1CR5A

N-terminal domain of sec18p
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
178
Chain Sequence
TRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIIIDNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVATGIETKGILTKQTQINFFKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Sec18p N-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
molecule keywords SEC18P (RESIDUES 22 - 210)
total genus 51
structure length 178
sequence length 185
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cr5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cr5A02
4AYBA 5DYIA 2VUMA 1TWAA 3GTKA 2NVYA 1R9TA 1H5NA 3H0GA 2NYAA 1WLFA 1PQEA 3GTQA 1PQFA 1R27A 1KQFA 2E2IA 1E32A 1E5VA 3O5AA 1CR5A 2VPWA 1YLEA 2VPXA 3GTJA 2VPZA 5FTLA 2NVXA 4KODA 1PYQA 1FDOA 1I50A 3CQZA 1PT1A 2WAQA 1DMRA 1E60A 3QQ8A 3GTMA 5FTKA 2Y0SA 5FTJA 1FDIA 3GTPA 3FKIA 3HU2A 2JIQA 1AW8B 4RV0A 4C2MA 2B63A 3CF2A 2JIRA 3GTGA 1E61A 2PJHB 3QC8A 3HU1A 5FTMA 4AAYA 4AZDA 3DMRA 1TWCA 3QQ7A 5B6CA 1PYUB 4GA5A 4AONB 1ZC1A 1UHDA 1TWHA 2DMRA 3IR6A 1OGYA 2YU9A 5C1BA 4GA6A 5FTNA 1CZ4A 2PMZA 2R7ZA 1TWGA 2EEOB 2IV2X 4KDLA 1CZ5A 4KO8A 3PLXB 2NAPA 2V3VA 2JA6A 1G8KA 1Y4ZA 3HU3A 3OUGA 1Q16A 1QCSA 2JA7A 4DMRA 2C45A 5T5ID 2KI8A 1PT0A 1KQGA 3IR7A 4AOKB 2V45A 2E2HA 5C18A 3TIWA 1VC3B 1EU1A 1DMSA 1S3SA 1K83A 1PQHA 1E18A 1TWFA 2JIPA 5DYGA 1Y5IA 2YUJA 4CRZA 2JIOA 1SIWA 4KLNA 5T5MD 1QDNA 1I3QA 1Y1VA 5GLFA 2JA5A 3HKZA 1H0HA 2E7ZA 5EPPA 1AA6A 1WCMA 3GTLA 1IW7D 1UHEA 3GTOA 3TM7B 4CS0A 1SFOA 1PPYA 1G8JA 3ML1A 2JV2A 3QWZA 1Y1WA 1R7RA 1TMOA 2WB1A 2R93A 4KDIA 2JIMA 2VPYA 2R92A 4D7ZB 3IR5A 4QIWA 4CRYG
chains in the Genus database with same CATH superfamily
1OA9A 4AYBA 5DYIA 2VUMA 5ERGB 1TWAA 4FIBA 2GAEA 3GTKA 2NVYA 1R9TA 1H5NA 3X2IA 3LHDA 3H0GA 2NYAA 1WLFA 1PQEA 3X2GA 3GTQA 1BW3A 4ARIA 2B25A 1PQFA 1R27A 1KQFA 2E2IA 1E32A 3ZJVA 1E5VA 4FG4A 2MM2A 3O5AA 1CR5A 5CCBA 2VPWA 3SUKA 1YLEA 2VPXA 3GTJA 2VPZA 2YVLA 4JJOA 5FTLA 4UC4A 3SUJA 2LW6A 2NVXA 4KODA 1PYQA 1FDOA 1I50A 3CQZA 1PT1A 1YNJD 2WAQA 1DMRA 2PICA 1E60A 3QQ8A 3X2JA 5FTKA 3GTMA 5CCXA 5H4UA 4ENGA 2Y0SA 5FTJA 1I9GA 1FDIA 1O54A 3GTPA 2Q1DX 3FKIA 3D30A 2JIQA 1AW8B 3HU2A 2QQSA 4L48A 3FPUA 4RV0A 4C2MA 5D6YA 2B63A 3CF2A 5CD1A 4JCWA 3MB5A 2JIRA 3GTGA 2A68D 1E61A 2PJHB 3QC8A 