1QCSA

N-terminal domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
195
Chain Sequence
NMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR (NSF-N)
publication title NSF N-terminal domain crystal structure: models of NSF function.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Fusion protein
total genus 37
structure length 195
sequence length 202
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qcsA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qcsA02
1QCSA 2Y0SA 2EEOB 2B63A 2VPWA 1ZC1A 5T5MD 4KO8A 4AZDA 1TWFA 1Q16A 3HU1A 1PT1A 2JA7A 2DMRA 3QWZA 1WLFA 1QDNA 5FTMA 3GTLA 1KQGA 5FTNA 2R92A 3H0GA 1R27A 1SFOA 3CQZA 5GLFA 2JA6A 1E60A 1I50A 1OGYA 1UHEA 2JV2A 1YLEA 4GA5A 1UHDA 1PQHA 1FDIA 3O5AA 3TIWA 4AOKB 5C18A 1AA6A 1I3QA 4QIWA 3QQ7A 2NYAA 2E2HA 1H0HA 3GTQA 2JA5A 1EU1A 1AW8B 1R9TA 2KI8A 4GA6A 3GTGA 1H5NA 4KODA 1VC3B 1WCMA 2R7ZA 1DMRA 2V3VA 5DYIA 4RV0A 2E7ZA 3CF2A 4CRZA 4AYBA 2PJHB 1KQFA 2C45A 2VPYA 3PLXB 1SIWA 1E5VA 2YUJA 4AONB 3HKZA 3GTOA 1Y1VA 3IR6A 4D7ZB 5FTKA 1TWHA 1K83A 4C2MA 2WB1A 2VPZA 1CZ5A 5B6CA 2IV2X 2NVYA 1Y4ZA 2WAQA 1CZ4A 2JIPA 2PMZA 4DMRA 5DYGA 3IR7A 1R7RA 1E18A 2VPXA 4KDLA 1PPYA 1Y5IA 5C1BA 1Y1WA 4KDIA 3QQ8A 3GTPA 1E61A 1PQFA 2JIOA 4AAYA 4CS0A 1TWAA 3OUGA 1IW7D 1PYQA 1G8JA 2NVXA 2E2IA 1FDOA 3GTMA 1TWGA 1TMOA 1PQEA 2JIMA 5T5ID 3FKIA 1PYUB 5FTJA 2JIRA 3GTJA 3GTKA 2V45A 1DMSA 2VUMA 1S3SA 3DMRA 3HU2A 3IR5A 2NAPA 3QC8A 5EPPA 3TM7B 1CR5A 4KLNA 3HU3A 3ML1A 1E32A 2JIQA 1G8KA 4CRYG 5FTLA 1TWCA 2YU9A 2R93A 1PT0A
chains in the Genus database with same CATH superfamily
1QCSA 2Y0SA 4FG4A 2EEOB 2B63A 2VPWA 3D30A 1ZC1A 2G6GA 5T5MD 4KO8A 3X2PA 1TWFA 1Q16A 4AZDA 2PJJA 2Q19X 3HU1A 1OA9A 2HCZX 1PT1A 3ZGZA 5D6XA 2JA7A 2DMRA 4FERA 3QWZA 1WLFA 1QDNA 5FTMA 3GTLA 4ZM7A 2XDPA 2Q18X 3SUMA 2A6ED 1KQGA 1BW3A 5FTNA 2R92A 3H0GA 2KY9A 1R27A 4NOHA 3CQZA 1SFOA 5GLFA 2JA6A 3M3GA 1E60A 1I50A 1OGYA 1L8FA 1UHEA 2JV2A 2Q1CX 1YLEA 3SULA 4FG2A 4GA5A 1UHDA 1PQHA 3X2KA 1FDIA 4JP6A 2PWYA 2KQAA 3O5AA 2Q1AX 3TIWA 2PICA 4AOKB 5C18A 1AA6A 1I3QA 4QIWA 3QQ7A 2NYAA 4UC4A 2E2HA 1H0HA 1I9GA 3GTQA 2JA5A 1EU1A 3X2JA 3SUKA 4CQNA 1AW8B 5CD1A 3BQBA 1R9TA 2KI8A 4GA6A 3GTGA 2LW6A 1H5NA 4KODA 3X2LA 1VC3B 4JJOA 1WC2A 1WCMA 2R7ZA 1DMRA 2V3VA 5DYIA 