1QCSA

N-terminal domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
195
Chain Sequence
b'NMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR (NSF-N)
publication title NSF N-terminal domain crystal structure: models of NSF function.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Fusion protein
total genus 37
structure length 195
sequence length 202
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qcsA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qcsA02
3PLXB 1E60A 4KDIA 5DYIA 4GA5A 1DMRA 3GTJA 2WB1A 1K83A 4RV0A 1CZ4A 1PYQA 1I3QA 5T5ID 1YLEA 3IR6A 3O5AA 3GTMA 3HU3A 2PJHB 2JA6A 4KDLA 2JIQA 5FTJA 5GLFA 3QWZA 5FTMA 1S3SA 2NAPA 3CF2A 3GTGA 2JA5A 1TMOA 1PQEA 1SFOA 2VPWA 2YUJA 1QCSA 1Q16A 3CQZA 4GA6A 1R27A 1PQHA 1CZ5A 1WLFA 2E2IA 3GTOA 1EU1A 5DYGA 2WAQA 2PMZA 1TWCA 4CRYG 1Y1VA 1SIWA 1WCMA 2EEOB 1FDOA 2DMRA 1R9TA 2C45A 3FKIA 3IR7A 1H0HA 1FDIA 3HU1A 1VC3B 2VPZA 3OUGA 4AOKB 1DMSA 2JV2A 5B6CA 1E32A 2VUMA 2R7ZA 1UHDA 3TM7B 5C18A 4C2MA 1R7RA 3GTKA 3HKZA 1Y4ZA 4KODA 1E5VA 1TWHA 1E61A 2NYAA 2KI8A 2Y0SA 1TWAA 3TIWA 2B63A 4KO8A 5C1BA 5FTNA 3GTPA 5FTLA 1G8KA 1AA6A 4DMRA 2R92A 1KQGA 1CR5A 1IW7D 2E7ZA 3QQ8A 3QQ7A 1PT1A 3ML1A 2IV2X 1ZC1A 1PT0A 1H5NA 2JIRA 1G8JA 2JIMA 4CRZA 4CS0A 2VPXA 4QIWA 1TWGA 4AYBA 2V3VA 2YU9A 2R93A 1E18A 5EPPA 1KQFA 1QDNA 2NVXA 1Y5IA 2JIOA 3H0GA 5FTKA 4AONB 3HU2A 3IR5A 2NVYA 4D7ZB 1Y1WA 2JIPA 2V45A 3QC8A 4AAYA 3DMRA 2JA7A 1OGYA 1AW8B 4KLNA 2E2HA 1I50A 1PQFA 4AZDA 3GTLA 2VPYA 5T5MD 3GTQA 1PYUB 1UHEA 1PPYA 1TWFA
chains in the Genus database with same CATH superfamily
4JCWA 3PLXB 1E60A 4KDIA 5DYIA 4GA5A 1DMRA 3GTJA 2WB1A 1K83A 2O5JD 1O54A 4RV0A 3X2MA 1OA7A 2Q1DX 3FPTA 4FIBA 1CZ4A 2QQRA 1PYQA 1N10A 5T5ID 1I3QA 1YLEA 4JP6A 2Q19X 3IR6A 3O5AA 3GTMA 2YVLA 5D6WA 3HU3A 2PJHB 2JA6A 4KDLA 2PWYA 2JIQA 5FTJA 3X2NA 5GLFA 2Q1CX 2PICA 3QWZA 5FTMA 5D6YA 1OA9A 1S3SA 3X2HA 1SMYD 2NAPA 2G5DA 3M3GA 3CF2A 3GTGA 2JA5A 1TMOA 1PQEA 1SFOA 5CCBA 2VPWA 2YUJA 1QCSA 1Q16A 3CQZA 4GA6A 1R27A 1PQHA 1CZ5A 5CCXA 1WLFA 2E2IA 2PJJA 3GTOA 1EU1A 5DYGA 2WAQA 2PMZA 3X2GA 1TWCA 5GM9A 4CRYG 2A6HD 1Y1VA 3LHDA 4L48A 1SIWA 1WCMA 2XDPA 2EEOB 1FDOA 4JS7A 2DMRA 2KQAA 1R9TA 2C45A 5GLXA 3FKIA 4UC4A 3IR7A 2HCZX 1H0HA 1FDIA 3HU1A 1VC3B 1YNJD 2GFAA 