1QCSA

N-terminal domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
195
Chain Sequence
b'NMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR (NSF-N)
molecule tags Fusion protein
source organism Cricetulus griseus
publication title NSF N-terminal domain crystal structure: models of NSF function.
pubmed doi rcsb
total genus 37
structure length 195
sequence length 202
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qcsA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qcsA02
1OGYA 2VPWA 3GTGA 2VPYA 1TWFA 2R92A 2DMRA 4AYBA 2V45A 5DYGA 4GA6A 4GA5A 5EPPA 2R7ZA 1R7RA 2NYAA 2YU9A 4CRYG 2JIRA 3IR6A 2E2IA 4AAYA 1ZC1A 1DMRA 1EU1A 3GTOA 1R27A 1AW8B 4KDLA 1TWGA 4DMRA 5C18A 1Q16A 1E5VA 2EEOB 3DMRA 2R93A 4KO8A 1E18A 1DMSA 3HU3A 3GTPA 1CZ5A 2WAQA 2NAPA 1QCSA 5FTLA 4AOKB 3CQZA 3GTJA 1Y1WA 1UHDA 3TM7B 1PQHA 3QWZA 1R9TA 1E61A 3QC8A 2JIPA 1QDNA 3TIWA 1KQFA 3GTQA 1PQEA 4AONB 3IR7A 3CF2A 4CRZA 5T5ID 3O5AA 3HU1A 1KQGA 1FDOA 1SFOA 1CZ4A 1E60A 1SIWA 1PT0A 2V3VA 5FTKA 1TWCA 4D7ZB 4C2MA 1Y5IA 1YLEA 2JIQA 1Y1VA 1WCMA 3PLXB 5B6CA 1CR5A 3HU2A 3H0GA 3IR5A 1G8JA 1FDIA 1AA6A 5FTJA 3GTKA 2IV2X 2PJHB 2VUMA 2JV2A 4AZDA 1H0HA 1PPYA 1E32A 1I3QA 5DYIA 3HKZA 3OUGA 1S3SA 4CS0A 2KI8A 1UHEA 1WLFA 1PQFA 1TWAA 2VPXA 1PYUB 2Y0SA 3QQ7A 1TWHA 5GLFA 2C45A 2YUJA 4RV0A 2PMZA 2B63A 1H5NA 4KLNA 4KODA 2JIMA 2JA6A 2WB1A 3ML1A 4QIWA 2JA5A 3GTMA 2E2HA 1K83A 2VPZA 1PYQA 3FKIA 1PT1A 2E7ZA 1IW7D 1VC3B 1I50A 3GTLA 2NVXA 4KDIA 2NVYA 1Y4ZA 2JA7A 2JIOA 1TMOA 3QQ8A 5FTMA 5FTNA 5C1BA 1G8KA 5T5MD
chains in the Genus database with same CATH superfamily
1OGYA 2VPWA 4AVRA 3GTGA 1WC2A 2VPYA 5H4UA 1TWFA 2R92A 2DMRA 4AYBA 2Q1AX 2GAEA 3ZGZA 2V45A 2KY9A 5DYGA 4ARIA 4GA6A 4FG4A 4GA5A 2B25A 2A6HD 5EPPA 3SUJA 2G5DA 2R7ZA 1R7RA 2NYAA 3BQBA 2YU9A 4CRYG 2JIRA 3IR6A 2E2IA 3CZBA 4AAYA 2Q1CX 1ZC1A 1L8FA 4AS1A 1DMRA 1EU1A 3GTOA 1R27A 1AW8B 4KDLA 1TWGA 4DMRA 1BW4A 3M3GA 3SUKA 5C18A 1Q16A 1E5VA 2A69D 2EEOB 2HCZX 3DMRA 2R93A 4UC4A 5EQJB 4KO8A 2Q19X 1HD5A 1E18A 1DMSA 3HU3A 4ENGA 3GTPA 1CZ5A 2WAQA 2NAPA 1BW3A 3X2LA 2YVLA 5CCXA 2PICA 1QCSA 5FTLA 1O54A 2BH0A 2PI8A 4AOKB 3CQZA 3GTJA 1Y1WA 1UHDA 3TM7B 1PQHA 2KQAA 3ENGA 1E61A 3QWZA 3QC8A 4FG2A 4FERA 1R9TA 2GFAA 2JIPA 5CCBA 1SMYD 1QDNA 2A68D 3TIWA 