2YUJA

Solution structure of human ubiquitin fusion degradation protein 1 homolog ufd1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
190
structure length
190
Chain Sequence
GSSGSSGIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin fusion degradation 1-like
total genus 25
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2yujA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2yujA02
5C18A 1CZ5A 4KDLA 3QQ7A 5GLFA 5B6CA 3CF2A 1ZC1A 1WLFA 4KODA 5DYGA 2JV2A 1QCSA 1E32A 1CZ4A 2YUJA 5FTMA 5FTJA 5EPPA 3TIWA 1S3SA 3HU3A 4KO8A 5FTNA 3HU1A 2PJHB 3QC8A 1R7RA 4KDIA 3HU2A 5FTKA 3QQ8A 5FTLA 4RV0A 4KLNA 3QWZA 5DYIA 1CR5A 5C1BA 1QDNA
chains in the Genus database with same CATH superfamily
1SIWA 1BW4A 2BH0A 1PYUB 5C18A 5D6YA 2Q18X 4KDLA 5GLFA 2A69D 2MM0A 3GTJA 2KY9A 2PNWA 3X2JA 1TWAA 1Y5IA 1H5NA 2KI8A 2NVYA 1I50A 4AAYA 2R93A 3M3GA 3SULA 4FG2A 4CRYG 5EQJB 2QQRA 5EPPA 3X2OA 2JIQA 4NOHA 2JIPA 4KDIA 4CQNA 2VUMA 5T5ID 5FTLA 1PPYA 2CW0D 4ARCA 1YLEA 2PI8A 2GF7A 3X2LA 3HKZA 5DYIA 1FDIA 2KQAA 3TM7B 1Y4ZA 3O5AA 3GTKA 1QDNA 4AVRA 3OUGA 3CQZA 2G5DA 1I3QA 2LW6A 1CZ5A 1UHDA 1PT1A 4JJOA 5CCBA 5GLXA 3ZJTA 3CF2A 1ZC1A 4AYBA 3GTPA 4L48A 4KODA 1PQHA 1QCSA 1E32A 3SUKA 3X2GA 2JV2A 4ZM7A 3FPUA 2QQSA 5FTMA 1Y1WA 1S3SA 1PQFA 2NAPA 1Q16A 1EU1A 1KQFA 1PYQA 5T5MD 2HCZX 3GTQA 2XDPA 3ZJUA 1TWGA 4JCWA 2G6GA 2IV2X 4JS7A 2O5JD 5FTKA 1TWFA 3QQ8A 4C2MA 1R9TA 3SUJA 4KLNA 3PLXB 3GTMA 3IR7A 2ENGA 5H4UA 3IR5A 2PWYA 2VPZA 5GLYA 2E2HA 1WC2A 2A6HD 1E18A 1KQGA 2E2IA 3BQBA 1G8JA 4ENGA 2YU9A 2WAQA 2JIRA 4GA6A 2R7ZA 2Q1AX 3ZJVA 1SMYD 5CCXA 1WLFA 1YNND 2AE0X 3X2PA 3LGAA 4FFTA 5D6XA 2VPXA 1CZ4A 2JA5A 2PICA 4FERA 1YNJD 2YUJA 4GA5A 5FTJA 1TMOA 5ERGB 1E5VA 5GM9A 1PT0A 1BW3A 3HU1A 4QIWA 3CZBA 3X2IA 1AA6A 2B63A 2PJHB 2Q1DX 1O54A 2A68D 3X2KA 1R7RA 1H0HA 3HU2A 4ARIA 3H0GA 2MM2A 2PJJA 4DMRA 3X2HA 1IW7D 1TWCA 1TWHA 4AQ7A 2VPWA 3MB5A 2B25A 3QWZA 3X2MA 3IR6A 1OGYA 2JIOA 1ZYRD 4UC4A 3GTOA 2YVLA 3LHDA 2WB1A 2V3VA 2R92A 2E7ZA 4AZDA 3FPRA 2JA6A 1E61A 2GFAA 3ENGA 1FDOA 1VC3B 3QQ7A 4CRZA 1L8FA 4D7ZB 5B6CA 3GTGA 2NVXA 2Q19X 3FPTA 3ZGZA 2JIMA 1WCMA 5DYGA 2V45A 2NYAA 4AOKB 4JP6A 5CD1A 1PQEA 1R27A 1DMSA 1SFOA 2PMZA 2DMRA 4CS0A 1K83A 2JA7A 4FIBA 4AS1A 1OA9A 2Y0SA 1N10A 1UHEA 3TIWA 3HU3A 2BE5D 4KO8A 5FTNA 2VPYA 1DMRA 2C45A 3QC8A 3D30A 5D6WA 1I9GA 3FKIA 1Y1VA 2Q1CX 1AW8B 3SUMA 4RV0A 3X2NA 1HD5A 2A6ED 4AONB 3GTLA 4JP7A 2GAEA 3ML1A 1CR5A 1OA7A 4FG4A 3DMRA 2EEOB 1E60A 5C1BA 1G8KA