4RV0A 2E7ZA 3CF2A 3X2HA 4CRZA 4AYBA 5CCBA 2PJHB 1O54A 1KQFA 2C45A 2AE0X 2GAEA 2VPYA 3PLXB 1SIWA 1E5VA 2YUJA 4AONB 1ZYRD 3HKZA 3X2IA 2A69D 4AVRA 3GTOA 1Y1VA 4ARIA 3IR6A 4D7ZB 5FTKA 5GLXA 2MM2A 3FPRA 2BE5D 1TWHA 1K83A 4C2MA 2WB1A 5CCXA 1OA7A 3ZJUA 2VPZA 1CZ5A 5B6CA 2B25A 4FIBA 2IV2X 1HD5A 2NVYA 2QQRA 3ZJTA 1Y4ZA 2WAQA 1CZ4A 2JIPA 3ENGA 5H4UA 2PMZA 1YNND 4DMRA 2O5JD 2GF7A 2GFAA 3ZJVA 5DYGA 3IR7A 4AS1A 1R7RA 1E18A 2VPXA 4KDLA 1PPYA 1Y5IA 5C1BA 1Y1WA 3CZBA 4KDIA 2ENGA 3QQ8A 3GTPA 4FFTA 1E61A 5GLYA 1PQFA 3MB5A 5D6YA 3X2NA 2JIOA 4AAYA 4CS0A 1TWAA 3OUGA 3FPTA 3SUJA 3LHDA 2A6HD 5EQJB 3X2MA 1IW7D 1PYQA 1G8JA 2NVXA 2E2IA 2CW0D 1FDOA 3GTMA 1TWGA 1YNJD 2QQSA 1TMOA 2YVLA 1N10A 1PQEA 2JIMA 5T5ID 3FKIA 2PNWA 2MM0A 4ARCA 1PYUB 2A68D 5FTJA 3X2OA 2JIRA 3GTJA 3GTKA 2Q1DX 2V45A 1DMSA 2VUMA 4JCWA 4L48A 1S3SA 3DMRA 4AQ7A 3X2GA 3HU2A 3IR5A 5ERGB 5D6WA 2NAPA 3QC8A 4JS7A 5EPPA 3TM7B 1CR5A 4KLNA 2PI8A 4ENGA 3HU3A 3LGAA 3ML1A 5GM9A 1E32A 2JIQA 1G8KA 1SMYD 4CRYG 5FTLA 1TWCA 2YU9A 2BH0A 4JP7A 2R93A 2G5DA 3FPUA 1BW4A 1PT0A
chains in the Genus database with same CATH topology
1QCSA 2Y0SA 2EEOB 2B63A 2VPWA 1ZC1A 2G6GA 5T5MD 4KO8A 4AZDA 1TWFA 1Q16A 2PJJA 2Q19X 3HU1A 1PT1A 3ZGZA 5D6XA 2JA7A 2DMRA 3QWZA 1WLFA 1QDNA 5FTMA 3GTLA 2XDPA 2Q18X 1KQGA 2A6ED 5FTNA 2R92A 3H0GA 2KY9A 1R27A 4NOHA 3CQZA 1SFOA 5GLFA 2JA6A 1E60A 1I50A 1OGYA 1UHEA 2JV2A 2Q1CX 1YLEA 4GA5A 1UHDA 1PQHA 2PWYA 1FDIA 3O5AA 2Q1AX 3TIWA 2PICA 4AOKB 5C18A 1AA6A 1I3QA 4QIWA 3QQ7A 2NYAA 4UC4A 2E2HA 1H0HA 1I9GA 3GTQA 2JA5A 1EU1A 4CQNA 1AW8B 5CD1A 3BQBA 1R9TA 2KI8A 4GA6A 3GTGA 2LW6A 1H5NA 4KODA 1VC3B 1WCMA 2R7ZA 1DMRA 2V3VA 5DYIA 4RV0A 2E7ZA 3CF2A 4CRZA 4AYBA 5CCBA 2PJHB 1O54A 1KQFA 2C45A 2AE0X 2GAEA 2VPYA 3PLXB 1SIWA 1E5VA 2YUJA 4AONB 1ZYRD 3HKZA 2A69D 3GTOA 1Y1VA 4ARIA 3IR6A 4D7ZB 5FTKA 2MM2A 3FPRA 2BE5D 1TWHA 1K83A 4C2MA 2WB1A 5CCXA 3ZJUA 2VPZA 1CZ5A 5B6CA 2B25A 4FIBA 2IV2X 2NVYA 2QQRA 3ZJTA 1Y4ZA 2WAQA 1CZ4A 2JIPA 2O5JD 2GF7A 2PMZA 1YNND 4DMRA 2GFAA 3ZJVA 5DYGA 3IR7A 4AS1A 1R7RA 1E18A 2VPXA 4KDLA 1PPYA 1Y5IA 5C1BA 1Y1WA 3CZBA 4KDIA 3QQ8A 3GTPA 1E61A 1PQFA 3MB5A 5D6YA 3FPTA 2JIOA 4AAYA 4CS0A 1TWAA 3OUGA 3LHDA 5EQJB 2A6HD 1IW7D 1PYQA 1G8JA 2NVXA 2E2IA 2CW0D 1FDOA 3GTMA 1TWGA 1YNJD 2QQSA 1TMOA 2YVLA 1PQEA 