1QCSA

N-terminal domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
195
Chain Sequence
NMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fusion protein
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR (NSF-N)
publication title NSF N-terminal domain crystal structure: models of NSF function.
pubmed doi rcsb
source organism Cricetulus griseus
total genus 37
structure length 195
sequence length 202
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qcsA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qcsA02
1R27A 2JA7A 1Y1VA 3GTJA 1TWAA 4AZDA 3QQ7A 1DMSA 2JIMA 3CQZA 3CF2A 3IR6A 2VUMA 4GA5A 1CZ5A 3HKZA 1QCSA 1QDNA 2WAQA 1TWCA 5B6CA 1E32A 2JA5A 1Y4ZA 5DYIA 5T5ID 1ZC1A 2PJHB 1Q16A 1PT0A 4CS0A 1PT1A 5FTKA 5EPPA 1WCMA 2R7ZA 2NVYA 3H0GA 3GTLA 4AAYA 1VC3B 1E5VA 4AOKB 1I3QA 3GTMA 2KI8A 4C2MA 4D7ZB 3HU2A 2E2HA 2JV2A 4RV0A 2JIOA 1KQFA 3HU3A 4KO8A 1WLFA 1Y1WA 3QC8A 1CZ4A 2EEOB 1CR5A 1TWHA 5FTNA 1UHDA 3QQ8A 3IR7A 4KODA 1EU1A 1R9TA 3FKIA 2DMRA 4KDIA 2IV2X 2JIRA 1TWGA 2YUJA 2JIPA 1E60A 1G8KA 3O5AA 1I50A 1PQHA 1TWFA 3PLXB 3TM7B 4KLNA 1OGYA 3GTGA 4GA6A 5GLFA 3ML1A 1YLEA 1E18A 3OUGA 4DMRA 1R7RA 2VPZA 1SIWA 1G8JA 1Y5IA 2C45A 4KDLA 5DYGA 2R93A 2E2IA 3GTQA 1DMRA 4QIWA 1FDOA 1K83A 4CRYG 2R92A 2V3VA 5FTJA 1PQEA 1E61A 5C18A 1TMOA 4AONB 2NYAA 2JA6A 1KQGA 3GTOA 1H0HA 2V45A 1AW8B 3DMRA 3TIWA 2VPXA 2VPWA 1UHEA 2VPYA 1SFOA 5T5MD 1PYUB 2E7ZA 1S3SA 3GTPA 2YU9A 3IR5A 2NAPA 2WB1A 5C1BA 3QWZA 2JIQA 1H5NA 1IW7D 1FDIA 4CRZA 2Y0SA 5FTMA 2NVXA 2PMZA 2B63A 1PPYA 5FTLA 1AA6A 4AYBA 3HU1A 3GTKA 1PYQA 1PQFA
chains in the Genus database with same CATH superfamily
3M3GA 1SMYD 1R27A 2JA7A 1Y1VA 3GTJA 4FIBA 2A6HD 1TWAA 4AZDA 3QQ7A 1DMSA 2JIMA 1I9GA 2YVLA 3CQZA 3X2OA 2XDPA 3CF2A 3IR6A 2VUMA 3FPRA 1O54A 4GA5A 1CZ5A 3HKZA 1QCSA 1QDNA 1BW4A 2WAQA 1TWCA 5B6CA 1E32A 2JA5A 1Y4ZA 1OA9A 1ZC1A 5DYIA 5T5ID 4JP6A 2PJHB 2KY9A 1Q16A 2GAEA 1PT0A 4CS0A 1PT1A 5FTKA 5ERGB 1YNJD 1HD5A 5EPPA 1WCMA 2R7ZA 2A6ED 2G6GA 4FFTA 2NVYA 3H0GA 1N10A 4AAYA 3X2GA 1VC3B 3GTLA 1E5VA 4AOKB 1I3QA 3GTMA 2KI8A 4C2MA 4D7ZB 3FPUA 3HU2A 1YNND 2G5DA 2E2HA 2JV2A 4RV0A 2JIOA 1KQFA 3HU3A 4KO8A 1WLFA 3ENGA 3X2HA 3X2IA 3QC8A 1Y1WA 1CZ4A 4FERA 3SUKA 2EEOB 1CR5A 1TWHA 4JJOA 5FTNA 4ZM7A 4AQ7A 1UHDA 3QQ8A 3SULA 