1KQFA 3GTQA 3X2OA 1PQEA 4AONB 1OA7A 3IR7A 3CF2A 4CRZA 5T5ID 2MM0A 3O5AA 3HU1A 4L48A 1KQGA 1OA9A 1FDOA 4ARCA 4FIBA 1SFOA 1CZ4A 1YNJD 1E60A 2LW6A 2A6ED 4ZM7A 1SIWA 1PT0A 4NOHA 2Q18X 4CQNA 2BE5D 3D30A 2V3VA 5FTKA 5D6XA 1TWCA 3X2GA 4D7ZB 5CD1A 4C2MA 1Y5IA 1YLEA 2PNWA 3ZJVA 3FPTA 2JIQA 1Y1VA 1WCMA 2ENGA 5GLYA 3PLXB 2Q1DX 5B6CA 1CR5A 3HU2A 2PJJA 3H0GA 3IR5A 3FPUA 3ZJTA 5GLXA 1G8JA 1FDIA 1AA6A 5FTJA 3GTKA 2IV2X 2QQSA 2PJHB 2VUMA 2O5JD 4JJOA 2G6GA 2JV2A 4AZDA 2MM2A 1H0HA 1PPYA 1E32A 4AQ7A 1I9GA 3X2MA 1I3QA 5DYIA 3HKZA 3OUGA 1S3SA 4CS0A 3LGAA 2KI8A 3ZJUA 1UHEA 1WLFA 4FFTA 1N10A 2QQRA 1PQFA 1TWAA 2VPXA 1PYUB 2Y0SA 3QQ7A 5D6YA 3X2PA 1TWHA 5GLFA 2GF7A 2C45A 2YUJA 3X2NA 4RV0A 2PMZA 4JP7A 2B63A 3X2HA 5ERGB 2CW0D 1H5NA 4KLNA 4KODA 2JIMA 2JA6A 2WB1A 3X2JA 3ML1A 4QIWA 2JA5A 3GTMA 4JS7A 3FPRA 3X2IA 1ZYRD 2E2HA 1YNND 3X2KA 3SUMA 1K83A 2VPZA 1PYQA 3FKIA 5D6WA 1PT1A 2E7ZA 1IW7D 1VC3B 4JCWA 1I50A 3GTLA 2NVXA 4KDIA 2PWYA 3LHDA 2NVYA 1Y4ZA 2JA7A 2JIOA 1TMOA 3QQ8A 5FTMA 3SULA 2AE0X 5FTNA 4JP6A 5C1BA 5GM9A 2XDPA 1G8KA 5T5MD 3MB5A
chains in the Genus database with same CATH topology
1OGYA 2VPWA 3GTGA 2VPYA 1TWFA 2R92A 2DMRA 4AYBA 2Q1AX 2GAEA 3ZGZA 2V45A 2KY9A 5DYGA 4ARIA 4GA6A 4GA5A 2B25A 2A6HD 5EPPA 2G5DA 2R7ZA 1R7RA 2NYAA 3BQBA 2YU9A 4CRYG 2JIRA 3IR6A 2E2IA 3CZBA 4AAYA 2Q1CX 1ZC1A 4AS1A 1DMRA 1EU1A 3GTOA 1R27A 1AW8B 4KDLA 1TWGA 4DMRA 5C18A 1Q16A 1E5VA 2A69D 2EEOB 3DMRA 2R93A 4UC4A 5EQJB 4KO8A 2Q19X 1E18A 1DMSA 3HU3A 3GTPA 1CZ5A 2WAQA 2NAPA 5CCXA 2YVLA 2PICA 1QCSA 5FTLA 1O54A 2PI8A 4AOKB 3CQZA 3GTJA 1Y1WA 1UHDA 3TM7B 1PQHA 3QWZA 1R9TA 1E61A 3QC8A 5CCBA 2GFAA 2JIPA 1SMYD 1QDNA 2A68D 3TIWA 1KQFA 3GTQA 1PQEA 4AONB 3IR7A 3CF2A 4CRZA 5T5ID 2MM0A 3O5AA 3HU1A 1KQGA 1FDOA 4ARCA 4FIBA 1SFOA 1CZ4A 1YNJD 1E60A 2LW6A 2A6ED 2Q18X 1SIWA 1PT0A 4NOHA 4CQNA 2BE5D 2V3VA 5FTKA 5D6XA 1TWCA 4D7ZB 5CD1A 4C2MA 1Y5IA 1YLEA 2PNWA 3ZJVA 3FPTA 2JIQA 1Y1VA 1WCMA 3PLXB 2Q1DX 5B6CA 1CR5A 3HU2A 2PJJA 3H0GA 3IR5A 3FPUA 3ZJTA 1G8JA 1FDIA 1AA6A 5FTJA 3GTKA 2IV2X 2QQSA 2PJHB 2VUMA 2O5JD 2MM2A 2G6GA 2JV2A 4AZDA 1H0HA 1PPYA 1E32A 4AQ7A 1I9GA 1I3QA 5DYIA 3HKZA 3OUGA 1S3SA 4CS0A 3LGAA 2KI8A 3ZJUA 1UHEA 1WLFA 2QQRA 1PQFA 1TWAA 2VPXA 1PYUB 2Y0SA 3QQ7A 5D6YA 1TWHA 5GLFA 2GF7A 2C45A 2YUJA 4RV0A 