1QCSA

N-terminal domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
195
Chain Sequence
NMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NSF N-terminal domain crystal structure: models of NSF function.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Fusion protein
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR (NSF-N)
total genus 37
structure length 195
sequence length 202
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qcsA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qcsA02
3HU1A 1Y1VA 1Y4ZA 3GTOA 5T5MD 2DMRA 1TWHA 1UHDA 3FKIA 2NVYA 1CR5A 3GTLA 2IV2X 1KQFA 4KDIA 3QQ8A 5B6CA 3GTKA 1E5VA 3CF2A 2NVXA 2KI8A 1PYQA 2JIOA 3TIWA 1R9TA 4AONB 3HU3A 3IR6A 5C1BA 5C18A 1TWAA 4AAYA 2E2HA 1FDOA 4GA5A 1TMOA 1Q16A 2JIQA 2VPWA 1PPYA 1R7RA 2VPXA 3GTPA 2YU9A 4AZDA 3QWZA 3GTJA 4KO8A 2JIMA 1E18A 1PQEA 5T5ID 2WB1A 5GLFA 4AYBA 2C45A 1G8JA 3TM7B 4CRZA 2JIRA 4C2MA 1VC3B 1AA6A 2JA7A 1EU1A 1PT0A 4AOKB 3ML1A 3IR5A 1CZ5A 1E60A 4CS0A 1UHEA 3QQ7A 2JV2A 3DMRA 1I3QA 3PLXB 1DMRA 3OUGA 1I50A 2B63A 1FDIA 1SIWA 3QC8A 2JA5A 2EEOB 4QIWA 1Y1WA 1PYUB 3H0GA 4KLNA 4D7ZB 2PJHB 1WCMA 2VPZA 5FTKA 1E61A 1H5NA 1PT1A 2R92A 1S3SA 4GA6A 1R27A 1E32A 1TWCA 1TWFA 1Y5IA 1KQGA 2YUJA 1QCSA 2R93A 1QDNA 2WAQA 1OGYA 1K83A 2V45A 1DMSA 2E2IA 5DYGA 4DMRA 1YLEA 2JIPA 4RV0A 1PQFA 1WLFA 3CQZA 3GTGA 4KDLA 2PMZA 3GTMA 3GTQA 2E7ZA 5FTMA 2VUMA 1CZ4A 5FTNA 1ZC1A 2V3VA 1H0HA 2NAPA 2R7ZA 4KODA 5FTLA 3IR7A 1IW7D 2NYAA 1G8KA 1SFOA 2Y0SA 1PQHA 2JA6A 1AW8B 3HU2A 1TWGA 5EPPA 2VPYA 3HKZA 4CRYG 5FTJA 5DYIA 3O5AA
chains in the Genus database with same CATH superfamily
2GAEA 3HU1A 1Y1VA 2A68D 2A6HD 1Y4ZA 3GTOA 5T5MD 2DMRA 1TWHA 1UHDA 3FKIA 2A69D 2NVYA 4FFTA 1CR5A 2PNWA 2IV2X 3GTLA 5D6WA 1KQFA 1ZYRD 4KDIA 3QQ8A 5B6CA 2ENGA 1E5VA 3CF2A 1N10A 3M3GA 2KI8A 1YNJD 3GTKA 4FERA 1PYQA 2JIOA 3SUKA 3TIWA 3X2OA 2BH0A 1R9TA 3SULA 4FG2A 4JJOA 3X2GA 4AONB 3HU3A 3IR6A 5C1BA 2XDPA 2PJJA 1TWAA 5C18A 3FPTA 4AAYA 2E2HA 5CD1A 4ARIA 1BW3A 4JP6A 1FDOA 4JS7A 5ERGB 1OA7A 2B25A 4GA5A 1TMOA 1Q16A 2JIQA 2VPWA 1PPYA 4ENGA 1R7RA 3X2MA 1O54A 2VPXA 3GTPA 3X2HA 2YU9A 2MM2A 4AZDA 3X2NA 2GFAA 3QWZA 5GLXA 3GTJA 4FIBA 4KO8A 2JIMA 1E18A 1PQEA 5T5ID 2G6GA 2WB1A 5GLFA 4AYBA 3MB5A 2C45A 1G8JA 3TM7B 4CRZA 3X2IA 2G5DA 