2YUJA

Solution structure of human ubiquitin fusion degradation protein 1 homolog ufd1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
190
structure length
190
Chain Sequence
GSSGSSGIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin fusion degradation 1-like
publication title Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1
rcsb
source organism Homo sapiens
total genus 25
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2yujA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2yujA02
5FTJA 3QWZA 5DYIA 2PJHB 5EPPA 5FTKA 1CZ4A 3QQ8A 3QC8A 3HU2A 3HU1A 1ZC1A 3QQ7A 5B6CA 5FTLA 2JV2A 1R7RA 4KDLA 1QDNA 3CF2A 3HU3A 5GLFA 1E32A 4RV0A 4KLNA 5FTMA 5C1BA 1S3SA 2YUJA 5C18A 4KO8A 5DYGA 1WLFA 3TIWA 1CZ5A 5FTNA 4KODA 1CR5A 1QCSA 4KDIA
chains in the Genus database with same CATH superfamily
2V45A 2Q1DX 1SMYD 1EU1A 2A6HD 2E7ZA 1UHDA 1Q16A 5H4UA 3TM7B 4QIWA 4AVRA 2KQAA 3MB5A 2NAPA 1PPYA 3M3GA 3IR5A 2DMRA 3HU2A 1PQEA 1E61A 2MM2A 5GM9A 4AYBA 2E2IA 2IV2X 1L8FA 5CCBA 2HCZX 3GTJA 4ZM7A 3IR7A 2JV2A 4KDLA 2PI8A 3CF2A 3HU3A 3X2JA 1I9GA 4ENGA 1E5VA 5C1BA 2YU9A 1S3SA 1OA7A 5ERGB 4KO8A 4GA5A 1KQFA 1H5NA 5FTNA 2AE0X 2G6GA 4KODA 1PQHA 1TMOA 2BE5D 4JS7A 1K83A 1OA9A 4AAYA 1CR5A 2VPZA 5DYGA 1TWAA 3CZBA 4JCWA 1E18A 5GLYA 2PWYA 3GTQA 3X2GA 1Y1WA 2V3VA 1TWFA 1WCMA 5D6YA 4CQNA 2R93A 5EPPA 1CZ4A 2Q18X 2B25A 3FPRA 3X2OA 2A68D 3O5AA 2GFAA 1PT1A 2QQRA 2YVLA 3QQ7A 3X2HA 2JIPA 2Q1CX 2JIOA 1R7RA 2R92A 1UHEA 1ZYRD 5GLFA 4L48A 3GTPA 4GA6A 4JP6A 1FDIA 1PQFA 1PYUB 4AONB 2GF7A 2JIRA 1HD5A 1YNJD 3ENGA 2VUMA 1WLFA 3D30A 3TIWA 1SFOA 2R7ZA 2JA7A 5EQJB 1G8JA 3X2PA 2KY9A 3ZJTA 5T5MD 1PT0A 3LGAA 2WB1A 2O5JD 2NVXA 1I50A 1Y4ZA 1QCSA 1SIWA 2A6ED 3IR6A 5T5ID 1FDOA 1YNND 2VPXA 1YLEA 4ARIA 1G8KA 2PMZA 1TWCA 4JJOA 5CCXA 4AS1A 2PJJA 1VC3B 3X2KA 3QQ8A 3OUGA 2VPWA 2JIMA 3HKZA 1PYQA 4NOHA 3SULA 4AQ7A 1IW7D 2EEOB 5B6CA 3DMRA 1AA6A 3LHDA 5FTLA 4UC4A 4CS0A 5D6XA 4CRZA 4AZDA 1QDNA 3FKIA 4D7ZB 5FTMA 4KLNA 3SUMA 2Q1AX 2YUJA 1TWHA 3GTOA 4ARCA 1R9TA 4FIBA 2PNWA 3X2IA 2Q19X 1CZ5A 3FPTA 2NYAA 3H0GA 3X2MA 2BH0A 3FPUA 3X2LA 1TWGA 4FG2A 1KQGA 5CD1A 4AOKB 3ZJUA 3GTKA 1DMSA 4KDIA 3QWZA 5FTJA 5DYIA 1H0HA 3SUKA 4FERA 5GLXA 2PJHB 4JP7A 