2B63 A;  3FPR A;  3QC8 A;  1ZC1 A;  2YU9 A;  5D6X A;  4ARC A;  3GTQ A;  5C18 A;  1R9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...