3HU1A 5FTMA 4AAYA 4AZDA 3DMRA 1TWCA 2PJJA 3QQ7A 5B6CA 1N10A 1PYUB 4GA5A 4AONB 4ZM7A 1ZC1A 1UHDA 1TWHA 3X2NA 2DMRA 3IR6A 1OGYA 2YU9A 4AQ7A 1YNND 4FERA 4GA6A 4JS7A 1CZ4A 5FTNA 5C1BA 3CZBA 2PMZA 4CQNA 3SUMA 1TWGA 2EEOB 2IV2X 2R7ZA 4KDLA 1CZ5A 4KO8A 2ENGA 3PLXB 2PNWA 3X2MA 2NAPA 2HCZX 2V3VA 3ZJTA 2JA6A 5EQJB 1G8KA 1L8FA 1Y4ZA 3HU3A 3OUGA 3X2LA 1Q16A 4AS1A 1QCSA 2JA7A 4DMRA 2C45A 3X2HA 4AVRA 5T5ID 4NOHA 2KI8A 2AE0X 1PT0A 2GF7A 1KQGA 2QQRA 2A6HD 2KQAA 1ZYRD 4JP7A 3X2KA 3X2OA 3IR7A 4AOKB 2V45A 2BE5D 2E2HA 3BQBA 2PI8A 3TIWA 5C18A 5GLYA 1VC3B 2Q1CX 1EU1A 1DMSA 1S3SA 1K83A 1PQHA 2BH0A 1E18A 3ZJUA 2A69D 2Q1AX 1TWFA 2JIPA 5DYGA 1Y5IA 2YUJA 4CRZA 3FPRA 2JIOA 1BW4A 1SIWA 4ARCA 2KY9A 4KLNA 5T5MD 1QDNA 1I3QA 1Y1VA 1SMYD 5GLFA 3HKZA 2JA5A 2GFAA 1H0HA 2E7ZA 5GM9A 5EPPA 1AA6A 2Q18X 1WCMA 4JP6A 3GTLA 3ZGZA 2Q19X 1IW7D 1UHEA 2A6ED 3SULA 3GTOA 3TM7B 2O5JD 4CS0A 1SFOA 2XDPA 5D6WA 2PWYA 1PPYA 1G8JA 3ML1A 4FFTA 2JV2A 3QWZA 1Y1WA 3X2PA 1R7RA 1HD5A 2G6GA 1TMOA 1WC2A 3ENGA 3FPTA 2CW0D 2WB1A 2R93A 4KDIA 3LGAA 2JIMA 2VPYA 2R92A 5D6XA 4D7ZB 1OA7A 3IR5A 5GLXA 2MM0A 2G5DA 4FG2A 4QIWA 3M3GA 4CRYG
chains in the Genus database with same CATH topology
4AYBA 5DYIA 2VUMA 5ERGB 1TWAA 4FIBA 2GAEA 3GTKA 2NVYA 1R9TA 1H5NA 3LHDA 3H0GA 2NYAA 1WLFA 1PQEA 3GTQA 4ARIA 2B25A 1PQFA 1R27A 1KQFA 2E2IA 1E32A 3ZJVA 1E5VA 2MM2A 3O5AA 1CR5A 5CCBA 2VPWA 2YVLA 1YLEA 2VPXA 3GTJA 2VPZA 5FTLA 4UC4A 2LW6A 2NVXA 4KODA 1PYQA 1FDOA 1I50A 3CQZA 1PT1A 1YNJD 2WAQA 1DMRA 2PICA 1E60A 3QQ8A 3GTMA 5FTKA 5CCXA 2Y0SA 5FTJA 1I9GA 1FDIA 1O54A 3GTPA 2Q1DX 3FKIA 3HU2A 2JIQA 1AW8B 2QQSA 3FPUA 4RV0A 4C2MA 5D6YA 2B63A 3CF2A 5CD1A 3MB5A 2JIRA 3GTGA 2A68D 1E61A 2PJHB 3QC8A 3HU1A 5FTMA 4AAYA 4AZDA 3DMRA 1TWCA 2PJJA 3QQ7A 5B6CA 1PYUB 4GA5A 4AONB 1ZC1A 1UHDA 1TWHA 2DMRA 3IR6A 1OGYA 2YU9A 4AQ7A 1YNND 5C1BA 4GA6A 5FTNA 1CZ4A 3CZBA 2PMZA 4CQNA 2R7ZA 1TWGA 2EEOB 2IV2X 4KDLA 1CZ5A 4KO8A 3PLXB 2PNWA 2NAPA 2V3VA 3ZJTA 2JA6A 5EQJB 1G8KA 1Y4ZA 3HU3A 3OUGA 1Q16A 4AS1A 1QCSA 2JA7A 4DMRA 2C45A 5T5ID 4NOHA 2KI8A 2AE0X 1PT0A 2GF7A 1KQGA 2QQRA 2A6HD 1ZYRD 3IR7A 4AOKB 2V45A 2BE5D 2E2HA 3BQBA 2PI8A 3TIWA 5C18A 1VC3B 2Q1CX 1EU1A 1DMSA 1S3SA 1K83A 1PQHA 1E18A 3ZJUA 2A69D 2Q1AX 1TWFA 2JIPA 5DYGA 1Y5IA 2YUJA 4CRZA 3FPRA 2JIOA 1SIWA 4ARCA 2KY9A 4KLNA 