5CD1A 3IR7A 4KODA 1EU1A 4FG2A 3ZJVA 1R9TA 3FKIA 2CW0D 2DMRA 4KDIA 2IV2X 2JIRA 3D30A 1TWGA 4JCWA 3X2KA 2Q18X 4UC4A 3X2PA 2YUJA 2A68D 2JIPA 2GFAA 2Q1CX 1E60A 1G8KA 3O5AA 2BE5D 1PQHA 1I50A 1TWFA 3PLXB 3TM7B 4KLNA 1BW3A 1OGYA 3GTGA 2GF7A 4GA6A 2Q1DX 5GLFA 3X2JA 4ENGA 3ML1A 1YLEA 1E18A 3OUGA 4DMRA 2LW6A 1R7RA 2VPZA 5D6WA 1SIWA 1ZYRD 1G8JA 2ENGA 3LGAA 1Y5IA 2C45A 4KDLA 5DYGA 2R93A 3LHDA 2E2IA 2PWYA 3GTQA 1DMRA 4QIWA 3X2LA 1FDOA 1K83A 2PICA 2PJJA 4CRYG 5CCBA 2R92A 5GLXA 2V3VA 5FTJA 1PQEA 1E61A 5C18A 1TMOA 4CQNA 4AONB 2MM0A 3MB5A 2NYAA 3CZBA 4L48A 2A69D 2JA6A 2QQRA 1KQGA 2PI8A 3GTOA 2B25A 3ZJUA 1H0HA 2HCZX 1AW8B 2V45A 3DMRA 3TIWA 1OA7A 2Q1AX 3SUMA 2VPXA 3FPTA 2O5JD 2VPWA 4JP7A 4FG4A 1UHEA 2VPYA 5H4UA 3X2NA 1SFOA 5T5MD 1PYUB 2E7ZA 1S3SA 3GTPA 4AS1A 2YU9A 5EQJB 2MM2A 4ARIA 3IR5A 3SUJA 2NAPA 2WB1A 5C1BA 2Q19X 4JS7A 5GM9A 3QWZA 3BQBA 5D6YA 3ZJTA 2JIQA 1H5NA 1IW7D 2AE0X 1FDIA 3X2MA 4CRZA 4AVRA 2QQSA 2Y0SA 1WC2A 3ZGZA 2KQAA 1L8FA 4NOHA 5FTMA 2NVXA 2BH0A 4ARCA 2PMZA 2PNWA 1PPYA 5FTLA 1AA6A 2B63A 4AYBA 5GLYA 5D6XA 5CCXA 3HU1A 3GTKA 1PYQA 1PQFA
chains in the Genus database with same CATH topology
1SMYD 1R27A 2JA7A 1Y1VA 3GTJA 4FIBA 2A6HD 1TWAA 4AZDA 3QQ7A 1DMSA 2JIMA 1I9GA 2YVLA 3CQZA 2XDPA 3CF2A 3IR6A 2VUMA 3FPRA 1O54A 4GA5A 1CZ5A 3HKZA 1QCSA 1QDNA 2WAQA 1TWCA 5B6CA 1E32A 2JA5A 1Y4ZA 1ZC1A 5DYIA 5T5ID 2KY9A 2PJHB 1Q16A 2GAEA 1PT0A 4CS0A 1PT1A 5FTKA 5ERGB 1YNJD 5EPPA 1WCMA 2R7ZA 2A6ED 2G6GA 2NVYA 3H0GA 3GTLA 4AAYA 1VC3B 1E5VA 4AOKB 1I3QA 3GTMA 2KI8A 4C2MA 4D7ZB 3FPUA 3HU2A 1YNND 2G5DA 2E2HA 2JV2A 4RV0A 2JIOA 1KQFA 3HU3A 4KO8A 1WLFA 1Y1WA 3QC8A 1CZ4A 2EEOB 1CR5A 1TWHA 5FTNA 4AQ7A 1UHDA 3QQ8A 5CD1A 3IR7A 4KODA 1EU1A 3ZJVA 1R9TA 3FKIA 2CW0D 2DMRA 4KDIA 2IV2X 2JIRA 1TWGA 4UC4A 2Q18X 2YUJA 2A68D 2JIPA 2GFAA 2Q1CX 1E60A 1G8KA 3O5AA 2BE5D 1PQHA 1I50A 1TWFA 3PLXB 3TM7B 4KLNA 1OGYA 3GTGA 2GF7A 4GA6A 2Q1DX 5GLFA 3ML1A 1YLEA 1E18A 3OUGA 4DMRA 2LW6A 1R7RA 2VPZA 5D6WA 1SIWA 1ZYRD 1G8JA 3LGAA 1Y5IA 2C45A 4KDLA 5DYGA 2R93A 3LHDA 2E2IA 2PWYA 3GTQA 1DMRA 4QIWA 1FDOA 1K83A 2PICA 2PJJA 4CRYG 5CCBA 2R92A 2V3VA 5FTJA 1PQEA 1E61A 5C18A 1TMOA 4CQNA 4AONB 2MM0A 3MB5A 2NYAA 3CZBA 2A69D 2JA6A 2QQRA 1KQGA 2PI8A 3GTOA 2B25A 3ZJUA 1H0HA 2V45A 1AW8B 3DMRA 3TIWA 2Q1AX 3FPTA 2VPXA 