1CR5A

N-terminal domain of sec18p
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
178
Chain Sequence
b'TRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIIIDNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVATGIETKGILTKQTQINFFKGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC18P (RESIDUES 22 - 210)
molecule tags Endocytosis/exocytosis
source organism Saccharomyces cerevisiae
publication title Crystal structure of the Sec18p N-terminal domain.
pubmed doi rcsb
total genus 51
structure length 178
sequence length 185
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cr5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cr5A02
3GTLA 1H0HA 1G8KA 2YUJA 2E7ZA 4KO8A 5T5ID 4AZDA 1Y1VA 3IR7A 3H0GA 3HU1A 4KDIA 1Q16A 2YU9A 2JIMA 3GTOA 3HKZA 2NVXA 4KLNA 1FDIA 3CF2A 1SFOA 1YLEA 4RV0A 1H5NA 1QDNA 2NVYA 2V3VA 3TIWA 1PPYA 1E32A 1K83A 1VC3B 1PYUB 3PLXB 2NYAA 3QC8A 3HU3A 1QCSA 1AA6A 1R9TA 2WB1A 1S3SA 2VPYA 1G8JA 2JIPA 3GTPA 1Y5IA 4CRYG 1WLFA 3IR5A 1TWCA 1R7RA 1I50A 1TWHA 4DMRA 1CZ5A 3QWZA 5EPPA 1DMRA 4AONB 5FTLA 3TM7B 1PT1A 2PMZA 4GA6A 5FTJA 3QQ8A 2E2HA 4AYBA 1SIWA 1PT0A 4QIWA 3CQZA 5FTKA 2VUMA 2JV2A 2KI8A 5B6CA 2JA6A 4CS0A 5GLFA 3OUGA 1PQHA 2R93A 3GTGA 1PQEA 2JA7A 2Y0SA 2DMRA 2EEOB 1PYQA 4D7ZB 1IW7D 4GA5A 2R92A 1TWFA 5DYIA 3ML1A 2B63A 5C1BA 4AAYA 1PQFA 1R27A 1UHDA 2V45A 5DYGA 1TWGA 5FTMA 3QQ7A 2E2IA 1E61A 1WCMA 1Y4ZA 2VPWA 3GTKA 5C18A 2NAPA 5T5MD 1I3QA 1OGYA 2PJHB 3HU2A 1CZ4A 2JIOA 4KODA 1DMSA 1Y1WA 4KDLA 2JIQA 2IV2X 1E5VA 1KQFA 2VPZA 3GTJA 4C2MA 1FDOA 4AOKB 1ZC1A 1TWAA 2R7ZA 3DMRA 2VPXA 1AW8B 2JA5A 3O5AA 3IR6A 1E60A 1CR5A 1UHEA 5FTNA 3GTMA 2C45A 3GTQA 2WAQA 4CRZA 1TMOA 3FKIA 1EU1A 1KQGA 1E18A 2JIRA
chains in the Genus database with same CATH superfamily
3GTLA 1H0HA 1G8KA 3ZJUA 2YUJA 2E7ZA 4FG4A 4KO8A 5T5ID 4AZDA 2QQRA 1Y1VA 3IR7A 3H0GA 3HU1A 4KDIA 1Q16A 2PWYA 2YU9A 4L48A 2JIMA 3GTOA 4AS1A 3HKZA 2NVXA 3SUMA 4KLNA 1FDIA 1N10A 4UC4A 3X2KA 3CF2A 4NOHA 1SFOA 4FG2A 1YLEA 2GFAA 4RV0A 1H5NA 1QDNA 2NVYA 2V3VA 4FFTA 3TIWA 2KY9A 1HD5A 2Q1DX 1PPYA 2QQSA 1E32A 4ENGA 1K83A 1VC3B 1PYUB 3ZJVA 3X2JA 2PICA 2MM2A 3MB5A 2G6GA 3PLXB 5CCBA 2NYAA 3QC8A 3X2NA 3CZBA 3HU3A 2A6ED 5D6YA 1QCSA 3ZJTA 4CQNA 3ENGA 5D6XA 1AA6A 1I9GA 2BE5D 1R9TA 5ERGB 3SUJA 1L8FA 2WB1A 2Q1CX 2MM0A 