2JIRA 2PI8A 4C2MA 4AQ7A 1VC3B 1AA6A 5GLYA 2JA7A 1EU1A 1PT0A 1BW4A 5D6XA 4AOKB 3ZGZA 3ML1A 3LHDA 3X2LA 3IR5A 1CZ5A 1E60A 4CS0A 1UHEA 2YVLA 2GF7A 4CQNA 3QQ7A 2JV2A 2QQSA 1I9GA 2Q18X 3DMRA 1I3QA 5EQJB 3ZJUA 3PLXB 1DMRA 4UC4A 3OUGA 1I50A 2KY9A 2QQRA 1SMYD 3ZJTA 2B63A 1FDIA 1SIWA 3QC8A 2JA5A 2EEOB 4QIWA 5GM9A 1Y1WA 1PYUB 3H0GA 4KLNA 3SUJA 4D7ZB 5CCXA 2PJHB 1WCMA 2VPZA 2LW6A 5FTKA 1E61A 1H5NA 1PT1A 4L48A 2R92A 1S3SA 4NOHA 3FPRA 4GA6A 1R27A 3LGAA 1E32A 1TWCA 1TWFA 1Y5IA 1KQGA 2YUJA 1QCSA 4ZM7A 2R93A 1QDNA 2WAQA 1OGYA 2NVXA 4AS1A 1K83A 2Q1DX 2V45A 2O5JD 1DMSA 2E2IA 4JP7A 5DYGA 4DMRA 1YLEA 2JIPA 4RV0A 2HCZX 1PQFA 1WLFA 5D6YA 3CQZA 3X2KA 3GTGA 2PWYA 4KDLA 2PMZA 3GTMA 3GTQA 2E7ZA 5FTMA 2KQAA 4AVRA 2A6ED 2VUMA 2Q1AX 1CZ4A 1HD5A 5FTNA 1ZC1A 2V3VA 1H0HA 2CW0D 1YNND 2NAPA 2R7ZA 4KODA 5FTLA 3IR7A 1OA9A 2PICA 1IW7D 2NYAA 3CZBA 3ZJVA 3X2JA 1G8KA 3X2PA 2MM0A 4FG4A 1SFOA 2BE5D 1PQHA 2Y0SA 2AE0X 3ENGA 5H4UA 1AW8B 3D30A 3HU2A 2JA6A 1TWGA 5EPPA 2Q1CX 5CCBA 1WC2A 4JCWA 2VPYA 4ARCA 2Q19X 3HKZA 4CRYG 1L8FA 5FTJA 3SUMA 3BQBA 3FPUA 5DYIA 3O5AA
chains in the Genus database with same CATH topology
2GAEA 3HU1A 1Y1VA 2A68D 2A6HD 1Y4ZA 3GTOA 5T5MD 2DMRA 1TWHA 1UHDA 3FKIA 2A69D 2NVYA 1CR5A 2PNWA 2IV2X 3GTLA 5D6WA 1KQFA 1ZYRD 4KDIA 3QQ8A 5B6CA 3GTKA 1E5VA 3CF2A 2NVXA 3ZJUA 2KI8A 1YNJD 1PYQA 2JIOA 3TIWA 1R9TA 4AONB 3HU3A 3IR6A 5C1BA 2XDPA 2PJJA 1TWAA 5C18A 3FPTA 4AAYA 2E2HA 5CD1A 4ARIA 1FDOA 5ERGB 2B25A 4GA5A 1TMOA 1Q16A 2JIQA 2VPWA 1PPYA 1R7RA 1O54A 2VPXA 3GTPA 2YU9A 2MM2A 4AZDA 2GFAA 3QWZA 3GTJA 4FIBA 4KO8A 2JIMA 1E18A 1PQEA 5T5ID 2G6GA 2WB1A 5GLFA 4AYBA 3MB5A 2C45A 1G8JA 3TM7B 4CRZA 2G5DA 2JIRA 2PI8A 4C2MA 4AQ7A 1VC3B 1AA6A 2JA7A 1EU1A 1PT0A 5D6XA 4AOKB 3ML1A 3LHDA 3IR5A 1CZ5A 1E60A 4CS0A 1UHEA 2YVLA 2GF7A 4CQNA 3QQ7A 2JV2A 2QQSA 1I9GA 2Q18X 3DMRA 1I3QA 5EQJB 3PLXB 1DMRA 4UC4A 3OUGA 1I50A 2KY9A 2QQRA 1SMYD 3ZJTA 2B63A 1FDIA 1SIWA 3QC8A 2JA5A 2EEOB 4QIWA 1Y1WA 1PYUB 3H0GA 4KLNA 5CCXA 4D7ZB 2PJHB 1WCMA 2VPZA 2LW6A 5FTKA 1E61A 1H5NA 1PT1A 2R92A 1S3SA 4NOHA 3FPRA 4GA6A 1R27A 3LGAA 1E32A 1TWCA 1TWFA 1Y5IA 1KQGA 2YUJA 1QCSA 2R93A 1QDNA 2WAQA 1OGYA 4AS1A 1K83A 2Q1DX 2V45A 2O5JD 1DMSA 2E2IA 5DYGA 4DMRA 1YLEA 2JIPA 4RV0A 1PQFA 1WLFA 5D6YA 3CQZA 3GTGA 2PWYA 4KDLA 2PMZA 