2O5JD 2VPWA 1UHEA 2VPYA 1SFOA 5T5MD 1PYUB 2E7ZA 1S3SA 3GTPA 4AS1A 2YU9A 5EQJB 2MM2A 4ARIA 3IR5A 2Q19X 2NAPA 2WB1A 5C1BA 3QWZA 3BQBA 5D6YA 3ZJTA 2JIQA 1H5NA 1IW7D 2AE0X 1FDIA 2QQSA 4CRZA 2Y0SA 3ZGZA 4NOHA 5FTMA 2NVXA 4ARCA 2PMZA 2PNWA 1PPYA 5FTLA 1AA6A 2B63A 4AYBA 5D6XA 5CCXA 3HU1A 3GTKA 1PYQA 1PQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R27 A;  2JA7 A;  1Y1V A;  3GTJ A;  1TWA A;  4AZD A;  3QQ7 A;  1DMS A;  2JIM A;  3CQZ A;  3CF2 A;  3IR6 A;  2VUM A;  4GA5 A;  1CZ5 A;  3HKZ A;  1QCS A;  1QDN A;  2WAQ A;  1TWC A;  5B6C A;  1E32 A;  2JA5 A;  1Y4Z A;  5DYI A;  5T5I D;  1ZC1 A;  2PJH B;  1Q16 A;  1PT0 A;  4CS0 A;  1PT1 A;  5FTK A;  5EPP A;  1WCM A;  2R7Z A;  2NVY A;  3H0G A;  3GTL A;  4AAY A;  1VC3 B;  1E5V A;  4AOK B;  1I3Q A;  3GTM A;  2KI8 A;  4C2M A;  4D7Z B;  3HU2 A;  2E2H A;  2JV2 A;  4RV0 A;  2JIO A;  1KQF A;  3HU3 A;  4KO8 A;  1WLF A;  1Y1W A;  3QC8 A;  1CZ4 A;  2EEO B;  1CR5 A;  1TWH A;  5FTN A;  1UHD A;  3QQ8 A;  3IR7 A;  4KOD A;  1EU1 A;  1R9T A;  3FKI A;  2DMR A;  4KDI A;  2IV2 X;  2JIR A;  1TWG A;  2YUJ A;  2JIP A;  1E60 A;  1G8K A;  3O5A A;  1I50 A;  1PQH A;  1TWF A;  3PLX B;  3TM7 B;  4KLN A;  1OGY A;  3GTG A;  4GA6 A;  5GLF A;  3ML1 A;  1YLE A;  1E18 A;  3OUG A;  4DMR A;  1R7R A;  2VPZ A;  1SIW A;  1G8J A;  1Y5I A;  2C45 A;  4KDL A;  5DYG A;  2R93 A;  2E2I A;  3GTQ A;  1DMR A;  4QIW A;  1FDO A;  1K83 A;  4CRY G;  2R92 A;  2V3V A;  5FTJ A;  1PQE A;  1E61 A;  5C18 A;  1TMO A;  4AON B;  2NYA A;  2JA6 A;  1KQG A;  3GTO A;  1H0H A;  2V45 A;  1AW8 B;  3DMR A;  3TIW A;  2VPX A;  2VPW A;  1UHE A;  2VPY A;  1SFO A;  5T5M D;  1PYU B;  2E7Z A;  1S3S A;  3GTP A;  2YU9 A;  3IR5 A;  2NAP A;  2WB1 A;  5C1B A;  3QWZ A;  2JIQ A;  1H5N A;  1IW7 D;  1FDI A;  4CRZ A;  2Y0S A;  5FTM A;  2NVX A;  2PMZ A;  2B63 A;  1PPY A;  5FTL A;  1AA6 A;  4AYB A;  3HU1 A;  3GTK A;  1PYQ A;  1PQF A; 
#chains in the Genus database with same CATH topology