3ZGZA 4AQ7A 2VPZA 3D30A 3OUGA 4AOKB 1DMSA 2JV2A 3X2JA 5B6CA 2LW6A 3SULA 4AVRA 1E32A 2A68D 2VUMA 2R7ZA 1UHDA 3CZBA 3TM7B 2CW0D 4C2MA 5C18A 5ERGB 5CD1A 3ZJTA 1R7RA 3GTKA 3HKZA 1Y4ZA 3ZJVA 4KODA 2AE0X 2QQSA 1E5VA 1BW4A 1TWHA 1E61A 3SUKA 3SUMA 2NYAA 2GF7A 2KI8A 4ARIA 2Y0SA 1L8FA 1TWAA 2A69D 2G6GA 4KO8A 3TIWA 2B63A 5C1BA 3FPRA 4CQNA 2MM0A 5FTNA 3GTPA 2Q1AX 5FTLA 1G8KA 5GLYA 1AA6A 1ZYRD 2KY9A 4DMRA 3X2IA 2PNWA 2R92A 1KQGA 3X2OA 3BQBA 3LGAA 1CR5A 1IW7D 1ZC1A 2E7ZA 3QQ8A 1PT1A 3ML1A 3QQ7A 2IV2X 1PT0A 1H5NA 2JIRA 1G8JA 2JIMA 4FFTA 3SUJA 4CRZA 3ZJUA 4CS0A 2VPXA 4FG2A 4QIWA 1TWGA 2PI8A 3FPUA 4NOHA 4AYBA 2V3VA 2YU9A 3X2PA 2R93A 1HD5A 2Q18X 1E18A 5EPPA 4AS1A 1KQFA 1QDNA 2NVXA 4ENGA 5EQJB 1Y5IA 5D6XA 3ENGA 3X2KA 4JJOA 2JIOA 3H0GA 5FTKA 4AONB 3HU2A 4ARCA 3IR5A 2NVYA 5H4UA 4D7ZB 2BH0A 4FERA 3MB5A 1Y1WA 2JIPA 4JP7A 2V45A 3QC8A 2MM2A 4AAYA 2B25A 3DMRA 2JA7A 2ENGA 1OGYA 1AW8B 4FG4A 4KLNA 3X2LA 2E2HA 1I50A 1PQFA 1YNND 1BW3A 2BE5D 1WC2A 4ZM7A 4AZDA 3GTLA 2GAEA 1I9GA 2VPYA 5T5MD 2A6ED 3GTQA 1PYUB 1UHEA 1PPYA 1TWFA
chains in the Genus database with same CATH topology
3PLXB 1E60A 4KDIA 5DYIA 4GA5A 1DMRA 3GTJA 2WB1A 1K83A 2O5JD 1O54A 4RV0A 2Q1DX 3FPTA 4FIBA 1CZ4A 2QQRA 1PYQA 1I3QA 5T5ID 1YLEA 2Q19X 3IR6A 3O5AA 3GTMA 2YVLA 5D6WA 3HU3A 2PJHB 2JA6A 4KDLA 2PWYA 2JIQA 5FTJA 5GLFA 2Q1CX 2PICA 3QWZA 5FTMA 5D6YA 1S3SA 1SMYD 2NAPA 2G5DA 3CF2A 3GTGA 2JA5A 1TMOA 1PQEA 1SFOA 5CCBA 2VPWA 2YUJA 1QCSA 1Q16A 3CQZA 4GA6A 1R27A 1PQHA 1CZ5A 5CCXA 1WLFA 2E2IA 2PJJA 3GTOA 1EU1A 5DYGA 2WAQA 2PMZA 1TWCA 4CRYG 2A6HD 1Y1VA 3LHDA 1SIWA 1WCMA 2XDPA 2EEOB 1FDOA 2DMRA 1R9TA 2C45A 3FKIA 4UC4A 3IR7A 1H0HA 1FDIA 3HU1A 1VC3B 1YNJD 2GFAA 3ZGZA 4AQ7A 2VPZA 3OUGA 4AOKB 1DMSA 2JV2A 5B6CA 2LW6A 1E32A 2A68D 2VUMA 2R7ZA 1UHDA 3CZBA 3TM7B 2CW0D 4C2MA 5C18A 5ERGB 5CD1A 3ZJTA 1R7RA 3GTKA 3HKZA 1Y4ZA 3ZJVA 4KODA 2AE0X 2QQSA 1E5VA 1TWHA 1E61A 2GF7A 2NYAA 2KI8A 4ARIA 2Y0SA 1TWAA 2A69D 2G6GA 4KO8A 3TIWA 2B63A 5C1BA 3FPRA 4CQNA 2MM0A 5FTNA 3GTPA 2Q1AX 5FTLA 1G8KA 1AA6A 1ZYRD 2KY9A 4DMRA 2PNWA 2R92A 1KQGA 3BQBA 3LGAA 1CR5A 1IW7D 1ZC1A 2E7ZA 3QQ8A 1PT1A 3ML1A 3QQ7A 2IV2X 1PT0A 1H5NA 2JIRA 1G8JA 2JIMA 3ZJUA 4CRZA 4CS0A 2VPXA 4QIWA 1TWGA 2PI8A 3FPUA 4NOHA 4AYBA 2V3VA 2YU9A 2R93A 2Q18X 1E18A 5EPPA 4AS1A 