2YUJA

Solution structure of human ubiquitin fusion degradation protein 1 homolog ufd1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
190
structure length
190
Chain Sequence
GSSGSSGIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin fusion degradation 1-like
publication title Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2yujA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2yujA02
1E32A 3HU3A 3HU1A 5FTNA 5B6CA 2PJHB 1QDNA 2YUJA 4RV0A 1CZ5A 1ZC1A 4KLNA 5FTMA 5DYGA 5FTLA 3QWZA 1QCSA 1CZ4A 3CF2A 3QQ8A 5FTKA 5C18A 5DYIA 3QC8A 5FTJA 2JV2A 3TIWA 5EPPA 4KDLA 4KODA 5C1BA 4KDIA 1WLFA 1CR5A 1S3SA 4KO8A 1R7RA 5GLFA 3HU2A 3QQ7A
chains in the Genus database with same CATH superfamily
1TMOA 1E18A 4JP7A 1Q16A 3H0GA 2QQSA 1Y1VA 2JA7A 1I9GA 2BH0A 2VPXA 1H0HA 1G8JA 1TWGA 5CCXA 3GTQA 2A6HD 3X2KA 2PWYA 2R92A 1PT0A 1OGYA 3MB5A 1QCSA 3CF2A 3D30A 2G6GA 2JIRA 3X2LA 2E2HA 1BW3A 1R27A 1N10A 2PMZA 3QC8A 5FTJA 2KY9A 3ZJVA 1PYUB 1E61A 4JCWA 3OUGA 3TIWA 3GTLA 3ENGA 2DMRA 2ENGA 5D6WA 1TWCA 4CQNA 3SUKA 2YVLA 1K83A 3LHDA 1TWFA 1YNJD 1Y5IA 5H4UA 5GLFA 3X2IA 1G8KA 3TM7B 1E32A 3HU3A 5FTNA 2PJHB 4CRZA 1OA7A 1YNND 1WC2A 2PICA 4FERA 1VC3B 2JIOA 2JIMA 4FG4A 2V45A 2WAQA 5FTMA 5T5ID 4DMRA 2Q1CX 1SMYD 5ERGB 4AONB 5FTLA 3QQ8A 5C18A 1WCMA 3ZGZA 3GTOA 1E60A 5DYIA 3SUMA 2JA6A 4NOHA 3FPTA 5GLYA 2NYAA 2A6ED 3DMRA 2NVYA 4QIWA 5EPPA 2QQRA 1PQFA 3GTKA 4KODA 5D6XA 3IR6A 1PT1A 3HKZA 4GA5A 2KI8A 2JIQA 5C1BA 3FPRA 1Y1WA 3BQBA 1AW8B 3GTPA 2Q1DX 5EQJB 1S3SA 2V3VA 1AA6A 2Q19X 1PPYA 4AZDA 1R9TA 3QQ7A 3GTGA 2MM0A 1PQEA 4ARCA 1PYQA 1ZYRD 4GA6A 2VPYA 4CRYG 5B6CA 5D6YA 2VPWA 2O5JD 2PNWA 2E2IA 1OA9A 1QDNA 2YUJA 5GLXA 3X2OA 1UHEA 4AAYA 1BW4A 1ZC1A 2XDPA 4CS0A 3IR7A 1TWHA 4FIBA 1EU1A 3FKIA 1YLEA 3ML1A 2LW6A 4C2MA 5CD1A 5FTKA 1FDIA 3M3GA 3O5AA 2EEOB 1I50A 2JV2A 4AYBA 2CW0D 4KDLA 2IV2X 1SIWA 3CZBA 1IW7D 4KDIA 2E7ZA 3GTMA 3ZJTA 2HCZX 4AVRA 3IR5A 3SULA 4FFTA 1DMRA 4JJOA 3X2NA 4D7ZB 4ENGA 2NVXA 2GFAA 4L48A 3PLXB 1WLFA 4AOKB 1CR5A 2GAEA 2KQAA 4AS1A 4KO8A 2YU9A 3ZJUA 2A69D 1UHDA 2JIPA 3HU2A 4AQ7A 2G5DA 2WB1A 1HD5A 2NAPA 2Y0SA 2BE5D 3HU1A 4FG2A 5CCBA 2JA5A 1Y4ZA 5T5MD 2GF7A 4JP6A 4RV0A 4ZM7A 1TWAA 1CZ5A 1KQFA 2Q18X 1KQGA 4KLNA 1FDOA 5DYGA 2VUMA 2R7ZA 2PI8A 3QWZA 1CZ4A 2PJJA 4ARIA 4JS7A 3X2GA 2VPZA 4UC4A 3X2JA 2C45A 1DMSA 3LGAA 3X2PA 2B25A 2Q1AX 1H5NA 1SFOA 2AE0X 1L8FA 2MM2A 2A68D 2R93A 1PQHA 1O54A 3FPUA 1E5VA 3CQZA 3X2MA 2B63A 3SUJA 5GM9A 1I3QA 3GTJA 1R7RA 3X2HA