 3M3G A;  1SMY D;  1R27 A;  2JA7 A;  1Y1V A;  3GTJ A;  4FIB A;  2A6H D;  1TWA A;  4AZD A;  3QQ7 A;  1DMS A;  2JIM A;  1I9G A;  2YVL A;  3CQZ A;  3X2O A;  2XDP A;  3CF2 A;  3IR6 A;  2VUM A;  3FPR A;  1O54 A;  4GA5 A;  1CZ5 A;  3HKZ A;  1QCS A;  1QDN A;  1BW4 A;  2WAQ A;  1TWC A;  5B6C A;  1E32 A;  2JA5 A;  1Y4Z A;  1OA9 A;  1ZC1 A;  5DYI A;  5T5I D;  4JP6 A;  2PJH B;  2KY9 A;  1Q16 A;  2GAE A;  1PT0 A;  4CS0 A;  1PT1 A;  5FTK A;  5ERG B;  1YNJ D;  1HD5 A;  5EPP A;  1WCM A;  2R7Z A;  2A6E D;  2G6G A;  4FFT A;  2NVY A;  3H0G A;  1N10 A;  4AAY A;  3X2G A;  1VC3 B;  3GTL A;  1E5V A;  4AOK B;  1I3Q A;  3GTM A;  2KI8 A;  4C2M A;  4D7Z B;  3FPU A;  3HU2 A;  1YNN D;  2G5D A;  2E2H A;  2JV2 A;  4RV0 A;  2JIO A;  1KQF A;  3HU3 A;  4KO8 A;  1WLF A;  3ENG A;  3X2H A;  3X2I A;  3QC8 A;  1Y1W A;  1CZ4 A;  4FER A;  3SUK A;  2EEO B;  1CR5 A;  1TWH A;  4JJO A;  5FTN A;  4ZM7 A;  4AQ7 A;  1UHD A;  3QQ8 A;  3SUL A;  5CD1 A;  3IR7 A;  4KOD A;  1EU1 A;  4FG2 A;  3ZJV A;  1R9T A;  3FKI A;  2CW0 D;  2DMR A;  4KDI A;  2IV2 X;  2JIR A;  3D30 A;  1TWG A;  4JCW A;  3X2K A;  2Q18 X;  4UC4 A;  3X2P A;  2YUJ A;  2A68 D;  2JIP A;  2GFA A;  2Q1C X;  1E60 A;  1G8K A;  3O5A A;  2BE5 D;  1PQH A;  1I50 A;  1TWF A;  3PLX B;  3TM7 B;  4KLN A;  1BW3 A;  1OGY A;  3GTG A;  2GF7 A;  4GA6 A;  2Q1D X;  5GLF A;  3X2J A;  4ENG A;  3ML1 A;  1YLE A;  1E18 A;  3OUG A;  4DMR A;  2LW6 A;  1R7R A;  2VPZ A;  5D6W A;  1SIW A;  1ZYR D;  1G8J A;  2ENG A;  3LGA A;  1Y5I A;  2C45 A;  4KDL A;  5DYG A;  2R93 A;  3LHD A;  2E2I A;  2PWY A;  3GTQ A;  1DMR A;  4QIW A;  3X2L A;  1FDO A;  1K83 A;  2PIC A;  2PJJ A;  4CRY G;  5CCB A;  2R92 A;  5GLX A;  2V3V A;  5FTJ A;  1PQE A;  1E61 A;  5C18 A;  1TMO A;  4CQN A;  4AON B;  2MM0 A;  3MB5 A;  2NYA A;  3CZB A;  4L48 A;  2A69 D;  2JA6 A;  2QQR A;  1KQG A;  2PI8 A;  3GTO A;  2B25 A;  3ZJU A;  1H0H A;  2HCZ X;  1AW8 B;  2V45 A;  3DMR A;  3TIW A;  1OA7 A;  2Q1A X;  3SUM A;  2VPX A;  3FPT A;  2O5J D;  2VPW A;  4JP7 A;  4FG4 A;  1UHE A;  2VPY A;  5H4U A;  3X2N A;  1SFO A;  5T5M D;  1PYU B;  2E7Z A;  1S3S A;  3GTP A;  4AS1 A;  2YU9 A;  5EQJ B;  2MM2 A;  4ARI A;  3IR5 A;  3SUJ A;  2NAP A;  2WB1 A;  5C1B A;  2Q19 X;  4JS7 A;  5GM9 A;  3QWZ A;  3BQB A;  5D6Y A;  3ZJT A;  2JIQ A;  1H5N A;  1IW7 D;  2AE0 X;  1FDI A;  3X2M A;  4CRZ A;  4AVR A;  2QQS A;  2Y0S A;  1WC2 A;  3ZGZ A;  2KQA A;  1L8F A;  4NOH A;  5FTM A;  2NVX A;  2BH0 A;  4ARC A;  2PMZ A;  2PNW A;  1PPY A;  5FTL A;  1AA6 A;  2B63 A;  4AYB A;  5GLY A;  5D6X A;  5CCX A;  3HU1 A;  3GTK A;  1PYQ A;  1PQF A; 