2JIMA 5T5ID 3FKIA 2PNWA 2MM0A 4ARCA 1PYUB 2A68D 5FTJA 2JIRA 3GTJA 3GTKA 2Q1DX 2V45A 1DMSA 2VUMA 1S3SA 3DMRA 4AQ7A 3HU2A 3IR5A 5ERGB 5D6WA 2NAPA 3QC8A 5EPPA 3TM7B 1CR5A 4KLNA 2PI8A 3LGAA 3HU3A 3ML1A 1E32A 2JIQA 1G8KA 1SMYD 4CRYG 5FTLA 1TWCA 2YU9A 2R93A 3FPUA 2G5DA 1PT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCS A;  2Y0S A;  2EEO B;  2B63 A;  2VPW A;  1ZC1 A;  5T5M D;  4KO8 A;  4AZD A;  1TWF A;  1Q16 A;  3HU1 A;  1PT1 A;  2JA7 A;  2DMR A;  3QWZ A;  1WLF A;  1QDN A;  5FTM A;  3GTL A;  1KQG A;  5FTN A;  2R92 A;  3H0G A;  1R27 A;  1SFO A;  3CQZ A;  5GLF A;  2JA6 A;  1E60 A;  1I50 A;  1OGY A;  1UHE A;  2JV2 A;  1YLE A;  4GA5 A;  1UHD A;  1PQH A;  1FDI A;  3O5A A;  3TIW A;  4AOK B;  5C18 A;  1AA6 A;  1I3Q A;  4QIW A;  3QQ7 A;  2NYA A;  2E2H A;  1H0H A;  3GTQ A;  2JA5 A;  1EU1 A;  1AW8 B;  1R9T A;  2KI8 A;  4GA6 A;  3GTG A;  1H5N A;  4KOD A;  1VC3 B;  1WCM A;  2R7Z A;  1DMR A;  2V3V A;  5DYI A;  4RV0 A;  2E7Z A;  3CF2 A;  4CRZ A;  4AYB A;  2PJH B;  1KQF A;  2C45 A;  2VPY A;  3PLX B;  1SIW A;  1E5V A;  2YUJ A;  4AON B;  3HKZ A;  3GTO A;  1Y1V A;  3IR6 A;  4D7Z B;  5FTK A;  1TWH A;  1K83 A;  4C2M A;  2WB1 A;  2VPZ A;  1CZ5 A;  5B6C A;  2IV2 X;  2NVY A;  1Y4Z A;  2WAQ A;  1CZ4 A;  2JIP A;  2PMZ A;  4DMR A;  5DYG A;  3IR7 A;  1R7R A;  1E18 A;  2VPX A;  4KDL A;  1PPY A;  1Y5I A;  5C1B A;  1Y1W A;  4KDI A;  3QQ8 A;  3GTP A;  1E61 A;  1PQF A;  2JIO A;  4AAY A;  4CS0 A;  1TWA A;  3OUG A;  1IW7 D;  1PYQ A;  1G8J A;  2NVX A;  2E2I A;  1FDO A;  3GTM A;  1TWG A;  1TMO A;  1PQE A;  2JIM A;  5T5I D;  3FKI A;  1PYU B;  5FTJ A;  2JIR A;  3GTJ A;  3GTK A;  2V45 A;  1DMS A;  2VUM A;  1S3S A;  3DMR A;  3HU2 A;  3IR5 A;  2NAP A;  3QC8 A;  5EPP A;  3TM7 B;  1CR5 A;  4KLN A;  3HU3 A;  3ML1 A;  1E32 A;  2JIQ A;  1G8K A;  4CRY G;  5FTL A;  1TWC A;  2YU9 A;  2R93 A;  1PT0 A; 
#chains in the Genus database with same CATH topology