chains in the Genus database with same CATH topology
1TMOA 1E18A 1Q16A 3H0GA 2QQSA 1Y1VA 2JA7A 1I9GA 2VPXA 1H0HA 1G8JA 1TWGA 5CCXA 3GTQA 2A6HD 2PWYA 2R92A 1PT0A 1OGYA 3MB5A 1QCSA 3CF2A 2G6GA 2JIRA 2E2HA 1R27A 2PMZA 3QC8A 5FTJA 2KY9A 3ZJVA 1PYUB 1E61A 3TIWA 3OUGA 3GTLA 2DMRA 5D6WA 1TWCA 4CQNA 2YVLA 1K83A 3LHDA 1TWFA 1YNJD 1Y5IA 5GLFA 1G8KA 3TM7B 1E32A 3HU3A 5FTNA 2PJHB 4CRZA 1YNND 2PICA 1VC3B 2JIOA 2JIMA 5T5ID 2V45A 2WAQA 5FTMA 4DMRA 2Q1CX 1SMYD 5ERGB 4AONB 5FTLA 3QQ8A 5C18A 1WCMA 3ZGZA 3GTOA 1E60A 5DYIA 2JA6A 4NOHA 3FPTA 2NYAA 2A6ED 3DMRA 2NVYA 4QIWA 5EPPA 2QQRA 1PQFA 3GTKA 4KODA 5D6XA 3IR6A 1PT1A 3HKZA 4GA5A 2KI8A 2JIQA 5C1BA 3FPRA 1Y1WA 3BQBA 1AW8B 3GTPA 2Q1DX 5EQJB 1S3SA 2V3VA 1AA6A 2Q19X 1PPYA 4AZDA 1R9TA 3QQ7A 3GTGA 2MM0A 1PQEA 4ARCA 1PYQA 1ZYRD 4GA6A 2VPYA 4CRYG 5B6CA 5D6YA 2VPWA 2O5JD 2PNWA 2E2IA 1QDNA 2YUJA 1UHEA 4AAYA 2XDPA 1ZC1A 4FIBA 4CS0A 3IR7A 1TWHA 1EU1A 3FKIA 1YLEA 3ML1A 2LW6A 4C2MA 5CD1A 5FTKA 1FDIA 3O5AA 2EEOB 1I50A 2JV2A 4AYBA 2CW0D 4KDLA 2IV2X 1SIWA 3CZBA 1IW7D 4KDIA 2E7ZA 3GTMA 3ZJTA 3IR5A 2NVXA 1DMRA 4D7ZB 2GFAA 3PLXB 1WLFA 4AOKB 1CR5A 2GAEA 4AS1A 4KO8A 2YU9A 3ZJUA 2A69D 1UHDA 2JIPA 3HU2A 4AQ7A 2G5DA 2WB1A 2NAPA 2Y0SA 2BE5D 3HU1A 5CCBA 2JA5A 1Y4ZA 5T5MD 2GF7A 4RV0A 1CZ5A 2Q18X 1TWAA 1KQFA 1KQGA 4KLNA 1FDOA 5DYGA 2VUMA 2R7ZA 2PI8A 3QWZA 1CZ4A 2PJJA 4ARIA 2VPZA 4UC4A 2C45A 1DMSA 3LGAA 2B25A 2Q1AX 1H5NA 1SFOA 2AE0X 2MM2A 2A68D 2R93A 1PQHA 1O54A 3FPUA 1E5VA 3CQZA 2B63A 1I3QA 3GTJA 1R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E32 A;  3HU3 A;  3HU1 A;  5FTN A;  5B6C A;  2PJH B;  1QDN A;  2YUJ A;  4RV0 A;  1CZ5 A;  1ZC1 A;  4KLN A;  5FTM A;  5DYG A;  5FTL A;  3QWZ A;  1QCS A;  1CZ4 A;  3CF2 A;  3QQ8 A;  5FTK A;  5C18 A;  5DYI A;  3QC8 A;  5FTJ A;  2JV2 A;  3TIW A;  5EPP A;  4KDL A;  4KOD A;  5C1B A;  4KDI A;  1WLF A;  1CR5 A;  1S3S A;  4KO8 A;  1R7R A;  5GLF A;  3HU2 A;  3QQ7 A; 
#chains in the Genus database with same CATH topology