3GTMA 3GTQA 2E7ZA 5FTMA 2VUMA 2Q1AX 2A6ED 1CZ4A 5FTNA 1ZC1A 2V3VA 1H0HA 2CW0D 1YNND 2NAPA 2R7ZA 4KODA 5FTLA 3IR7A 2PICA 1IW7D 2NYAA 3CZBA 3ZJVA 1G8KA 2MM0A 1SFOA 2BE5D 1PQHA 2Y0SA 2AE0X 2JA6A 3ZGZA 1AW8B 3HU2A 1TWGA 5EPPA 2Q1CX 5CCBA 2VPYA 4ARCA 2Q19X 3HKZA 4CRYG 5FTJA 3BQBA 3FPUA 5DYIA 3O5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HU1 A;  1Y1V A;  1Y4Z A;  3GTO A;  5T5M D;  2DMR A;  1TWH A;  1UHD A;  3FKI A;  2NVY A;  1CR5 A;  3GTL A;  2IV2 X;  1KQF A;  4KDI A;  3QQ8 A;  5B6C A;  3GTK A;  1E5V A;  3CF2 A;  2NVX A;  2KI8 A;  1PYQ A;  2JIO A;  3TIW A;  1R9T A;  4AON B;  3HU3 A;  3IR6 A;  5C1B A;  5C18 A;  1TWA A;  4AAY A;  2E2H A;  1FDO A;  4GA5 A;  1TMO A;  1Q16 A;  2JIQ A;  2VPW A;  1PPY A;  1R7R A;  2VPX A;  3GTP A;  2YU9 A;  4AZD A;  3QWZ A;  3GTJ A;  4KO8 A;  2JIM A;  1E18 A;  1PQE A;  5T5I D;  2WB1 A;  5GLF A;  4AYB A;  2C45 A;  1G8J A;  3TM7 B;  4CRZ A;  2JIR A;  4C2M A;  1VC3 B;  1AA6 A;  2JA7 A;  1EU1 A;  1PT0 A;  4AOK B;  3ML1 A;  3IR5 A;  1CZ5 A;  1E60 A;  4CS0 A;  1UHE A;  3QQ7 A;  2JV2 A;  3DMR A;  1I3Q A;  3PLX B;  1DMR A;  3OUG A;  1I50 A;  2B63 A;  1FDI A;  1SIW A;  3QC8 A;  2JA5 A;  2EEO B;  4QIW A;  1Y1W A;  1PYU B;  3H0G A;  4KLN A;  4D7Z B;  2PJH B;  1WCM A;  2VPZ A;  5FTK A;  1E61 A;  1H5N A;  1PT1 A;  2R92 A;  1S3S A;  4GA6 A;  1R27 A;  1E32 A;  1TWC A;  1TWF A;  1Y5I A;  1KQG A;  2YUJ A;  1QCS A;  2R93 A;  1QDN A;  2WAQ A;  1OGY A;  1K83 A;  2V45 A;  1DMS A;  2E2I A;  5DYG A;  4DMR A;  1YLE A;  2JIP A;  4RV0 A;  1PQF A;  1WLF A;  3CQZ A;  3GTG A;  4KDL A;  2PMZ A;  3GTM A;  3GTQ A;  2E7Z A;  5FTM A;  2VUM A;  1CZ4 A;  5FTN A;  1ZC1 A;  2V3V A;  1H0H A;  2NAP A;  2R7Z A;  4KOD A;  5FTL A;  3IR7 A;  1IW7 D;  2NYA A;  1G8K A;  1SFO A;  2Y0S A;  1PQH A;  2JA6 A;  1AW8 B;  3HU2 A;  1TWG A;  5EPP A;  2VPY A;  3HKZ A;  4CRY G;  5FTJ A;  5DYI A;  3O5A A; 
#chains in the Genus database with same CATH topology