 1QCS A;  2Y0S A;  4FG4 A;  2EEO B;  2B63 A;  2VPW A;  3D30 A;  1ZC1 A;  2G6G A;  5T5M D;  4KO8 A;  3X2P A;  1TWF A;  1Q16 A;  4AZD A;  2PJJ A;  2Q19 X;  3HU1 A;  1OA9 A;  2HCZ X;  1PT1 A;  3ZGZ A;  5D6X A;  2JA7 A;  2DMR A;  4FER A;  3QWZ A;  1WLF A;  1QDN A;  5FTM A;  3GTL A;  4ZM7 A;  2XDP A;  2Q18 X;  3SUM A;  2A6E D;  1KQG A;  1BW3 A;  5FTN A;  2R92 A;  3H0G A;  2KY9 A;  1R27 A;  4NOH A;  3CQZ A;  1SFO A;  5GLF A;  2JA6 A;  3M3G A;  1E60 A;  1I50 A;  1OGY A;  1L8F A;  1UHE A;  2JV2 A;  2Q1C X;  1YLE A;  3SUL A;  4FG2 A;  4GA5 A;  1UHD A;  1PQH A;  3X2K A;  1FDI A;  4JP6 A;  2PWY A;  2KQA A;  3O5A A;  2Q1A X;  3TIW A;  2PIC A;  4AOK B;  5C18 A;  1AA6 A;  1I3Q A;  4QIW A;  3QQ7 A;  2NYA A;  4UC4 A;  2E2H A;  1H0H A;  1I9G A;  3GTQ A;  2JA5 A;  1EU1 A;  3X2J A;  3SUK A;  4CQN A;  1AW8 B;  5CD1 A;  3BQB A;  1R9T A;  2KI8 A;  4GA6 A;  3GTG A;  2LW6 A;  1H5N A;  4KOD A;  3X2L A;  1VC3 B;  4JJO A;  1WC2 A;  1WCM A;  2R7Z A;  1DMR A;  2V3V A;  5DYI A;  4RV0 A;  2E7Z A;  3CF2 A;  3X2H A;  4CRZ A;  4AYB A;  5CCB A;  2PJH B;  1O54 A;  1KQF A;  2C45 A;  2AE0 X;  2GAE A;  2VPY A;  3PLX B;  1SIW A;  1E5V A;  2YUJ A;  4AON B;  1ZYR D;  3HKZ A;  3X2I A;  2A69 D;  4AVR A;  3GTO A;  1Y1V A;  4ARI A;  3IR6 A;  4D7Z B;  5FTK A;  5GLX A;  2MM2 A;  3FPR A;  2BE5 D;  1TWH A;  1K83 A;  4C2M A;  2WB1 A;  5CCX A;  1OA7 A;  3ZJU A;  2VPZ A;  1CZ5 A;  5B6C A;  2B25 A;  4FIB A;  2IV2 X;  1HD5 A;  2NVY A;  2QQR A;  3ZJT A;  1Y4Z A;  2WAQ A;  1CZ4 A;  2JIP A;  3ENG A;  5H4U A;  2PMZ A;  1YNN D;  4DMR A;  2O5J D;  2GF7 A;  2GFA A;  3ZJV A;  5DYG A;  3IR7 A;  4AS1 A;  1R7R A;  1E18 A;  2VPX A;  4KDL A;  1PPY A;  1Y5I A;  5C1B A;  1Y1W A;  3CZB A;  4KDI A;  2ENG A;  3QQ8 A;  3GTP A;  4FFT A;  1E61 A;  5GLY A;  1PQF A;  3MB5 A;  5D6Y A;  3X2N A;  2JIO A;  4AAY A;  4CS0 A;  1TWA A;  3OUG A;  3FPT A;  3SUJ A;  3LHD A;  2A6H D;  5EQJ B;  3X2M A;  1IW7 D;  1PYQ A;  1G8J A;  2NVX A;  2E2I A;  2CW0 D;  1FDO A;  3GTM A;  1TWG A;  1YNJ D;  2QQS A;  1TMO A;  2YVL A;  1N10 A;  1PQE A;  2JIM A;  5T5I D;  3FKI A;  2PNW A;  2MM0 A;  4ARC A;  1PYU B;  2A68 D;  5FTJ A;  3X2O A;  2JIR A;  3GTJ A;  3GTK A;  2Q1D X;  2V45 A;  1DMS A;  2VUM A;  4JCW A;  4L48 A;  1S3S A;  3DMR A;  4AQ7 A;  3X2G A;  3HU2 A;  3IR5 A;  5ERG B;  5D6W A;  2NAP A;  3QC8 A;  4JS7 A;  5EPP A;  3TM7 B;  1CR5 A;  4KLN A;  2PI8 A;  4ENG A;  3HU3 A;  3LGA A;  3ML1 A;  5GM9 A;  1E32 A;  2JIQ A;  1G8K A;  1SMY D;  4CRY G;  5FTL A;  1TWC A;  2YU9 A;  2BH0 A;  4JP7 A;  2R93 A;  2G5D A;  3FPU A;  1BW4 A;  1PT0 A; 