2XDPA 5D6WA 2C45A 5FTKA 1BW4A 3QC8A 2GAEA 2PICA 2WAQA 3HU1A 1ZC1A 2LW6A 4FG4A 2MM0A 1DMRA 1WC2A 3SUJA 3GTLA 3ZJVA 1I3QA 2JA5A 3CQZA 2VPYA 1O54A 2A69D 2KI8A 2QQSA 1E32A 4RV0A 4FFTA 3ZGZA 4CRYG 1AW8B 1Y5IA 2CW0D 3PLXB 1N10A 1Y1VA 5C18A 2B63A 3ML1A 1R27A 1E60A 4C2MA 3BQBA 2NVYA 2JA6A 2G5DA 2JIQA 3GTGA 1BW3A 1OGYA 2ENGA 3GTMA 2Y0SA 3X2NA 2E2HA 4DMRA
chains in the Genus database with same CATH topology
2V45A 2Q1DX 1SMYD 1EU1A 2A6HD 2E7ZA 1UHDA 1Q16A 3TM7B 4QIWA 3MB5A 2NAPA 1PPYA 3IR5A 2DMRA 3HU2A 1PQEA 1E61A 2MM2A 4AYBA 2E2IA 2IV2X 5CCBA 3GTJA 2JV2A 3IR7A 4KDLA 2PI8A 3CF2A 3HU3A 1I9GA 1E5VA 5C1BA 2YU9A 1S3SA 5ERGB 4KO8A 4GA5A 1KQFA 1H5NA 5FTNA 2AE0X 2G6GA 4KODA 1PQHA 1TMOA 2BE5D 1K83A 4AAYA 1CR5A 2VPZA 5DYGA 1TWAA 3CZBA 2PWYA 1E18A 3GTQA 1Y1WA 2V3VA 1TWFA 1WCMA 5D6YA 4CQNA 2R93A 5EPPA 1CZ4A 2Q18X 2B25A 3FPRA 2A68D 3O5AA 2GFAA 1PT1A 2QQRA 2YVLA 3QQ7A 2JIPA 2Q1CX 2JIOA 1R7RA 2R92A 1UHEA 1ZYRD 5GLFA 3GTPA 4GA6A 1FDIA 1PQFA 1PYUB 4AONB 2GF7A 2JIRA 1YNJD 2R7ZA 2VUMA 1WLFA 3TIWA 1SFOA 2JA7A 5EQJB 1G8JA 2KY9A 3ZJTA 5T5MD 1PT0A 3LGAA 2WB1A 2O5JD 2NVXA 1I50A 1Y4ZA 1QCSA 1SIWA 2A6ED 3IR6A 5T5ID 1FDOA 1YNND 2VPXA 1YLEA 4ARIA 1G8KA 2PMZA 1TWCA 5CCXA 4AS1A 2PJJA 1VC3B 3QQ8A 3OUGA 2VPWA 2JIMA 3HKZA 1PYQA 4NOHA 4AQ7A 1IW7D 2EEOB 5B6CA 3DMRA 1AA6A 3LHDA 5FTLA 4UC4A 4CS0A 5D6XA 4CRZA 4AZDA 1QDNA 3FKIA 4D7ZB 5FTMA 4KLNA 2Q1AX 2YUJA 1TWHA 3GTOA 4ARCA 1R9TA 4FIBA 2PNWA 2Q19X 1CZ5A 3FPTA 2NYAA 3H0GA 3FPUA 1TWGA 1KQGA 5CD1A 4AOKB 3ZJUA 3GTKA 1DMSA 4KDIA 3QWZA 5FTJA 5DYIA 1H0HA 2PJHB 5D6WA 2XDPA 2C45A 5FTKA 3QC8A 2GAEA 2PICA 2WAQA 3HU1A 1ZC1A 2LW6A 2MM0A 1DMRA 3ZJVA 3GTLA 1I3QA 2JA5A 3CQZA 2VPYA 1O54A 2A69D 2KI8A 2QQSA 1E32A 4RV0A 3ZGZA 4CRYG 1AW8B 1Y5IA 2CW0D 3PLXB 1Y1VA 5C18A 2B63A 3ML1A 1R27A 1E60A 4C2MA 3BQBA 2NVYA 2JA6A 2G5DA 2JIQA 3GTGA 1OGYA 3GTMA 2Y0SA 2E2HA 4DMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTJ A;  3QWZ A;  5DYI A;  2PJH B;  5EPP A;  5FTK A;  1CZ4 A;  3QQ8 A;  3QC8 A;  3HU2 A;  3HU1 A;  1ZC1 A;  3QQ7 A;  5B6C A;  5FTL A;  2JV2 A;  1R7R A;  4KDL A;  1QDN A;  3CF2 A;  3HU3 A;  5GLF A;  1E32 A;  4RV0 A;  4KLN A;  5FTM A;  5C1B A;  1S3S A;  2YUJ A;  5C18 A;  4KO8 A;  5DYG A;  1WLF A;  3TIW A;  1CZ5 A;  5FTN A;  4KOD A;  1CR5 A;  1QCS A;  4KDI A; 