3FPTA 3X2MA 1S3SA 2VPYA 4AQ7A 1G8JA 2PI8A 2JIPA 2AE0X 3GTPA 4JP7A 1Y5IA 3SUKA 4CRYG 1WLFA 2Q18X 4FIBA 4JCWA 1TWCA 1R7RA 3IR5A 1I50A 1WC2A 5CCXA 4ARCA 3X2OA 2GF7A 2A6HD 1TWHA 1OA9A 4DMRA 1CZ5A 5D6WA 3QWZA 5CD1A 5EPPA 1DMRA 4AONB 5FTLA 3FPUA 3TM7B 2G5DA 1PT1A 2PMZA 4GA6A 2A68D 2LW6A 5FTJA 4JS7A 3QQ8A 4JJOA 5H4UA 2E2HA 1BW4A 2PNWA 4FERA 2B25A 4AYBA 1SIWA 1PT0A 3D30A 4QIWA 3CQZA 2A69D 4JP6A 5FTKA 5GM9A 2VUMA 2KI8A 5B6CA 2JA6A 2JV2A 2O5JD 4CS0A 5GLFA 3OUGA 1PQHA 2R93A 3LHDA 3FPRA 3GTGA 1PQEA 2JA7A 2Y0SA 1YNJD 2EEOB 2DMRA 2HCZX 1PYQA 4D7ZB 1IW7D 4GA5A 2R92A 1TWFA 5DYIA 1BW3A 3ML1A 2B63A 2YVLA 5C1BA 3ZGZA 4AAYA 1PQFA 1R27A 1UHDA 2V45A 5DYGA 1TWGA 5FTMA 3QQ7A 5GLYA 3X2PA 2E2IA 1E61A 1WCMA 1YNND 1Y4ZA 2PJJA 2VPWA 3GTKA 1O54A 5C18A 3SULA 4ZM7A 2Q19X 2NAPA 5T5MD 1I3QA 1OGYA 2PJHB 3HU2A 1CZ4A 2JIOA 4KODA 2XDPA 1DMSA 3LGAA 1Y1WA 4KDLA 3M3GA 3X2IA 2JIQA 2IV2X 1E5VA 1ZYRD 3X2LA 1KQFA 4ARIA 2VPZA 2ENGA 3GTJA 1SMYD 4C2MA 5EQJB 1FDOA 1ZC1A 4AOKB 2Q1AX 1TWAA 2CW0D 2R7ZA 2KQAA 3DMRA 2VPXA 2GAEA 1AW8B 2JA5A 3O5AA 1OA7A 3IR6A 1E60A 1CR5A 1UHEA 5FTNA 2BH0A 3X2GA 2C45A 5GLXA 3GTQA 3GTMA 3BQBA 2WAQA 4CRZA 1TMOA 3FKIA 1EU1A 1KQGA 1E18A 2JIRA 4AVRA 3X2HA
chains in the Genus database with same CATH topology
3GTLA 1H0HA 1G8KA 3ZJUA 2YUJA 2E7ZA 2QQRA 4KO8A 5T5ID 4AZDA 1Y1VA 3IR7A 3H0GA 3HU1A 4KDIA 1Q16A 2PWYA 2YU9A 2JIMA 3GTOA 4AS1A 3HKZA 2NVXA 4KLNA 1FDIA 4UC4A 3CF2A 4NOHA 1SFOA 1YLEA 2GFAA 4RV0A 1H5NA 1QDNA 2NVYA 2V3VA 3TIWA 2KY9A 2Q1DX 1PPYA 2QQSA 1E32A 1K83A 1VC3B 1PYUB 3ZJVA 2PICA 2MM2A 3MB5A 2G6GA 3PLXB 5CCBA 2NYAA 3QC8A 3CZBA 3HU3A 2A6ED 5D6YA 1QCSA 3ZJTA 4CQNA 5D6XA 1AA6A 1I9GA 2BE5D 1R9TA 5ERGB 2WB1A 2Q1CX 2MM0A 3FPTA 1S3SA 2VPYA 1G8JA 2PI8A 2JIPA 2AE0X 3GTPA 1Y5IA 4CRYG 1WLFA 2Q18X 4FIBA 1TWCA 1R7RA 3IR5A 1I50A 5CCXA 4ARCA 2GF7A 2A6HD 1TWHA 4DMRA 1CZ5A 5D6WA 3QWZA 5CD1A 5EPPA 1DMRA 4AONB 5FTLA 3FPUA 3TM7B 2G5DA 1PT1A 2PMZA 4GA6A 2A68D 2LW6A 5FTJA 3QQ8A 2E2HA 2PNWA 2B25A 4AYBA 1SIWA 1PT0A 4QIWA 3CQZA 2A69D 5FTKA 2VUMA 2JV2A 2KI8A 5B6CA 2JA6A 2O5JD 4CS0A 5GLFA 3OUGA 1PQHA 2R93A 3LHDA 3FPRA 3GTGA 1PQEA 2JA7A 2Y0SA 1YNJD 2EEOB 2DMRA 4AQ7A 1PYQA 4D7ZB 1IW7D 4GA5A 2R92A 1TWFA 5DYIA 3ML1A 2B63A 2YVLA 5C1BA 3ZGZA 4AAYA 1PQFA 2V45A 1R27A 1UHDA 5DYGA 1TWGA 5FTMA 3QQ7A 2E2IA 1E61A 1WCMA 