chains in the Genus database with same CATH topology
1SIWA 1PYUB 5C18A 5D6YA 2Q18X 4KDLA 5GLFA 2A69D 2MM0A 3GTJA 2KY9A 2PNWA 1TWAA 1Y5IA 1H5NA 2KI8A 2NVYA 1I50A 2R93A 5EQJB 4CRYG 2QQRA 5EPPA 2JIQA 4NOHA 2JIPA 4KDIA 4CQNA 2VUMA 5T5ID 5FTLA 1PPYA 2CW0D 4ARCA 1YLEA 2PI8A 2GF7A 3HKZA 5DYIA 1FDIA 3TM7B 1Y4ZA 3O5AA 3GTKA 1QDNA 3OUGA 3CQZA 2G5DA 1I3QA 2LW6A 1CZ5A 1UHDA 1PT1A 5CCBA 3ZJTA 3CF2A 1ZC1A 4AYBA 3GTPA 4KODA 1PQHA 1QCSA 1E32A 2JV2A 3FPUA 2QQSA 5FTMA 1Y1WA 1S3SA 1PQFA 2NAPA 1Q16A 1EU1A 1KQFA 1PYQA 5T5MD 3GTQA 3ZJUA 2XDPA 1TWGA 2G6GA 2IV2X 2O5JD 5FTKA 1TWFA 3QQ8A 4C2MA 1R9TA 3GTMA 4KLNA 3PLXB 3IR7A 3IR5A 2PWYA 2VPZA 2E2HA 2A6HD 1E18A 1KQGA 2E2IA 3BQBA 1G8JA 2YU9A 2WAQA 2JIRA 4GA6A 2R7ZA 2Q1AX 3ZJVA 1SMYD 5CCXA 1WLFA 1YNND 2AE0X 3LGAA 5D6XA 2VPXA 1CZ4A 2JA5A 2PICA 1YNJD 2YUJA 4GA5A 5FTJA 1TMOA 5ERGB 1E5VA 1PT0A 3HU1A 4QIWA 3CZBA 2Q1DX 1AA6A 2B63A 2PJHB 1O54A 2A68D 1R7RA 1H0HA 3HU2A 4ARIA 3H0GA 2MM2A 2PJJA 4DMRA 1IW7D 1TWCA 1TWHA 4AQ7A 2VPWA 3MB5A 2B25A 3QWZA 3IR6A 1OGYA 2JIOA 1ZYRD 4UC4A 3GTOA 2YVLA 3LHDA 2WB1A 2V3VA 2R92A 2E7ZA 4AZDA 3FPRA 2JA6A 1E61A 2GFAA 1FDOA 1VC3B 3QQ7A 4CRZA 5B6CA 4D7ZB 3GTGA 2NVXA 2Q19X 3FPTA 3ZGZA 2JIMA 1WCMA 5DYGA 2V45A 2NYAA 4AOKB 5CD1A 1PQEA 1R27A 1DMSA 1SFOA 2PMZA 2DMRA 4CS0A 1K83A 2JA7A 4FIBA 4AS1A 2Y0SA 1UHEA 3TIWA 3HU3A 2BE5D 4KO8A 5FTNA 2VPYA 1DMRA 2C45A 3QC8A 5D6WA 1I9GA 3FKIA 1Y1VA 2Q1CX 1AW8B 4RV0A 2A6ED 4AONB 3GTLA 2GAEA 3ML1A 1CR5A 4AAYA 3DMRA 2EEOB 1E60A 5C1BA 1G8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C18 A;  1CZ5 A;  4KDL A;  3QQ7 A;  5GLF A;  5B6C A;  3CF2 A;  1ZC1 A;  1WLF A;  4KOD A;  5DYG A;  2JV2 A;  1QCS A;  1E32 A;  1CZ4 A;  2YUJ A;  5FTM A;  5FTJ A;  5EPP A;  3TIW A;  1S3S A;  3HU3 A;  4KO8 A;  5FTN A;  3HU1 A;  2PJH B;  3QC8 A;  1R7R A;  4KDI A;  3HU2 A;  5FTK A;  3QQ8 A;  5FTL A;  4RV0 A;  4KLN A;  3QWZ A;  5DYI A;  1CR5 A;  5C1B A;  1QDN A; 
#chains in the Genus database with same CATH topology