5T5MD 1QDNA 1I3QA 1Y1VA 1SMYD 5GLFA 3HKZA 2JA5A 2GFAA 1H0HA 2E7ZA 5EPPA 1AA6A 2Q18X 1WCMA 3GTLA 3ZGZA 2Q19X 1IW7D 1UHEA 2A6ED 2O5JD 3GTOA 3TM7B 2XDPA 4CS0A 1SFOA 5D6WA 2PWYA 1PPYA 1G8JA 3ML1A 2JV2A 3QWZA 1Y1WA 1R7RA 2G6GA 1TMOA 3FPTA 2CW0D 2WB1A 2R93A 4KDIA 3LGAA 2JIMA 2VPYA 2R92A 5D6XA 4D7ZB 2MM0A 3IR5A 2G5DA 4QIWA 4CRYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB A;  5DYI A;  2VUM A;  1TWA A;  3GTK A;  2NVY A;  1R9T A;  1H5N A;  3H0G A;  2NYA A;  1WLF A;  1PQE A;  3GTQ A;  1PQF A;  1R27 A;  1KQF A;  2E2I A;  1E32 A;  1E5V A;  3O5A A;  1CR5 A;  2VPW A;  1YLE A;  2VPX A;  3GTJ A;  2VPZ A;  5FTL A;  2NVX A;  4KOD A;  1PYQ A;  1FDO A;  1I50 A;  3CQZ A;  1PT1 A;  2WAQ A;  1DMR A;  1E60 A;  3QQ8 A;  3GTM A;  5FTK A;  2Y0S A;  5FTJ A;  1FDI A;  3GTP A;  3FKI A;  3HU2 A;  2JIQ A;  1AW8 B;  4RV0 A;  4C2M A;  2B63 A;  3CF2 A;  2JIR A;  3GTG A;  1E61 A;  2PJH B;  3QC8 A;  3HU1 A;  5FTM A;  4AAY A;  4AZD A;  3DMR A;  1TWC A;  3QQ7 A;  5B6C A;  1PYU B;  4GA5 A;  4AON B;  1ZC1 A;  1UHD A;  1TWH A;  2DMR A;  3IR6 A;  1OGY A;  2YU9 A;  5C1B A;  4GA6 A;  5FTN A;  1CZ4 A;  2PMZ A;  2R7Z A;  1TWG A;  2EEO B;  2IV2 X;  4KDL A;  1CZ5 A;  4KO8 A;  3PLX B;  2NAP A;  2V3V A;  2JA6 A;  1G8K A;  1Y4Z A;  3HU3 A;  3OUG A;  1Q16 A;  1QCS A;  2JA7 A;  4DMR A;  2C45 A;  5T5I D;  2KI8 A;  1PT0 A;  1KQG A;  3IR7 A;  4AOK B;  2V45 A;  2E2H A;  5C18 A;  3TIW A;  1VC3 B;  1EU1 A;  1DMS A;  1S3S A;  1K83 A;  1PQH A;  1E18 A;  1TWF A;  2JIP A;  5DYG A;  1Y5I A;  2YUJ A;  4CRZ A;  2JIO A;  1SIW A;  4KLN A;  5T5M D;  1QDN A;  1I3Q A;  1Y1V A;  5GLF A;  2JA5 A;  3HKZ A;  1H0H A;  2E7Z A;  5EPP A;  1AA6 A;  1WCM A;  3GTL A;  1IW7 D;  1UHE A;  3GTO A;  3TM7 B;  4CS0 A;  1SFO A;  1PPY A;  1G8J A;  3ML1 A;  2JV2 A;  3QWZ A;  1Y1W A;  1R7R A;  1TMO A;  2WB1 A;  2R93 A;  4KDI A;  2JIM A;  2VPY A;  2R92 A;  4D7Z B;  3IR5 A;  4QIW A;  4CRY G; 
#chains in the Genus database with same CATH topology