1YNND 2PJJA 1Y4ZA 2VPWA 3GTKA 1O54A 5C18A 2Q19X 2NAPA 5T5MD 1I3QA 1OGYA 2PJHB 3HU2A 1CZ4A 2JIOA 4KODA 2XDPA 1DMSA 3LGAA 1Y1WA 4KDLA 2JIQA 2IV2X 1E5VA 1ZYRD 1KQFA 4ARIA 2VPZA 3GTJA 1SMYD 4C2MA 5EQJB 1FDOA 1ZC1A 4AOKB 2Q1AX 1TWAA 2CW0D 2R7ZA 3DMRA 2VPXA 2GAEA 1AW8B 2JA5A 3O5AA 3IR6A 1E60A 1CR5A 1UHEA 5FTNA 3GTMA 3BQBA 2C45A 3GTQA 2WAQA 4CRZA 1TMOA 3FKIA 1EU1A 1KQGA 1E18A 2JIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL A;  1H0H A;  1G8K A;  2YUJ A;  2E7Z A;  4KO8 A;  5T5I D;  4AZD A;  1Y1V A;  3IR7 A;  3H0G A;  3HU1 A;  4KDI A;  1Q16 A;  2YU9 A;  2JIM A;  3GTO A;  3HKZ A;  2NVX A;  4KLN A;  1FDI A;  3CF2 A;  1SFO A;  1YLE A;  4RV0 A;  1H5N A;  1QDN A;  2NVY A;  2V3V A;  3TIW A;  1PPY A;  1E32 A;  1K83 A;  1VC3 B;  1PYU B;  3PLX B;  2NYA A;  3QC8 A;  3HU3 A;  1QCS A;  1AA6 A;  1R9T A;  2WB1 A;  1S3S A;  2VPY A;  1G8J A;  2JIP A;  3GTP A;  1Y5I A;  4CRY G;  1WLF A;  3IR5 A;  1TWC A;  1R7R A;  1I50 A;  1TWH A;  4DMR A;  1CZ5 A;  3QWZ A;  5EPP A;  1DMR A;  4AON B;  5FTL A;  3TM7 B;  1PT1 A;  2PMZ A;  4GA6 A;  5FTJ A;  3QQ8 A;  2E2H A;  4AYB A;  1SIW A;  1PT0 A;  4QIW A;  3CQZ A;  5FTK A;  2VUM A;  2JV2 A;  2KI8 A;  5B6C A;  2JA6 A;  4CS0 A;  5GLF A;  3OUG A;  1PQH A;  2R93 A;  3GTG A;  1PQE A;  2JA7 A;  2Y0S A;  2DMR A;  2EEO B;  1PYQ A;  4D7Z B;  1IW7 D;  4GA5 A;  2R92 A;  1TWF A;  5DYI A;  3ML1 A;  2B63 A;  5C1B A;  4AAY A;  1PQF A;  1R27 A;  1UHD A;  2V45 A;  5DYG A;  1TWG A;  5FTM A;  3QQ7 A;  2E2I A;  1E61 A;  1WCM A;  1Y4Z A;  2VPW A;  3GTK A;  5C18 A;  2NAP A;  5T5M D;  1I3Q A;  1OGY A;  2PJH B;  3HU2 A;  1CZ4 A;  2JIO A;  4KOD A;  1DMS A;  1Y1W A;  4KDL A;  2JIQ A;  2IV2 X;  1E5V A;  1KQF A;  2VPZ A;  3GTJ A;  4C2M A;  1FDO A;  4AOK B;  1ZC1 A;  1TWA A;  2R7Z A;  3DMR A;  2VPX A;  1AW8 B;  2JA5 A;  3O5A A;  3IR6 A;  1E60 A;  1CR5 A;  1UHE A;  5FTN A;  3GTM A;  2C45 A;  3GTQ A;  2WAQ A;  4CRZ A;  1TMO A;  3FKI A;  1EU1 A;  1KQG A;  1E18 A;  2JIR A; 
#chains in the Genus database with same CATH topology