 1TMO A;  1E18 A;  4JP7 A;  1Q16 A;  3H0G A;  2QQS A;  1Y1V A;  2JA7 A;  1I9G A;  2BH0 A;  2VPX A;  1H0H A;  1G8J A;  1TWG A;  5CCX A;  3GTQ A;  2A6H D;  3X2K A;  2PWY A;  2R92 A;  1PT0 A;  1OGY A;  3MB5 A;  1QCS A;  3CF2 A;  3D30 A;  2G6G A;  2JIR A;  3X2L A;  2E2H A;  1BW3 A;  1R27 A;  1N10 A;  2PMZ A;  3QC8 A;  5FTJ A;  2KY9 A;  3ZJV A;  1PYU B;  1E61 A;  4JCW A;  3OUG A;  3TIW A;  3GTL A;  3ENG A;  2DMR A;  2ENG A;  5D6W A;  1TWC A;  4CQN A;  3SUK A;  2YVL A;  1K83 A;  3LHD A;  1TWF A;  1YNJ D;  1Y5I A;  5H4U A;  5GLF A;  3X2I A;  1G8K A;  3TM7 B;  1E32 A;  3HU3 A;  5FTN A;  2PJH B;  4CRZ A;  1OA7 A;  1YNN D;  1WC2 A;  2PIC A;  4FER A;  1VC3 B;  2JIO A;  2JIM A;  4FG4 A;  2V45 A;  2WAQ A;  5FTM A;  5T5I D;  4DMR A;  2Q1C X;  1SMY D;  5ERG B;  4AON B;  5FTL A;  3QQ8 A;  5C18 A;  1WCM A;  3ZGZ A;  3GTO A;  1E60 A;  5DYI A;  3SUM A;  2JA6 A;  4NOH A;  3FPT A;  5GLY A;  2NYA A;  2A6E D;  3DMR A;  2NVY A;  4QIW A;  5EPP A;  2QQR A;  1PQF A;  3GTK A;  4KOD A;  5D6X A;  3IR6 A;  1PT1 A;  3HKZ A;  4GA5 A;  2KI8 A;  2JIQ A;  5C1B A;  3FPR A;  1Y1W A;  3BQB A;  1AW8 B;  3GTP A;  2Q1D X;  5EQJ B;  1S3S A;  2V3V A;  1AA6 A;  2Q19 X;  1PPY A;  4AZD A;  1R9T A;  3QQ7 A;  3GTG A;  2MM0 A;  1PQE A;  4ARC A;  1PYQ A;  1ZYR D;  4GA6 A;  2VPY A;  4CRY G;  5B6C A;  5D6Y A;  2VPW A;  2O5J D;  2PNW A;  2E2I A;  1OA9 A;  1QDN A;  2YUJ A;  5GLX A;  3X2O A;  1UHE A;  4AAY A;  1BW4 A;  1ZC1 A;  2XDP A;  4CS0 A;  3IR7 A;  1TWH A;  4FIB A;  1EU1 A;  3FKI A;  1YLE A;  3ML1 A;  2LW6 A;  4C2M A;  5CD1 A;  5FTK A;  1FDI A;  3M3G A;  3O5A A;  2EEO B;  1I50 A;  2JV2 A;  4AYB A;  2CW0 D;  4KDL A;  2IV2 X;  1SIW A;  3CZB A;  1IW7 D;  4KDI A;  2E7Z A;  3GTM A;  3ZJT A;  2HCZ X;  4AVR A;  3IR5 A;  3SUL A;  4FFT A;  1DMR A;  4JJO A;  3X2N A;  4D7Z B;  4ENG A;  2NVX A;  2GFA A;  4L48 A;  3PLX B;  1WLF A;  4AOK B;  1CR5 A;  2GAE A;  2KQA A;  4AS1 A;  4KO8 A;  2YU9 A;  3ZJU A;  2A69 D;  1UHD A;  2JIP A;  3HU2 A;  4AQ7 A;  2G5D A;  2WB1 A;  1HD5 A;  2NAP A;  2Y0S A;  2BE5 D;  3HU1 A;  4FG2 A;  5CCB A;  2JA5 A;  1Y4Z A;  5T5M D;  2GF7 A;  4JP6 A;  4RV0 A;  4ZM7 A;  1TWA A;  1CZ5 A;  1KQF A;  2Q18 X;  1KQG A;  4KLN A;  1FDO A;  5DYG A;  2VUM A;  2R7Z A;  2PI8 A;  3QWZ A;  1CZ4 A;  2PJJ A;  4ARI A;  4JS7 A;  3X2G A;  2VPZ A;  4UC4 A;  3X2J A;  2C45 A;  1DMS A;  3LGA A;  3X2P A;  2B25 A;  2Q1A X;  1H5N A;  1SFO A;  2AE0 X;  1L8F A;  2MM2 A;  2A68 D;  2R93 A;  1PQH A;  1O54 A;  3FPU A;  1E5V A;  3CQZ A;  3X2M A;  2B63 A;  3SUJ A;  5GM9 A;  1I3Q A;  3GTJ A;  1R7R A;  3X2H A; 