 1OA9 A;  4AYB A;  5DYI A;  2VUM A;  5ERG B;  1TWA A;  4FIB A;  2GAE A;  3GTK A;  2NVY A;  1R9T A;  1H5N A;  3X2I A;  3LHD A;  3H0G A;  2NYA A;  1WLF A;  1PQE A;  3X2G A;  3GTQ A;  1BW3 A;  4ARI A;  2B25 A;  1PQF A;  1R27 A;  1KQF A;  2E2I A;  1E32 A;  3ZJV A;  1E5V A;  4FG4 A;  2MM2 A;  3O5A A;  1CR5 A;  5CCB A;  2VPW A;  3SUK A;  1YLE A;  2VPX A;  3GTJ A;  2VPZ A;  2YVL A;  4JJO A;  5FTL A;  4UC4 A;  3SUJ A;  2LW6 A;  2NVX A;  4KOD A;  1PYQ A;  1FDO A;  1I50 A;  3CQZ A;  1PT1 A;  1YNJ D;  2WAQ A;  1DMR A;  2PIC A;  1E60 A;  3QQ8 A;  3X2J A;  5FTK A;  3GTM A;  5CCX A;  5H4U A;  4ENG A;  2Y0S A;  5FTJ A;  1I9G A;  1FDI A;  1O54 A;  3GTP A;  2Q1D X;  3FKI A;  3D30 A;  2JIQ A;  1AW8 B;  3HU2 A;  2QQS A;  4L48 A;  3FPU A;  4RV0 A;  4C2M A;  5D6Y A;  2B63 A;  3CF2 A;  5CD1 A;  4JCW A;  3MB5 A;  2JIR A;  3GTG A;  2A68 D;  1E61 A;  2PJH B;  3QC8 A;  3HU1 A;  5FTM A;  4AAY A;  4AZD A;  3DMR A;  1TWC A;  2PJJ A;  3QQ7 A;  5B6C A;  1N10 A;  1PYU B;  4GA5 A;  4AON B;  4ZM7 A;  1ZC1 A;  1UHD A;  1TWH A;  3X2N A;  2DMR A;  3IR6 A;  1OGY A;  2YU9 A;  4AQ7 A;  1YNN D;  4FER A;  4GA6 A;  4JS7 A;  1CZ4 A;  5FTN A;  5C1B A;  3CZB A;  2PMZ A;  4CQN A;  3SUM A;  1TWG A;  2EEO B;  2IV2 X;  2R7Z A;  4KDL A;  1CZ5 A;  4KO8 A;  2ENG A;  3PLX B;  2PNW A;  3X2M A;  2NAP A;  2HCZ X;  2V3V A;  3ZJT A;  2JA6 A;  5EQJ B;  1G8K A;  1L8F A;  1Y4Z A;  3HU3 A;  3OUG A;  3X2L A;  1Q16 A;  4AS1 A;  1QCS A;  2JA7 A;  4DMR A;  2C45 A;  3X2H A;  4AVR A;  5T5I D;  4NOH A;  2KI8 A;  2AE0 X;  1PT0 A;  2GF7 A;  1KQG A;  2QQR A;  2A6H D;  2KQA A;  1ZYR D;  4JP7 A;  3X2K A;  3X2O A;  3IR7 A;  4AOK B;  2V45 A;  2BE5 D;  2E2H A;  3BQB A;  2PI8 A;  3TIW A;  5C18 A;  5GLY A;  1VC3 B;  2Q1C X;  1EU1 A;  1DMS A;  1S3S A;  1K83 A;  1PQH A;  2BH0 A;  1E18 A;  3ZJU A;  2A69 D;  2Q1A X;  1TWF A;  2JIP A;  5DYG A;  1Y5I A;  2YUJ A;  4CRZ A;  3FPR A;  2JIO A;  1BW4 A;  1SIW A;  4ARC A;  2KY9 A;  4KLN A;  5T5M D;  1QDN A;  1I3Q A;  1Y1V A;  1SMY D;  5GLF A;  3HKZ A;  2JA5 A;  2GFA A;  1H0H A;  2E7Z A;  5GM9 A;  5EPP A;  1AA6 A;  2Q18 X;  1WCM A;  4JP6 A;  3GTL A;  3ZGZ A;  2Q19 X;  1IW7 D;  1UHE A;  2A6E D;  3SUL A;  3GTO A;  3TM7 B;  2O5J D;  4CS0 A;  1SFO A;  2XDP A;  5D6W A;  2PWY A;  1PPY A;  1G8J A;  3ML1 A;  4FFT A;  2JV2 A;  3QWZ A;  1Y1W A;  3X2P A;  1R7R A;  1HD5 A;  2G6G A;  1TMO A;  1WC2 A;  3ENG A;  3FPT A;  2CW0 D;  2WB1 A;  2R93 A;  4KDI A;  3LGA A;  2JIM A;  2VPY A;  2R92 A;  5D6X A;  4D7Z B;  1OA7 A;  3IR5 A;  5GLX A;  2MM0 A;  2G5D A;  4FG2 A;  4QIW A;  3M3G A;  4CRY G; 