#chains in the Genus database with same CATH homology
 1SMY D;  1R27 A;  2JA7 A;  1Y1V A;  3GTJ A;  4FIB A;  2A6H D;  1TWA A;  4AZD A;  3QQ7 A;  1DMS A;  2JIM A;  1I9G A;  2YVL A;  3CQZ A;  2XDP A;  3CF2 A;  3IR6 A;  2VUM A;  3FPR A;  1O54 A;  4GA5 A;  1CZ5 A;  3HKZ A;  1QCS A;  1QDN A;  2WAQ A;  1TWC A;  5B6C A;  1E32 A;  2JA5 A;  1Y4Z A;  1ZC1 A;  5DYI A;  5T5I D;  2KY9 A;  2PJH B;  1Q16 A;  2GAE A;  1PT0 A;  4CS0 A;  1PT1 A;  5FTK A;  5ERG B;  1YNJ D;  5EPP A;  1WCM A;  2R7Z A;  2A6E D;  2G6G A;  2NVY A;  3H0G A;  3GTL A;  4AAY A;  1VC3 B;  1E5V A;  4AOK B;  1I3Q A;  3GTM A;  2KI8 A;  4C2M A;  4D7Z B;  3FPU A;  3HU2 A;  1YNN D;  2G5D A;  2E2H A;  2JV2 A;  4RV0 A;  2JIO A;  1KQF A;  3HU3 A;  4KO8 A;  1WLF A;  1Y1W A;  3QC8 A;  1CZ4 A;  2EEO B;  1CR5 A;  1TWH A;  5FTN A;  4AQ7 A;  1UHD A;  3QQ8 A;  5CD1 A;  3IR7 A;  4KOD A;  1EU1 A;  3ZJV A;  1R9T A;  3FKI A;  2CW0 D;  2DMR A;  4KDI A;  2IV2 X;  2JIR A;  1TWG A;  4UC4 A;  2Q18 X;  2YUJ A;  2A68 D;  2JIP A;  2GFA A;  2Q1C X;  1E60 A;  1G8K A;  3O5A A;  2BE5 D;  1PQH A;  1I50 A;  1TWF A;  3PLX B;  3TM7 B;  4KLN A;  1OGY A;  3GTG A;  2GF7 A;  4GA6 A;  2Q1D X;  5GLF A;  3ML1 A;  1YLE A;  1E18 A;  3OUG A;  4DMR A;  2LW6 A;  1R7R A;  2VPZ A;  5D6W A;  1SIW A;  1ZYR D;  1G8J A;  3LGA A;  1Y5I A;  2C45 A;  4KDL A;  5DYG A;  2R93 A;  3LHD A;  2E2I A;  2PWY A;  3GTQ A;  1DMR A;  4QIW A;  1FDO A;  1K83 A;  2PIC A;  2PJJ A;  4CRY G;  5CCB A;  2R92 A;  2V3V A;  5FTJ A;  1PQE A;  1E61 A;  5C18 A;  1TMO A;  4CQN A;  4AON B;  2MM0 A;  3MB5 A;  2NYA A;  3CZB A;  2A69 D;  2JA6 A;  2QQR A;  1KQG A;  2PI8 A;  3GTO A;  2B25 A;  3ZJU A;  1H0H A;  2V45 A;  1AW8 B;  3DMR A;  3TIW A;  2Q1A X;  3FPT A;  2VPX A;  2O5J D;  2VPW A;  1UHE A;  2VPY A;  1SFO A;  5T5M D;  1PYU B;  2E7Z A;  1S3S A;  3GTP A;  4AS1 A;  2YU9 A;  5EQJ B;  2MM2 A;  4ARI A;  3IR5 A;  2Q19 X;  2NAP A;  2WB1 A;  5C1B A;  3QWZ A;  3BQB A;  5D6Y A;  3ZJT A;  2JIQ A;  1H5N A;  1IW7 D;  2AE0 X;  1FDI A;  2QQS A;  4CRZ A;  2Y0S A;  3ZGZ A;  4NOH A;  5FTM A;  2NVX A;  4ARC A;  2PMZ A;  2PNW A;  1PPY A;  5FTL A;  1AA6 A;  2B63 A;  4AYB A;  5D6X A;  5CCX A;  3HU1 A;  3GTK A;  1PYQ A;  1PQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...