 1SIW A;  1BW4 A;  2BH0 A;  1PYU B;  5C18 A;  5D6Y A;  2Q18 X;  4KDL A;  5GLF A;  2A69 D;  2MM0 A;  3GTJ A;  2KY9 A;  2PNW A;  3X2J A;  1TWA A;  1Y5I A;  1H5N A;  2KI8 A;  2NVY A;  1I50 A;  4AAY A;  2R93 A;  3M3G A;  3SUL A;  4FG2 A;  4CRY G;  5EQJ B;  2QQR A;  5EPP A;  3X2O A;  2JIQ A;  4NOH A;  2JIP A;  4KDI A;  4CQN A;  2VUM A;  5T5I D;  5FTL A;  1PPY A;  2CW0 D;  4ARC A;  1YLE A;  2PI8 A;  2GF7 A;  3X2L A;  3HKZ A;  5DYI A;  1FDI A;  2KQA A;  3TM7 B;  1Y4Z A;  3O5A A;  3GTK A;  1QDN A;  4AVR A;  3OUG A;  3CQZ A;  2G5D A;  1I3Q A;  2LW6 A;  1CZ5 A;  1UHD A;  1PT1 A;  4JJO A;  5CCB A;  5GLX A;  3ZJT A;  3CF2 A;  1ZC1 A;  4AYB A;  3GTP A;  4L48 A;  4KOD A;  1PQH A;  1QCS A;  1E32 A;  3SUK A;  3X2G A;  2JV2 A;  4ZM7 A;  3FPU A;  2QQS A;  5FTM A;  1Y1W A;  1S3S A;  1PQF A;  2NAP A;  1Q16 A;  1EU1 A;  1KQF A;  1PYQ A;  5T5M D;  2HCZ X;  3GTQ A;  2XDP A;  3ZJU A;  1TWG A;  4JCW A;  2G6G A;  2IV2 X;  4JS7 A;  2O5J D;  5FTK A;  1TWF A;  3QQ8 A;  4C2M A;  1R9T A;  3SUJ A;  4KLN A;  3PLX B;  3GTM A;  3IR7 A;  2ENG A;  5H4U A;  3IR5 A;  2PWY A;  2VPZ A;  5GLY A;  2E2H A;  1WC2 A;  2A6H D;  1E18 A;  1KQG A;  2E2I A;  3BQB A;  1G8J A;  4ENG A;  2YU9 A;  2WAQ A;  2JIR A;  4GA6 A;  2R7Z A;  2Q1A X;  3ZJV A;  1SMY D;  5CCX A;  1WLF A;  1YNN D;  2AE0 X;  3X2P A;  3LGA A;  4FFT A;  5D6X A;  2VPX A;  1CZ4 A;  2JA5 A;  2PIC A;  4FER A;  1YNJ D;  2YUJ A;  4GA5 A;  5FTJ A;  1TMO A;  5ERG B;  1E5V A;  5GM9 A;  1PT0 A;  1BW3 A;  3HU1 A;  4QIW A;  3CZB A;  3X2I A;  1AA6 A;  2B63 A;  2PJH B;  2Q1D X;  1O54 A;  2A68 D;  3X2K A;  1R7R A;  1H0H A;  3HU2 A;  4ARI A;  3H0G A;  2MM2 A;  2PJJ A;  4DMR A;  3X2H A;  1IW7 D;  1TWC A;  1TWH A;  4AQ7 A;  2VPW A;  3MB5 A;  2B25 A;  3QWZ A;  3X2M A;  3IR6 A;  1OGY A;  2JIO A;  1ZYR D;  4UC4 A;  3GTO A;  2YVL A;  3LHD A;  2WB1 A;  2V3V A;  2R92 A;  2E7Z A;  4AZD A;  3FPR A;  2JA6 A;  1E61 A;  2GFA A;  3ENG A;  1FDO A;  1VC3 B;  3QQ7 A;  4CRZ A;  1L8F A;  4D7Z B;  5B6C A;  3GTG A;  2NVX A;  2Q19 X;  3FPT A;  3ZGZ A;  2JIM A;  1WCM A;  5DYG A;  2V45 A;  2NYA A;  4AOK B;  4JP6 A;  5CD1 A;  1PQE A;  1R27 A;  1DMS A;  1SFO A;  2PMZ A;  2DMR A;  4CS0 A;  1K83 A;  2JA7 A;  4FIB A;  4AS1 A;  1OA9 A;  2Y0S A;  1N10 A;  1UHE A;  3TIW A;  3HU3 A;  2BE5 D;  4KO8 A;  5FTN A;  2VPY A;  1DMR A;  2C45 A;  3QC8 A;  3D30 A;  5D6W A;  1I9G A;  3FKI A;  1Y1V A;  2Q1C X;  1AW8 B;  3SUM A;  4RV0 A;  3X2N A;  1HD5 A;  2A6E D;  4AON B;  3GTL A;  4JP7 A;  2GAE A;  3ML1 A;  1CR5 A;  1OA7 A;  4FG4 A;  3DMR A;  2EEO B;  1E60 A;  5C1B A;  1G8K A; 