2PMZA 2B63A 5ERGB 2CW0D 1H5NA 4KLNA 4KODA 2JIMA 2JA6A 2WB1A 3ML1A 4QIWA 2JA5A 3GTMA 3FPRA 2E2HA 1ZYRD 1YNND 1K83A 2VPZA 1PYQA 3FKIA 5D6WA 1PT1A 2E7ZA 1IW7D 1VC3B 1I50A 3GTLA 2NVXA 2PWYA 4KDIA 3LHDA 2NVYA 1Y4ZA 2JA7A 2JIOA 1TMOA 3QQ8A 5FTMA 2AE0X 5FTNA 5C1BA 2XDPA 1G8KA 5T5MD 3MB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGY A;  2VPW A;  3GTG A;  2VPY A;  1TWF A;  2R92 A;  2DMR A;  4AYB A;  2V45 A;  5DYG A;  4GA6 A;  4GA5 A;  5EPP A;  2R7Z A;  1R7R A;  2NYA A;  2YU9 A;  4CRY G;  2JIR A;  3IR6 A;  2E2I A;  4AAY A;  1ZC1 A;  1DMR A;  1EU1 A;  3GTO A;  1R27 A;  1AW8 B;  4KDL A;  1TWG A;  4DMR A;  5C18 A;  1Q16 A;  1E5V A;  2EEO B;  3DMR A;  2R93 A;  4KO8 A;  1E18 A;  1DMS A;  3HU3 A;  3GTP A;  1CZ5 A;  2WAQ A;  2NAP A;  1QCS A;  5FTL A;  4AOK B;  3CQZ A;  3GTJ A;  1Y1W A;  1UHD A;  3TM7 B;  1PQH A;  3QWZ A;  1R9T A;  1E61 A;  3QC8 A;  2JIP A;  1QDN A;  3TIW A;  1KQF A;  3GTQ A;  1PQE A;  4AON B;  3IR7 A;  3CF2 A;  4CRZ A;  5T5I D;  3O5A A;  3HU1 A;  1KQG A;  1FDO A;  1SFO A;  1CZ4 A;  1E60 A;  1SIW A;  1PT0 A;  2V3V A;  5FTK A;  1TWC A;  4D7Z B;  4C2M A;  1Y5I A;  1YLE A;  2JIQ A;  1Y1V A;  1WCM A;  3PLX B;  5B6C A;  1CR5 A;  3HU2 A;  3H0G A;  3IR5 A;  1G8J A;  1FDI A;  1AA6 A;  5FTJ A;  3GTK A;  2IV2 X;  2PJH B;  2VUM A;  2JV2 A;  4AZD A;  1H0H A;  1PPY A;  1E32 A;  1I3Q A;  5DYI A;  3HKZ A;  3OUG A;  1S3S A;  4CS0 A;  2KI8 A;  1UHE A;  1WLF A;  1PQF A;  1TWA A;  2VPX A;  1PYU B;  2Y0S A;  3QQ7 A;  1TWH A;  5GLF A;  2C45 A;  2YUJ A;  4RV0 A;  2PMZ A;  2B63 A;  1H5N A;  4KLN A;  4KOD A;  2JIM A;  2JA6 A;  2WB1 A;  3ML1 A;  4QIW A;  2JA5 A;  3GTM A;  2E2H A;  1K83 A;  2VPZ A;  1PYQ A;  3FKI A;  1PT1 A;  2E7Z A;  1IW7 D;  1VC3 B;  1I50 A;  3GTL A;  2NVX A;  4KDI A;  2NVY A;  1Y4Z A;  2JA7 A;  2JIO A;  1TMO A;  3QQ8 A;  5FTM A;  5FTN A;  5C1B A;  1G8K A;  5T5M D; 
#chains in the Genus database with same CATH topology