#chains in the Genus database with same CATH homology
 1TMO A;  1E18 A;  1Q16 A;  3H0G A;  2QQS A;  1Y1V A;  2JA7 A;  1I9G A;  2VPX A;  1H0H A;  1G8J A;  1TWG A;  5CCX A;  3GTQ A;  2A6H D;  2PWY A;  2R92 A;  1PT0 A;  1OGY A;  3MB5 A;  1QCS A;  3CF2 A;  2G6G A;  2JIR A;  2E2H A;  1R27 A;  2PMZ A;  3QC8 A;  5FTJ A;  2KY9 A;  3ZJV A;  1PYU B;  1E61 A;  3TIW A;  3OUG A;  3GTL A;  2DMR A;  5D6W A;  1TWC A;  4CQN A;  2YVL A;  1K83 A;  3LHD A;  1TWF A;  1YNJ D;  1Y5I A;  5GLF A;  1G8K A;  3TM7 B;  1E32 A;  3HU3 A;  5FTN A;  2PJH B;  4CRZ A;  1YNN D;  2PIC A;  1VC3 B;  2JIO A;  2JIM A;  5T5I D;  2V45 A;  2WAQ A;  5FTM A;  4DMR A;  2Q1C X;  1SMY D;  5ERG B;  4AON B;  5FTL A;  3QQ8 A;  5C18 A;  1WCM A;  3ZGZ A;  3GTO A;  1E60 A;  5DYI A;  2JA6 A;  4NOH A;  3FPT A;  2NYA A;  2A6E D;  3DMR A;  2NVY A;  4QIW A;  5EPP A;  2QQR A;  1PQF A;  3GTK A;  4KOD A;  5D6X A;  3IR6 A;  1PT1 A;  3HKZ A;  4GA5 A;  2KI8 A;  2JIQ A;  5C1B A;  3FPR A;  1Y1W A;  3BQB A;  1AW8 B;  3GTP A;  2Q1D X;  5EQJ B;  1S3S A;  2V3V A;  1AA6 A;  2Q19 X;  1PPY A;  4AZD A;  1R9T A;  3QQ7 A;  3GTG A;  2MM0 A;  1PQE A;  4ARC A;  1PYQ A;  1ZYR D;  4GA6 A;  2VPY A;  4CRY G;  5B6C A;  5D6Y A;  2VPW A;  2O5J D;  2PNW A;  2E2I A;  1QDN A;  2YUJ A;  1UHE A;  4AAY A;  2XDP A;  1ZC1 A;  4FIB A;  4CS0 A;  3IR7 A;  1TWH A;  1EU1 A;  3FKI A;  1YLE A;  3ML1 A;  2LW6 A;  4C2M A;  5CD1 A;  5FTK A;  1FDI A;  3O5A A;  2EEO B;  1I50 A;  2JV2 A;  4AYB A;  2CW0 D;  4KDL A;  2IV2 X;  1SIW A;  3CZB A;  1IW7 D;  4KDI A;  2E7Z A;  3GTM A;  3ZJT A;  3IR5 A;  2NVX A;  1DMR A;  4D7Z B;  2GFA A;  3PLX B;  1WLF A;  4AOK B;  1CR5 A;  2GAE A;  4AS1 A;  4KO8 A;  2YU9 A;  3ZJU A;  2A69 D;  1UHD A;  2JIP A;  3HU2 A;  4AQ7 A;  2G5D A;  2WB1 A;  2NAP A;  2Y0S A;  2BE5 D;  3HU1 A;  5CCB A;  2JA5 A;  1Y4Z A;  5T5M D;  2GF7 A;  4RV0 A;  1CZ5 A;  2Q18 X;  1TWA A;  1KQF A;  1KQG A;  4KLN A;  1FDO A;  5DYG A;  2VUM A;  2R7Z A;  2PI8 A;  3QWZ A;  1CZ4 A;  2PJJ A;  4ARI A;  2VPZ A;  4UC4 A;  2C45 A;  1DMS A;  3LGA A;  2B25 A;  2Q1A X;  1H5N A;  1SFO A;  2AE0 X;  2MM2 A;  2A68 D;  2R93 A;  1PQH A;  1O54 A;  3FPU A;  1E5V A;  3CQZ A;  2B63 A;  1I3Q A;  3GTJ A;  1R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...