 2GAE A;  3HU1 A;  1Y1V A;  2A68 D;  2A6H D;  1Y4Z A;  3GTO A;  5T5M D;  2DMR A;  1TWH A;  1UHD A;  3FKI A;  2A69 D;  2NVY A;  4FFT A;  1CR5 A;  2PNW A;  2IV2 X;  3GTL A;  5D6W A;  1KQF A;  1ZYR D;  4KDI A;  3QQ8 A;  5B6C A;  2ENG A;  1E5V A;  3CF2 A;  1N10 A;  3M3G A;  2KI8 A;  1YNJ D;  3GTK A;  4FER A;  1PYQ A;  2JIO A;  3SUK A;  3TIW A;  3X2O A;  2BH0 A;  1R9T A;  3SUL A;  4FG2 A;  4JJO A;  3X2G A;  4AON B;  3HU3 A;  3IR6 A;  5C1B A;  2XDP A;  2PJJ A;  1TWA A;  5C18 A;  3FPT A;  4AAY A;  2E2H A;  5CD1 A;  4ARI A;  1BW3 A;  4JP6 A;  1FDO A;  4JS7 A;  5ERG B;  1OA7 A;  2B25 A;  4GA5 A;  1TMO A;  1Q16 A;  2JIQ A;  2VPW A;  1PPY A;  4ENG A;  1R7R A;  3X2M A;  1O54 A;  2VPX A;  3GTP A;  3X2H A;  2YU9 A;  2MM2 A;  4AZD A;  3X2N A;  2GFA A;  3QWZ A;  5GLX A;  3GTJ A;  4FIB A;  4KO8 A;  2JIM A;  1E18 A;  1PQE A;  5T5I D;  2G6G A;  2WB1 A;  5GLF A;  4AYB A;  3MB5 A;  2C45 A;  1G8J A;  3TM7 B;  4CRZ A;  3X2I A;  2G5D A;  2JIR A;  2PI8 A;  4C2M A;  4AQ7 A;  1VC3 B;  1AA6 A;  5GLY A;  2JA7 A;  1EU1 A;  1PT0 A;  1BW4 A;  5D6X A;  4AOK B;  3ZGZ A;  3ML1 A;  3LHD A;  3X2L A;  3IR5 A;  1CZ5 A;  1E60 A;  4CS0 A;  1UHE A;  2YVL A;  2GF7 A;  4CQN A;  3QQ7 A;  2JV2 A;  2QQS A;  1I9G A;  2Q18 X;  3DMR A;  1I3Q A;  5EQJ B;  3ZJU A;  3PLX B;  1DMR A;  4UC4 A;  3OUG A;  1I50 A;  2KY9 A;  2QQR A;  1SMY D;  3ZJT A;  2B63 A;  1FDI A;  1SIW A;  3QC8 A;  2JA5 A;  2EEO B;  4QIW A;  5GM9 A;  1Y1W A;  1PYU B;  3H0G A;  4KLN A;  3SUJ A;  4D7Z B;  5CCX A;  2PJH B;  1WCM A;  2VPZ A;  2LW6 A;  5FTK A;  1E61 A;  1H5N A;  1PT1 A;  4L48 A;  2R92 A;  1S3S A;  4NOH A;  3FPR A;  4GA6 A;  1R27 A;  3LGA A;  1E32 A;  1TWC A;  1TWF A;  1Y5I A;  1KQG A;  2YUJ A;  1QCS A;  4ZM7 A;  2R93 A;  1QDN A;  2WAQ A;  1OGY A;  2NVX A;  4AS1 A;  1K83 A;  2Q1D X;  2V45 A;  2O5J D;  1DMS A;  2E2I A;  4JP7 A;  5DYG A;  4DMR A;  1YLE A;  2JIP A;  4RV0 A;  2HCZ X;  1PQF A;  1WLF A;  5D6Y A;  3CQZ A;  3X2K A;  3GTG A;  2PWY A;  4KDL A;  2PMZ A;  3GTM A;  3GTQ A;  2E7Z A;  5FTM A;  2KQA A;  4AVR A;  2A6E D;  2VUM A;  2Q1A X;  1CZ4 A;  1HD5 A;  5FTN A;  1ZC1 A;  2V3V A;  1H0H A;  2CW0 D;  1YNN D;  2NAP A;  2R7Z A;  4KOD A;  5FTL A;  3IR7 A;  1OA9 A;  2PIC A;  1IW7 D;  2NYA A;  3CZB A;  3ZJV A;  3X2J A;  1G8K A;  3X2P A;  2MM0 A;  4FG4 A;  1SFO A;  2BE5 D;  1PQH A;  2Y0S A;  2AE0 X;  3ENG A;  5H4U A;  1AW8 B;  3D30 A;  3HU2 A;  2JA6 A;  1TWG A;  5EPP A;  2Q1C X;  5CCB A;  1WC2 A;  4JCW A;  2VPY A;  4ARC A;  2Q19 X;  3HKZ A;  4CRY G;  1L8F A;  5FTJ A;  3SUM A;  3BQB A;  3FPU A;  5DYI A;  3O5A A; 