#chains in the Genus database with same CATH homology
 1SIW A;  1PYU B;  5C18 A;  5D6Y A;  2Q18 X;  4KDL A;  5GLF A;  2A69 D;  2MM0 A;  3GTJ A;  2KY9 A;  2PNW A;  1TWA A;  1Y5I A;  1H5N A;  2KI8 A;  2NVY A;  1I50 A;  2R93 A;  5EQJ B;  4CRY G;  2QQR A;  5EPP A;  2JIQ A;  4NOH A;  2JIP A;  4KDI A;  4CQN A;  2VUM A;  5T5I D;  5FTL A;  1PPY A;  2CW0 D;  4ARC A;  1YLE A;  2PI8 A;  2GF7 A;  3HKZ A;  5DYI A;  1FDI A;  3TM7 B;  1Y4Z A;  3O5A A;  3GTK A;  1QDN A;  3OUG A;  3CQZ A;  2G5D A;  1I3Q A;  2LW6 A;  1CZ5 A;  1UHD A;  1PT1 A;  5CCB A;  3ZJT A;  3CF2 A;  1ZC1 A;  4AYB A;  3GTP A;  4KOD A;  1PQH A;  1QCS A;  1E32 A;  2JV2 A;  3FPU A;  2QQS A;  5FTM A;  1Y1W A;  1S3S A;  1PQF A;  2NAP A;  1Q16 A;  1EU1 A;  1KQF A;  1PYQ A;  5T5M D;  3GTQ A;  3ZJU A;  2XDP A;  1TWG A;  2G6G A;  2IV2 X;  2O5J D;  5FTK A;  1TWF A;  3QQ8 A;  4C2M A;  1R9T A;  3GTM A;  4KLN A;  3PLX B;  3IR7 A;  3IR5 A;  2PWY A;  2VPZ A;  2E2H A;  2A6H D;  1E18 A;  1KQG A;  2E2I A;  3BQB A;  1G8J A;  2YU9 A;  2WAQ A;  2JIR A;  4GA6 A;  2R7Z A;  2Q1A X;  3ZJV A;  1SMY D;  5CCX A;  1WLF A;  1YNN D;  2AE0 X;  3LGA A;  5D6X A;  2VPX A;  1CZ4 A;  2JA5 A;  2PIC A;  1YNJ D;  2YUJ A;  4GA5 A;  5FTJ A;  1TMO A;  5ERG B;  1E5V A;  1PT0 A;  3HU1 A;  4QIW A;  3CZB A;  2Q1D X;  1AA6 A;  2B63 A;  2PJH B;  1O54 A;  2A68 D;  1R7R A;  1H0H A;  3HU2 A;  4ARI A;  3H0G A;  2MM2 A;  2PJJ A;  4DMR A;  1IW7 D;  1TWC A;  1TWH A;  4AQ7 A;  2VPW A;  3MB5 A;  2B25 A;  3QWZ A;  3IR6 A;  1OGY A;  2JIO A;  1ZYR D;  4UC4 A;  3GTO A;  2YVL A;  3LHD A;  2WB1 A;  2V3V A;  2R92 A;  2E7Z A;  4AZD A;  3FPR A;  2JA6 A;  1E61 A;  2GFA A;  1FDO A;  1VC3 B;  3QQ7 A;  4CRZ A;  5B6C A;  4D7Z B;  3GTG A;  2NVX A;  2Q19 X;  3FPT A;  3ZGZ A;  2JIM A;  1WCM A;  5DYG A;  2V45 A;  2NYA A;  4AOK B;  5CD1 A;  1PQE A;  1R27 A;  1DMS A;  1SFO A;  2PMZ A;  2DMR A;  4CS0 A;  1K83 A;  2JA7 A;  4FIB A;  4AS1 A;  2Y0S A;  1UHE A;  3TIW A;  3HU3 A;  2BE5 D;  4KO8 A;  5FTN A;  2VPY A;  1DMR A;  2C45 A;  3QC8 A;  5D6W A;  1I9G A;  3FKI A;  1Y1V A;  2Q1C X;  1AW8 B;  4RV0 A;  2A6E D;  4AON B;  3GTL A;  2GAE A;  3ML1 A;  1CR5 A;  4AAY A;  3DMR A;  2EEO B;  1E60 A;  5C1B A;  1G8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...