#chains in the Genus database with same CATH homology
 4AYB A;  5DYI A;  2VUM A;  5ERG B;  1TWA A;  4FIB A;  2GAE A;  3GTK A;  2NVY A;  1R9T A;  1H5N A;  3LHD A;  3H0G A;  2NYA A;  1WLF A;  1PQE A;  3GTQ A;  4ARI A;  2B25 A;  1PQF A;  1R27 A;  1KQF A;  2E2I A;  1E32 A;  3ZJV A;  1E5V A;  2MM2 A;  3O5A A;  1CR5 A;  5CCB A;  2VPW A;  2YVL A;  1YLE A;  2VPX A;  3GTJ A;  2VPZ A;  5FTL A;  4UC4 A;  2LW6 A;  2NVX A;  4KOD A;  1PYQ A;  1FDO A;  1I50 A;  3CQZ A;  1PT1 A;  1YNJ D;  2WAQ A;  1DMR A;  2PIC A;  1E60 A;  3QQ8 A;  3GTM A;  5FTK A;  5CCX A;  2Y0S A;  5FTJ A;  1I9G A;  1FDI A;  1O54 A;  3GTP A;  2Q1D X;  3FKI A;  3HU2 A;  2JIQ A;  1AW8 B;  2QQS A;  3FPU A;  4RV0 A;  4C2M A;  5D6Y A;  2B63 A;  3CF2 A;  5CD1 A;  3MB5 A;  2JIR A;  3GTG A;  2A68 D;  1E61 A;  2PJH B;  3QC8 A;  3HU1 A;  5FTM A;  4AAY A;  4AZD A;  3DMR A;  1TWC A;  2PJJ A;  3QQ7 A;  5B6C A;  1PYU B;  4GA5 A;  4AON B;  1ZC1 A;  1UHD A;  1TWH A;  2DMR A;  3IR6 A;  1OGY A;  2YU9 A;  4AQ7 A;  1YNN D;  5C1B A;  4GA6 A;  5FTN A;  1CZ4 A;  3CZB A;  2PMZ A;  4CQN A;  2R7Z A;  1TWG A;  2EEO B;  2IV2 X;  4KDL A;  1CZ5 A;  4KO8 A;  3PLX B;  2PNW A;  2NAP A;  2V3V A;  3ZJT A;  2JA6 A;  5EQJ B;  1G8K A;  1Y4Z A;  3HU3 A;  3OUG A;  1Q16 A;  4AS1 A;  1QCS A;  2JA7 A;  4DMR A;  2C45 A;  5T5I D;  4NOH A;  2KI8 A;  2AE0 X;  1PT0 A;  2GF7 A;  1KQG A;  2QQR A;  2A6H D;  1ZYR D;  3IR7 A;  4AOK B;  2V45 A;  2BE5 D;  2E2H A;  3BQB A;  2PI8 A;  3TIW A;  5C18 A;  1VC3 B;  2Q1C X;  1EU1 A;  1DMS A;  1S3S A;  1K83 A;  1PQH A;  1E18 A;  3ZJU A;  2A69 D;  2Q1A X;  1TWF A;  2JIP A;  5DYG A;  1Y5I A;  2YUJ A;  4CRZ A;  3FPR A;  2JIO A;  1SIW A;  4ARC A;  2KY9 A;  4KLN A;  5T5M D;  1QDN A;  1I3Q A;  1Y1V A;  1SMY D;  5GLF A;  3HKZ A;  2JA5 A;  2GFA A;  1H0H A;  2E7Z A;  5EPP A;  1AA6 A;  2Q18 X;  1WCM A;  3GTL A;  3ZGZ A;  2Q19 X;  1IW7 D;  1UHE A;  2A6E D;  2O5J D;  3GTO A;  3TM7 B;  2XDP A;  4CS0 A;  1SFO A;  5D6W A;  2PWY A;  1PPY A;  1G8J A;  3ML1 A;  2JV2 A;  3QWZ A;  1Y1W A;  1R7R A;  2G6G A;  1TMO A;  3FPT A;  2CW0 D;  2WB1 A;  2R93 A;  4KDI A;  3LGA A;  2JIM A;  2VPY A;  2R92 A;  5D6X A;  4D7Z B;  2MM0 A;  3IR5 A;  2G5D A;  4QIW A;  4CRY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...