#chains in the Genus database with same CATH homology
 2GAE A;  3HU1 A;  1Y1V A;  2A68 D;  2A6H D;  1Y4Z A;  3GTO A;  5T5M D;  2DMR A;  1TWH A;  1UHD A;  3FKI A;  2A69 D;  2NVY A;  1CR5 A;  2PNW A;  2IV2 X;  3GTL A;  5D6W A;  1KQF A;  1ZYR D;  4KDI A;  3QQ8 A;  5B6C A;  3GTK A;  1E5V A;  3CF2 A;  2NVX A;  3ZJU A;  2KI8 A;  1YNJ D;  1PYQ A;  2JIO A;  3TIW A;  1R9T A;  4AON B;  3HU3 A;  3IR6 A;  5C1B A;  2XDP A;  2PJJ A;  1TWA A;  5C18 A;  3FPT A;  4AAY A;  2E2H A;  5CD1 A;  4ARI A;  1FDO A;  5ERG B;  2B25 A;  4GA5 A;  1TMO A;  1Q16 A;  2JIQ A;  2VPW A;  1PPY A;  1R7R A;  1O54 A;  2VPX A;  3GTP A;  2YU9 A;  2MM2 A;  4AZD A;  2GFA A;  3QWZ A;  3GTJ A;  4FIB A;  4KO8 A;  2JIM A;  1E18 A;  1PQE A;  5T5I D;  2G6G A;  2WB1 A;  5GLF A;  4AYB A;  3MB5 A;  2C45 A;  1G8J A;  3TM7 B;  4CRZ A;  2G5D A;  2JIR A;  2PI8 A;  4C2M A;  4AQ7 A;  1VC3 B;  1AA6 A;  2JA7 A;  1EU1 A;  1PT0 A;  5D6X A;  4AOK B;  3ML1 A;  3LHD A;  3IR5 A;  1CZ5 A;  1E60 A;  4CS0 A;  1UHE A;  2YVL A;  2GF7 A;  4CQN A;  3QQ7 A;  2JV2 A;  2QQS A;  1I9G A;  2Q18 X;  3DMR A;  1I3Q A;  5EQJ B;  3PLX B;  1DMR A;  4UC4 A;  3OUG A;  1I50 A;  2KY9 A;  2QQR A;  1SMY D;  3ZJT A;  2B63 A;  1FDI A;  1SIW A;  3QC8 A;  2JA5 A;  2EEO B;  4QIW A;  1Y1W A;  1PYU B;  3H0G A;  4KLN A;  5CCX A;  4D7Z B;  2PJH B;  1WCM A;  2VPZ A;  2LW6 A;  5FTK A;  1E61 A;  1H5N A;  1PT1 A;  2R92 A;  1S3S A;  4NOH A;  3FPR A;  4GA6 A;  1R27 A;  3LGA A;  1E32 A;  1TWC A;  1TWF A;  1Y5I A;  1KQG A;  2YUJ A;  1QCS A;  2R93 A;  1QDN A;  2WAQ A;  1OGY A;  4AS1 A;  1K83 A;  2Q1D X;  2V45 A;  2O5J D;  1DMS A;  2E2I A;  5DYG A;  4DMR A;  1YLE A;  2JIP A;  4RV0 A;  1PQF A;  1WLF A;  5D6Y A;  3CQZ A;  3GTG A;  2PWY A;  4KDL A;  2PMZ A;  3GTM A;  3GTQ A;  2E7Z A;  5FTM A;  2VUM A;  2Q1A X;  2A6E D;  1CZ4 A;  5FTN A;  1ZC1 A;  2V3V A;  1H0H A;  2CW0 D;  1YNN D;  2NAP A;  2R7Z A;  4KOD A;  5FTL A;  3IR7 A;  2PIC A;  1IW7 D;  2NYA A;  3CZB A;  3ZJV A;  1G8K A;  2MM0 A;  1SFO A;  2BE5 D;  1PQH A;  2Y0S A;  2AE0 X;  2JA6 A;  3ZGZ A;  1AW8 B;  3HU2 A;  1TWG A;  5EPP A;  2Q1C X;  5CCB A;  2VPY A;  4ARC A;  2Q19 X;  3HKZ A;  4CRY G;  5FTJ A;  3BQB A;  3FPU A;  5DYI A;  3O5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...