 1OGY A;  2VPW A;  4AVR A;  3GTG A;  1WC2 A;  2VPY A;  5H4U A;  1TWF A;  2R92 A;  2DMR A;  4AYB A;  2Q1A X;  2GAE A;  3ZGZ A;  2V45 A;  2KY9 A;  5DYG A;  4ARI A;  4GA6 A;  4FG4 A;  4GA5 A;  2B25 A;  2A6H D;  5EPP A;  3SUJ A;  2G5D A;  2R7Z A;  1R7R A;  2NYA A;  3BQB A;  2YU9 A;  4CRY G;  2JIR A;  3IR6 A;  2E2I A;  3CZB A;  4AAY A;  2Q1C X;  1ZC1 A;  1L8F A;  4AS1 A;  1DMR A;  1EU1 A;  3GTO A;  1R27 A;  1AW8 B;  4KDL A;  1TWG A;  4DMR A;  1BW4 A;  3M3G A;  3SUK A;  5C18 A;  1Q16 A;  1E5V A;  2A69 D;  2EEO B;  2HCZ X;  3DMR A;  2R93 A;  4UC4 A;  5EQJ B;  4KO8 A;  2Q19 X;  1HD5 A;  1E18 A;  1DMS A;  3HU3 A;  4ENG A;  3GTP A;  1CZ5 A;  2WAQ A;  2NAP A;  1BW3 A;  3X2L A;  2YVL A;  5CCX A;  2PIC A;  1QCS A;  5FTL A;  1O54 A;  2BH0 A;  2PI8 A;  4AOK B;  3CQZ A;  3GTJ A;  1Y1W A;  1UHD A;  3TM7 B;  1PQH A;  2KQA A;  3ENG A;  1E61 A;  3QWZ A;  3QC8 A;  4FG2 A;  4FER A;  1R9T A;  2GFA A;  2JIP A;  5CCB A;  1SMY D;  1QDN A;  2A68 D;  3TIW A;  1KQF A;  3GTQ A;  3X2O A;  1PQE A;  4AON B;  1OA7 A;  3IR7 A;  3CF2 A;  4CRZ A;  5T5I D;  2MM0 A;  3O5A A;  3HU1 A;  4L48 A;  1KQG A;  1OA9 A;  1FDO A;  4ARC A;  4FIB A;  1SFO A;  1CZ4 A;  1YNJ D;  1E60 A;  2LW6 A;  2A6E D;  4ZM7 A;  1SIW A;  1PT0 A;  4NOH A;  2Q18 X;  4CQN A;  2BE5 D;  3D30 A;  2V3V A;  5FTK A;  5D6X A;  1TWC A;  3X2G A;  4D7Z B;  5CD1 A;  4C2M A;  1Y5I A;  1YLE A;  2PNW A;  3ZJV A;  3FPT A;  2JIQ A;  1Y1V A;  1WCM A;  2ENG A;  5GLY A;  3PLX B;  2Q1D X;  5B6C A;  1CR5 A;  3HU2 A;  2PJJ A;  3H0G A;  3IR5 A;  3FPU A;  3ZJT A;  5GLX A;  1G8J A;  1FDI A;  1AA6 A;  5FTJ A;  3GTK A;  2IV2 X;  2QQS A;  2PJH B;  2VUM A;  2O5J D;  4JJO A;  2G6G A;  2JV2 A;  4AZD A;  2MM2 A;  1H0H A;  1PPY A;  1E32 A;  4AQ7 A;  1I9G A;  3X2M A;  1I3Q A;  5DYI A;  3HKZ A;  3OUG A;  1S3S A;  4CS0 A;  3LGA A;  2KI8 A;  3ZJU A;  1UHE A;  1WLF A;  4FFT A;  1N10 A;  2QQR A;  1PQF A;  1TWA A;  2VPX A;  1PYU B;  2Y0S A;  3QQ7 A;  5D6Y A;  3X2P A;  1TWH A;  5GLF A;  2GF7 A;  2C45 A;  2YUJ A;  3X2N A;  4RV0 A;  2PMZ A;  4JP7 A;  2B63 A;  3X2H A;  5ERG B;  2CW0 D;  1H5N A;  4KLN A;  4KOD A;  2JIM A;  2JA6 A;  2WB1 A;  3X2J A;  3ML1 A;  4QIW A;  2JA5 A;  3GTM A;  4JS7 A;  3FPR A;  3X2I A;  1ZYR D;  2E2H A;  1YNN D;  3X2K A;  3SUM A;  1K83 A;  2VPZ A;  1PYQ A;  3FKI A;  5D6W A;  1PT1 A;  2E7Z A;  1IW7 D;  1VC3 B;  4JCW A;  1I50 A;  3GTL A;  2NVX A;  4KDI A;  2PWY A;  3LHD A;  2NVY A;  1Y4Z A;  2JA7 A;  2JIO A;  1TMO A;  3QQ8 A;  5FTM A;  3SUL A;  2AE0 X;  5FTN A;  4JP6 A;  5C1B A;  5GM9 A;  2XDP A;  1G8K A;  5T5M D;  3MB5 A; 