1KQFA 1QDNA 2NVXA 5EQJB 1Y5IA 5D6XA 2JIOA 3H0GA 5FTKA 4AONB 3HU2A 4ARCA 3IR5A 2NVYA 4D7ZB 3MB5A 1Y1WA 2JIPA 2V45A 3QC8A 2MM2A 4AAYA 2B25A 3DMRA 2JA7A 1OGYA 1AW8B 4KLNA 2E2HA 1I50A 1PQFA 1YNND 2BE5D 4AZDA 3GTLA 2GAEA 1I9GA 2VPYA 5T5MD 2A6ED 3GTQA 1PYUB 1UHEA 1PPYA 1TWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLX B;  1E60 A;  4KDI A;  5DYI A;  4GA5 A;  1DMR A;  3GTJ A;  2WB1 A;  1K83 A;  4RV0 A;  1CZ4 A;  1PYQ A;  1I3Q A;  5T5I D;  1YLE A;  3IR6 A;  3O5A A;  3GTM A;  3HU3 A;  2PJH B;  2JA6 A;  4KDL A;  2JIQ A;  5FTJ A;  5GLF A;  3QWZ A;  5FTM A;  1S3S A;  2NAP A;  3CF2 A;  3GTG A;  2JA5 A;  1TMO A;  1PQE A;  1SFO A;  2VPW A;  2YUJ A;  1QCS A;  1Q16 A;  3CQZ A;  4GA6 A;  1R27 A;  1PQH A;  1CZ5 A;  1WLF A;  2E2I A;  3GTO A;  1EU1 A;  5DYG A;  2WAQ A;  2PMZ A;  1TWC A;  4CRY G;  1Y1V A;  1SIW A;  1WCM A;  2EEO B;  1FDO A;  2DMR A;  1R9T A;  2C45 A;  3FKI A;  3IR7 A;  1H0H A;  1FDI A;  3HU1 A;  1VC3 B;  2VPZ A;  3OUG A;  4AOK B;  1DMS A;  2JV2 A;  5B6C A;  1E32 A;  2VUM A;  2R7Z A;  1UHD A;  3TM7 B;  5C18 A;  4C2M A;  1R7R A;  3GTK A;  3HKZ A;  1Y4Z A;  4KOD A;  1E5V A;  1TWH A;  1E61 A;  2NYA A;  2KI8 A;  2Y0S A;  1TWA A;  3TIW A;  2B63 A;  4KO8 A;  5C1B A;  5FTN A;  3GTP A;  5FTL A;  1G8K A;  1AA6 A;  4DMR A;  2R92 A;  1KQG A;  1CR5 A;  1IW7 D;  2E7Z A;  3QQ8 A;  3QQ7 A;  1PT1 A;  3ML1 A;  2IV2 X;  1ZC1 A;  1PT0 A;  1H5N A;  2JIR A;  1G8J A;  2JIM A;  4CRZ A;  4CS0 A;  2VPX A;  4QIW A;  1TWG A;  4AYB A;  2V3V A;  2YU9 A;  2R93 A;  1E18 A;  5EPP A;  1KQF A;  1QDN A;  2NVX A;  1Y5I A;  2JIO A;  3H0G A;  5FTK A;  4AON B;  3HU2 A;  3IR5 A;  2NVY A;  4D7Z B;  1Y1W A;  2JIP A;  2V45 A;  3QC8 A;  4AAY A;  3DMR A;  2JA7 A;  1OGY A;  1AW8 B;  4KLN A;  2E2H A;  1I50 A;  1PQF A;  4AZD A;  3GTL A;  2VPY A;  5T5M D;  3GTQ A;  1PYU B;  1UHE A;  1PPY A;  1TWF A; 
#chains in the Genus database with same CATH topology