 3GTL A;  1H0H A;  1G8K A;  3ZJU A;  2YUJ A;  2E7Z A;  4FG4 A;  4KO8 A;  5T5I D;  4AZD A;  2QQR A;  1Y1V A;  3IR7 A;  3H0G A;  3HU1 A;  4KDI A;  1Q16 A;  2PWY A;  2YU9 A;  4L48 A;  2JIM A;  3GTO A;  4AS1 A;  3HKZ A;  2NVX A;  3SUM A;  4KLN A;  1FDI A;  1N10 A;  4UC4 A;  3X2K A;  3CF2 A;  4NOH A;  1SFO A;  4FG2 A;  1YLE A;  2GFA A;  4RV0 A;  1H5N A;  1QDN A;  2NVY A;  2V3V A;  4FFT A;  3TIW A;  2KY9 A;  1HD5 A;  2Q1D X;  1PPY A;  2QQS A;  1E32 A;  4ENG A;  1K83 A;  1VC3 B;  1PYU B;  3ZJV A;  3X2J A;  2PIC A;  2MM2 A;  3MB5 A;  2G6G A;  3PLX B;  5CCB A;  2NYA A;  3QC8 A;  3X2N A;  3CZB A;  3HU3 A;  2A6E D;  5D6Y A;  1QCS A;  3ZJT A;  4CQN A;  3ENG A;  5D6X A;  1AA6 A;  1I9G A;  2BE5 D;  1R9T A;  5ERG B;  3SUJ A;  1L8F A;  2WB1 A;  2Q1C X;  2MM0 A;  3FPT A;  3X2M A;  1S3S A;  2VPY A;  4AQ7 A;  1G8J A;  2PI8 A;  2JIP A;  2AE0 X;  3GTP A;  4JP7 A;  1Y5I A;  3SUK A;  4CRY G;  1WLF A;  2Q18 X;  4FIB A;  4JCW A;  1TWC A;  1R7R A;  3IR5 A;  1I50 A;  1WC2 A;  5CCX A;  4ARC A;  3X2O A;  2GF7 A;  2A6H D;  1TWH A;  1OA9 A;  4DMR A;  1CZ5 A;  5D6W A;  3QWZ A;  5CD1 A;  5EPP A;  1DMR A;  4AON B;  5FTL A;  3FPU A;  3TM7 B;  2G5D A;  1PT1 A;  2PMZ A;  4GA6 A;  2A68 D;  2LW6 A;  5FTJ A;  4JS7 A;  3QQ8 A;  4JJO A;  5H4U A;  2E2H A;  1BW4 A;  2PNW A;  4FER A;  2B25 A;  4AYB A;  1SIW A;  1PT0 A;  3D30 A;  4QIW A;  3CQZ A;  2A69 D;  4JP6 A;  5FTK A;  5GM9 A;  2VUM A;  2KI8 A;  5B6C A;  2JA6 A;  2JV2 A;  2O5J D;  4CS0 A;  5GLF A;  3OUG A;  1PQH A;  2R93 A;  3LHD A;  3FPR A;  3GTG A;  1PQE A;  2JA7 A;  2Y0S A;  1YNJ D;  2EEO B;  2DMR A;  2HCZ X;  1PYQ A;  4D7Z B;  1IW7 D;  4GA5 A;  2R92 A;  1TWF A;  5DYI A;  1BW3 A;  3ML1 A;  2B63 A;  2YVL A;  5C1B A;  3ZGZ A;  4AAY A;  1PQF A;  1R27 A;  1UHD A;  2V45 A;  5DYG A;  1TWG A;  5FTM A;  3QQ7 A;  5GLY A;  3X2P A;  2E2I A;  1E61 A;  1WCM A;  1YNN D;  1Y4Z A;  2PJJ A;  2VPW A;  3GTK A;  1O54 A;  5C18 A;  3SUL A;  4ZM7 A;  2Q19 X;  2NAP A;  5T5M D;  1I3Q A;  1OGY A;  2PJH B;  3HU2 A;  1CZ4 A;  2JIO A;  4KOD A;  2XDP A;  1DMS A;  3LGA A;  1Y1W A;  4KDL A;  3M3G A;  3X2I A;  2JIQ A;  2IV2 X;  1E5V A;  1ZYR D;  3X2L A;  1KQF A;  4ARI A;  2VPZ A;  2ENG A;  3GTJ A;  1SMY D;  4C2M A;  5EQJ B;  1FDO A;  1ZC1 A;  4AOK B;  2Q1A X;  1TWA A;  2CW0 D;  2R7Z A;  2KQA A;  3DMR A;  2VPX A;  2GAE A;  1AW8 B;  2JA5 A;  3O5A A;  1OA7 A;  3IR6 A;  1E60 A;  1CR5 A;  1UHE A;  5FTN A;  2BH0 A;  3X2G A;  2C45 A;  5GLX A;  3GTQ A;  3GTM A;  3BQB A;  2WAQ A;  4CRZ A;  1TMO A;  3FKI A;  1EU1 A;  1KQG A;  1E18 A;  2JIR A;  4AVR A;  3X2H A; 