#chains in the Genus database with same CATH homology
 1OGY A;  2VPW A;  3GTG A;  2VPY A;  1TWF A;  2R92 A;  2DMR A;  4AYB A;  2Q1A X;  2GAE A;  3ZGZ A;  2V45 A;  2KY9 A;  5DYG A;  4ARI A;  4GA6 A;  4GA5 A;  2B25 A;  2A6H D;  5EPP A;  2G5D A;  2R7Z A;  1R7R A;  2NYA A;  3BQB A;  2YU9 A;  4CRY G;  2JIR A;  3IR6 A;  2E2I A;  3CZB A;  4AAY A;  2Q1C X;  1ZC1 A;  4AS1 A;  1DMR A;  1EU1 A;  3GTO A;  1R27 A;  1AW8 B;  4KDL A;  1TWG A;  4DMR A;  5C18 A;  1Q16 A;  1E5V A;  2A69 D;  2EEO B;  3DMR A;  2R93 A;  4UC4 A;  5EQJ B;  4KO8 A;  2Q19 X;  1E18 A;  1DMS A;  3HU3 A;  3GTP A;  1CZ5 A;  2WAQ A;  2NAP A;  5CCX A;  2YVL A;  2PIC A;  1QCS A;  5FTL A;  1O54 A;  2PI8 A;  4AOK B;  3CQZ A;  3GTJ A;  1Y1W A;  1UHD A;  3TM7 B;  1PQH A;  3QWZ A;  1R9T A;  1E61 A;  3QC8 A;  5CCB A;  2GFA A;  2JIP A;  1SMY D;  1QDN A;  2A68 D;  3TIW A;  1KQF A;  3GTQ A;  1PQE A;  4AON B;  3IR7 A;  3CF2 A;  4CRZ A;  5T5I D;  2MM0 A;  3O5A A;  3HU1 A;  1KQG A;  1FDO A;  4ARC A;  4FIB A;  1SFO A;  1CZ4 A;  1YNJ D;  1E60 A;  2LW6 A;  2A6E D;  2Q18 X;  1SIW A;  1PT0 A;  4NOH A;  4CQN A;  2BE5 D;  2V3V A;  5FTK A;  5D6X A;  1TWC A;  4D7Z B;  5CD1 A;  4C2M A;  1Y5I A;  1YLE A;  2PNW A;  3ZJV A;  3FPT A;  2JIQ A;  1Y1V A;  1WCM A;  3PLX B;  2Q1D X;  5B6C A;  1CR5 A;  3HU2 A;  2PJJ A;  3H0G A;  3IR5 A;  3FPU A;  3ZJT A;  1G8J A;  1FDI A;  1AA6 A;  5FTJ A;  3GTK A;  2IV2 X;  2QQS A;  2PJH B;  2VUM A;  2O5J D;  2MM2 A;  2G6G A;  2JV2 A;  4AZD A;  1H0H A;  1PPY A;  1E32 A;  4AQ7 A;  1I9G A;  1I3Q A;  5DYI A;  3HKZ A;  3OUG A;  1S3S A;  4CS0 A;  3LGA A;  2KI8 A;  3ZJU A;  1UHE A;  1WLF A;  2QQR A;  1PQF A;  1TWA A;  2VPX A;  1PYU B;  2Y0S A;  3QQ7 A;  5D6Y A;  1TWH A;  5GLF A;  2GF7 A;  2C45 A;  2YUJ A;  4RV0 A;  2PMZ A;  2B63 A;  5ERG B;  2CW0 D;  1H5N A;  4KLN A;  4KOD A;  2JIM A;  2JA6 A;  2WB1 A;  3ML1 A;  4QIW A;  2JA5 A;  3GTM A;  3FPR A;  2E2H A;  1ZYR D;  1YNN D;  1K83 A;  2VPZ A;  1PYQ A;  3FKI A;  5D6W A;  1PT1 A;  2E7Z A;  1IW7 D;  1VC3 B;  1I50 A;  3GTL A;  2NVX A;  2PWY A;  4KDI A;  3LHD A;  2NVY A;  1Y4Z A;  2JA7 A;  2JIO A;  1TMO A;  3QQ8 A;  5FTM A;  2AE0 X;  5FTN A;  5C1B A;  2XDP A;  1G8K A;  5T5M D;  3MB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...