 4JCW A;  3PLX B;  1E60 A;  4KDI A;  5DYI A;  4GA5 A;  1DMR A;  3GTJ A;  2WB1 A;  1K83 A;  2O5J D;  1O54 A;  4RV0 A;  3X2M A;  1OA7 A;  2Q1D X;  3FPT A;  4FIB A;  1CZ4 A;  2QQR A;  1PYQ A;  1N10 A;  5T5I D;  1I3Q A;  1YLE A;  4JP6 A;  2Q19 X;  3IR6 A;  3O5A A;  3GTM A;  2YVL A;  5D6W A;  3HU3 A;  2PJH B;  2JA6 A;  4KDL A;  2PWY A;  2JIQ A;  5FTJ A;  3X2N A;  5GLF A;  2Q1C X;  2PIC A;  3QWZ A;  5FTM A;  5D6Y A;  1OA9 A;  1S3S A;  3X2H A;  1SMY D;  2NAP A;  2G5D A;  3M3G A;  3CF2 A;  3GTG A;  2JA5 A;  1TMO A;  1PQE A;  1SFO A;  5CCB A;  2VPW A;  2YUJ A;  1QCS A;  1Q16 A;  3CQZ A;  4GA6 A;  1R27 A;  1PQH A;  1CZ5 A;  5CCX A;  1WLF A;  2E2I A;  2PJJ A;  3GTO A;  1EU1 A;  5DYG A;  2WAQ A;  2PMZ A;  3X2G A;  1TWC A;  5GM9 A;  4CRY G;  2A6H D;  1Y1V A;  3LHD A;  4L48 A;  1SIW A;  1WCM A;  2XDP A;  2EEO B;  1FDO A;  4JS7 A;  2DMR A;  2KQA A;  1R9T A;  2C45 A;  5GLX A;  3FKI A;  4UC4 A;  3IR7 A;  2HCZ X;  1H0H A;  1FDI A;  3HU1 A;  1VC3 B;  1YNJ D;  2GFA A;  3ZGZ A;  4AQ7 A;  2VPZ A;  3D30 A;  3OUG A;  4AOK B;  1DMS A;  2JV2 A;  3X2J A;  5B6C A;  2LW6 A;  3SUL A;  4AVR A;  1E32 A;  2A68 D;  2VUM A;  2R7Z A;  1UHD A;  3CZB A;  3TM7 B;  2CW0 D;  4C2M A;  5C18 A;  5ERG B;  5CD1 A;  3ZJT A;  1R7R A;  3GTK A;  3HKZ A;  1Y4Z A;  3ZJV A;  4KOD A;  2AE0 X;  2QQS A;  1E5V A;  1BW4 A;  1TWH A;  1E61 A;  3SUK A;  3SUM A;  2NYA A;  2GF7 A;  2KI8 A;  4ARI A;  2Y0S A;  1L8F A;  1TWA A;  2A69 D;  2G6G A;  4KO8 A;  3TIW A;  2B63 A;  5C1B A;  3FPR A;  4CQN A;  2MM0 A;  5FTN A;  3GTP A;  2Q1A X;  5FTL A;  1G8K A;  5GLY A;  1AA6 A;  1ZYR D;  2KY9 A;  4DMR A;  3X2I A;  2PNW A;  2R92 A;  1KQG A;  3X2O A;  3BQB A;  3LGA A;  1CR5 A;  1IW7 D;  1ZC1 A;  2E7Z A;  3QQ8 A;  1PT1 A;  3ML1 A;  3QQ7 A;  2IV2 X;  1PT0 A;  1H5N A;  2JIR A;  1G8J A;  2JIM A;  4FFT A;  3SUJ A;  4CRZ A;  3ZJU A;  4CS0 A;  2VPX A;  4FG2 A;  4QIW A;  1TWG A;  2PI8 A;  3FPU A;  4NOH A;  4AYB A;  2V3V A;  2YU9 A;  3X2P A;  2R93 A;  1HD5 A;  2Q18 X;  1E18 A;  5EPP A;  4AS1 A;  1KQF A;  1QDN A;  2NVX A;  4ENG A;  5EQJ B;  1Y5I A;  5D6X A;  3ENG A;  3X2K A;  4JJO A;  2JIO A;  3H0G A;  5FTK A;  4AON B;  3HU2 A;  4ARC A;  3IR5 A;  2NVY A;  5H4U A;  4D7Z B;  2BH0 A;  4FER A;  3MB5 A;  1Y1W A;  2JIP A;  4JP7 A;  2V45 A;  3QC8 A;  2MM2 A;  4AAY A;  2B25 A;  3DMR A;  2JA7 A;  2ENG A;  1OGY A;  1AW8 B;  4FG4 A;  4KLN A;  3X2L A;  2E2H A;  1I50 A;  1PQF A;  1YNN D;  1BW3 A;  2BE5 D;  1WC2 A;  4ZM7 A;  4AZD A;  3GTL A;  2GAE A;  1I9G A;  2VPY A;  5T5M D;  2A6E D;  3GTQ A;  1PYU B;  1UHE A;  1PPY A;  1TWF A; 