#chains in the Genus database with same CATH homology
 3GTL A;  1H0H A;  1G8K A;  3ZJU A;  2YUJ A;  2E7Z A;  2QQR A;  4KO8 A;  5T5I D;  4AZD A;  1Y1V A;  3IR7 A;  3H0G A;  3HU1 A;  4KDI A;  1Q16 A;  2PWY A;  2YU9 A;  2JIM A;  3GTO A;  4AS1 A;  3HKZ A;  2NVX A;  4KLN A;  1FDI A;  4UC4 A;  3CF2 A;  4NOH A;  1SFO A;  1YLE A;  2GFA A;  4RV0 A;  1H5N A;  1QDN A;  2NVY A;  2V3V A;  3TIW A;  2KY9 A;  2Q1D X;  1PPY A;  2QQS A;  1E32 A;  1K83 A;  1VC3 B;  1PYU B;  3ZJV A;  2PIC A;  2MM2 A;  3MB5 A;  2G6G A;  3PLX B;  5CCB A;  2NYA A;  3QC8 A;  3CZB A;  3HU3 A;  2A6E D;  5D6Y A;  1QCS A;  3ZJT A;  4CQN A;  5D6X A;  1AA6 A;  1I9G A;  2BE5 D;  1R9T A;  5ERG B;  2WB1 A;  2Q1C X;  2MM0 A;  3FPT A;  1S3S A;  2VPY A;  1G8J A;  2PI8 A;  2JIP A;  2AE0 X;  3GTP A;  1Y5I A;  4CRY G;  1WLF A;  2Q18 X;  4FIB A;  1TWC A;  1R7R A;  3IR5 A;  1I50 A;  5CCX A;  4ARC A;  2GF7 A;  2A6H D;  1TWH A;  4DMR A;  1CZ5 A;  5D6W A;  3QWZ A;  5CD1 A;  5EPP A;  1DMR A;  4AON B;  5FTL A;  3FPU A;  3TM7 B;  2G5D A;  1PT1 A;  2PMZ A;  4GA6 A;  2A68 D;  2LW6 A;  5FTJ A;  3QQ8 A;  2E2H A;  2PNW A;  2B25 A;  4AYB A;  1SIW A;  1PT0 A;  4QIW A;  3CQZ A;  2A69 D;  5FTK A;  2VUM A;  2JV2 A;  2KI8 A;  5B6C A;  2JA6 A;  2O5J D;  4CS0 A;  5GLF A;  3OUG A;  1PQH A;  2R93 A;  3LHD A;  3FPR A;  3GTG A;  1PQE A;  2JA7 A;  2Y0S A;  1YNJ D;  2EEO B;  2DMR A;  4AQ7 A;  1PYQ A;  4D7Z B;  1IW7 D;  4GA5 A;  2R92 A;  1TWF A;  5DYI A;  3ML1 A;  2B63 A;  2YVL A;  5C1B A;  3ZGZ A;  4AAY A;  1PQF A;  2V45 A;  1R27 A;  1UHD A;  5DYG A;  1TWG A;  5FTM A;  3QQ7 A;  2E2I A;  1E61 A;  1WCM A;  1YNN D;  2PJJ A;  1Y4Z A;  2VPW A;  3GTK A;  1O54 A;  5C18 A;  2Q19 X;  2NAP A;  5T5M D;  1I3Q A;  1OGY A;  2PJH B;  3HU2 A;  1CZ4 A;  2JIO A;  4KOD A;  2XDP A;  1DMS A;  3LGA A;  1Y1W A;  4KDL A;  2JIQ A;  2IV2 X;  1E5V A;  1ZYR D;  1KQF A;  4ARI A;  2VPZ A;  3GTJ A;  1SMY D;  4C2M A;  5EQJ B;  1FDO A;  1ZC1 A;  4AOK B;  2Q1A X;  1TWA A;  2CW0 D;  2R7Z A;  3DMR A;  2VPX A;  2GAE A;  1AW8 B;  2JA5 A;  3O5A A;  3IR6 A;  1E60 A;  1CR5 A;  1UHE A;  5FTN A;  3GTM A;  3BQB A;  2C45 A;  3GTQ A;  2WAQ A;  4CRZ A;  1TMO A;  3FKI A;  1EU1 A;  1KQG A;  1E18 A;  2JIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...