#chains in the Genus database with same CATH homology
 1QCS A;  2Y0S A;  2EEO B;  2B63 A;  2VPW A;  1ZC1 A;  2G6G A;  5T5M D;  4KO8 A;  4AZD A;  1TWF A;  1Q16 A;  2PJJ A;  2Q19 X;  3HU1 A;  1PT1 A;  3ZGZ A;  5D6X A;  2JA7 A;  2DMR A;  3QWZ A;  1WLF A;  1QDN A;  5FTM A;  3GTL A;  2XDP A;  2Q18 X;  1KQG A;  2A6E D;  5FTN A;  2R92 A;  3H0G A;  2KY9 A;  1R27 A;  4NOH A;  3CQZ A;  1SFO A;  5GLF A;  2JA6 A;  1E60 A;  1I50 A;  1OGY A;  1UHE A;  2JV2 A;  2Q1C X;  1YLE A;  4GA5 A;  1UHD A;  1PQH A;  2PWY A;  1FDI A;  3O5A A;  2Q1A X;  3TIW A;  2PIC A;  4AOK B;  5C18 A;  1AA6 A;  1I3Q A;  4QIW A;  3QQ7 A;  2NYA A;  4UC4 A;  2E2H A;  1H0H A;  1I9G A;  3GTQ A;  2JA5 A;  1EU1 A;  4CQN A;  1AW8 B;  5CD1 A;  3BQB A;  1R9T A;  2KI8 A;  4GA6 A;  3GTG A;  2LW6 A;  1H5N A;  4KOD A;  1VC3 B;  1WCM A;  2R7Z A;  1DMR A;  2V3V A;  5DYI A;  4RV0 A;  2E7Z A;  3CF2 A;  4CRZ A;  4AYB A;  5CCB A;  2PJH B;  1O54 A;  1KQF A;  2C45 A;  2AE0 X;  2GAE A;  2VPY A;  3PLX B;  1SIW A;  1E5V A;  2YUJ A;  4AON B;  1ZYR D;  3HKZ A;  2A69 D;  3GTO A;  1Y1V A;  4ARI A;  3IR6 A;  4D7Z B;  5FTK A;  2MM2 A;  3FPR A;  2BE5 D;  1TWH A;  1K83 A;  4C2M A;  2WB1 A;  5CCX A;  3ZJU A;  2VPZ A;  1CZ5 A;  5B6C A;  2B25 A;  4FIB A;  2IV2 X;  2NVY A;  2QQR A;  3ZJT A;  1Y4Z A;  2WAQ A;  1CZ4 A;  2JIP A;  2O5J D;  2GF7 A;  2PMZ A;  1YNN D;  4DMR A;  2GFA A;  3ZJV A;  5DYG A;  3IR7 A;  4AS1 A;  1R7R A;  1E18 A;  2VPX A;  4KDL A;  1PPY A;  1Y5I A;  5C1B A;  1Y1W A;  3CZB A;  4KDI A;  3QQ8 A;  3GTP A;  1E61 A;  1PQF A;  3MB5 A;  5D6Y A;  3FPT A;  2JIO A;  4AAY A;  4CS0 A;  1TWA A;  3OUG A;  3LHD A;  5EQJ B;  2A6H D;  1IW7 D;  1PYQ A;  1G8J A;  2NVX A;  2E2I A;  2CW0 D;  1FDO A;  3GTM A;  1TWG A;  1YNJ D;  2QQS A;  1TMO A;  2YVL A;  1PQE A;  2JIM A;  5T5I D;  3FKI A;  2PNW A;  2MM0 A;  4ARC A;  1PYU B;  2A68 D;  5FTJ A;  2JIR A;  3GTJ A;  3GTK A;  2Q1D X;  2V45 A;  1DMS A;  2VUM A;  1S3S A;  3DMR A;  4AQ7 A;  3HU2 A;  3IR5 A;  5ERG B;  5D6W A;  2NAP A;  3QC8 A;  5EPP A;  3TM7 B;  1CR5 A;  4KLN A;  2PI8 A;  3LGA A;  3HU3 A;  3ML1 A;  1E32 A;  2JIQ A;  1G8K A;  1SMY D;  4CRY G;  5FTL A;  1TWC A;  2YU9 A;  2R93 A;  3FPU A;  2G5D A;  1PT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...