#chains in the Genus database with same CATH homology
 3PLX B;  1E60 A;  4KDI A;  5DYI A;  4GA5 A;  1DMR A;  3GTJ A;  2WB1 A;  1K83 A;  2O5J D;  1O54 A;  4RV0 A;  2Q1D X;  3FPT A;  4FIB A;  1CZ4 A;  2QQR A;  1PYQ A;  1I3Q A;  5T5I D;  1YLE A;  2Q19 X;  3IR6 A;  3O5A A;  3GTM A;  2YVL A;  5D6W A;  3HU3 A;  2PJH B;  2JA6 A;  4KDL A;  2PWY A;  2JIQ A;  5FTJ A;  5GLF A;  2Q1C X;  2PIC A;  3QWZ A;  5FTM A;  5D6Y A;  1S3S A;  1SMY D;  2NAP A;  2G5D A;  3CF2 A;  3GTG A;  2JA5 A;  1TMO A;  1PQE A;  1SFO A;  5CCB A;  2VPW A;  2YUJ A;  1QCS A;  1Q16 A;  3CQZ A;  4GA6 A;  1R27 A;  1PQH A;  1CZ5 A;  5CCX A;  1WLF A;  2E2I A;  2PJJ A;  3GTO A;  1EU1 A;  5DYG A;  2WAQ A;  2PMZ A;  1TWC A;  4CRY G;  2A6H D;  1Y1V A;  3LHD A;  1SIW A;  1WCM A;  2XDP A;  2EEO B;  1FDO A;  2DMR A;  1R9T A;  2C45 A;  3FKI A;  4UC4 A;  3IR7 A;  1H0H A;  1FDI A;  3HU1 A;  1VC3 B;  1YNJ D;  2GFA A;  3ZGZ A;  4AQ7 A;  2VPZ A;  3OUG A;  4AOK B;  1DMS A;  2JV2 A;  5B6C A;  2LW6 A;  1E32 A;  2A68 D;  2VUM A;  2R7Z A;  1UHD A;  3CZB A;  3TM7 B;  2CW0 D;  4C2M A;  5C18 A;  5ERG B;  5CD1 A;  3ZJT A;  1R7R A;  3GTK A;  3HKZ A;  1Y4Z A;  3ZJV A;  4KOD A;  2AE0 X;  2QQS A;  1E5V A;  1TWH A;  1E61 A;  2GF7 A;  2NYA A;  2KI8 A;  4ARI A;  2Y0S A;  1TWA A;  2A69 D;  2G6G A;  4KO8 A;  3TIW A;  2B63 A;  5C1B A;  3FPR A;  4CQN A;  2MM0 A;  5FTN A;  3GTP A;  2Q1A X;  5FTL A;  1G8K A;  1AA6 A;  1ZYR D;  2KY9 A;  4DMR A;  2PNW A;  2R92 A;  1KQG A;  3BQB A;  3LGA A;  1CR5 A;  1IW7 D;  1ZC1 A;  2E7Z A;  3QQ8 A;  1PT1 A;  3ML1 A;  3QQ7 A;  2IV2 X;  1PT0 A;  1H5N A;  2JIR A;  1G8J A;  2JIM A;  3ZJU A;  4CRZ A;  4CS0 A;  2VPX A;  4QIW A;  1TWG A;  2PI8 A;  3FPU A;  4NOH A;  4AYB A;  2V3V A;  2YU9 A;  2R93 A;  2Q18 X;  1E18 A;  5EPP A;  4AS1 A;  1KQF A;  1QDN A;  2NVX A;  5EQJ B;  1Y5I A;  5D6X A;  2JIO A;  3H0G A;  5FTK A;  4AON B;  3HU2 A;  4ARC A;  3IR5 A;  2NVY A;  4D7Z B;  3MB5 A;  1Y1W A;  2JIP A;  2V45 A;  3QC8 A;  2MM2 A;  4AAY A;  2B25 A;  3DMR A;  2JA7 A;  1OGY A;  1AW8 B;  4KLN A;  2E2H A;  1I50 A;  1PQF A;  1YNN D;  2BE5 D;  4AZD A;  3GTL A;  2GAE A;  1I9G A;  2VPY A;  5T5M D;  2A6E D;  3GTQ A;  1PYU B;  1UHE A;  1PPY A;  1TWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...