#chains in the Genus database with same CATH topology
 2V45 A;  2Q1D X;  1SMY D;  1EU1 A;  2A6H D;  2E7Z A;  1UHD A;  1Q16 A;  5H4U A;  3TM7 B;  4QIW A;  4AVR A;  2KQA A;  3MB5 A;  2NAP A;  1PPY A;  3M3G A;  3IR5 A;  2DMR A;  3HU2 A;  1PQE A;  1E61 A;  2MM2 A;  5GM9 A;  4AYB A;  2E2I A;  2IV2 X;  1L8F A;  5CCB A;  2HCZ X;  3GTJ A;  4ZM7 A;  3IR7 A;  2JV2 A;  4KDL A;  2PI8 A;  3CF2 A;  3HU3 A;  3X2J A;  1I9G A;  4ENG A;  1E5V A;  5C1B A;  2YU9 A;  1S3S A;  1OA7 A;  5ERG B;  4KO8 A;  4GA5 A;  1KQF A;  1H5N A;  5FTN A;  2AE0 X;  2G6G A;  4KOD A;  1PQH A;  1TMO A;  2BE5 D;  4JS7 A;  1K83 A;  1OA9 A;  4AAY A;  1CR5 A;  2VPZ A;  5DYG A;  1TWA A;  3CZB A;  4JCW A;  1E18 A;  5GLY A;  2PWY A;  3GTQ A;  3X2G A;  1Y1W A;  2V3V A;  1TWF A;  1WCM A;  5D6Y A;  4CQN A;  2R93 A;  5EPP A;  1CZ4 A;  2Q18 X;  2B25 A;  3FPR A;  3X2O A;  2A68 D;  3O5A A;  2GFA A;  1PT1 A;  2QQR A;  2YVL A;  3QQ7 A;  3X2H A;  2JIP A;  2Q1C X;  2JIO A;  1R7R A;  2R92 A;  1UHE A;  1ZYR D;  5GLF A;  4L48 A;  3GTP A;  4GA6 A;  4JP6 A;  1FDI A;  1PQF A;  1PYU B;  4AON B;  2GF7 A;  2JIR A;  1HD5 A;  1YNJ D;  3ENG A;  2VUM A;  1WLF A;  3D30 A;  3TIW A;  1SFO A;  2R7Z A;  2JA7 A;  5EQJ B;  1G8J A;  3X2P A;  2KY9 A;  3ZJT A;  5T5M D;  1PT0 A;  3LGA A;  2WB1 A;  2O5J D;  2NVX A;  1I50 A;  1Y4Z A;  1QCS A;  1SIW A;  2A6E D;  3IR6 A;  5T5I D;  1FDO A;  1YNN D;  2VPX A;  1YLE A;  4ARI A;  1G8K A;  2PMZ A;  1TWC A;  4JJO A;  5CCX A;  4AS1 A;  2PJJ A;  1VC3 B;  3X2K A;  3QQ8 A;  3OUG A;  2VPW A;  2JIM A;  3HKZ A;  1PYQ A;  4NOH A;  3SUL A;  4AQ7 A;  1IW7 D;  2EEO B;  5B6C A;  3DMR A;  1AA6 A;  3LHD A;  5FTL A;  4UC4 A;  4CS0 A;  5D6X A;  4CRZ A;  4AZD A;  1QDN A;  3FKI A;  4D7Z B;  5FTM A;  4KLN A;  3SUM A;  2Q1A X;  2YUJ A;  1TWH A;  3GTO A;  4ARC A;  1R9T A;  4FIB A;  2PNW A;  3X2I A;  2Q19 X;  1CZ5 A;  3FPT A;  2NYA A;  3H0G A;  3X2M A;  2BH0 A;  3FPU A;  3X2L A;  1TWG A;  4FG2 A;  1KQG A;  5CD1 A;  4AOK B;  3ZJU A;  3GTK A;  1DMS A;  4KDI A;  3QWZ A;  5FTJ A;  5DYI A;  1H0H A;  3SUK A;  4FER A;  5GLX A;  2PJH B;  4JP7 A;  2XDP A;  5D6W A;  2C45 A;  5FTK A;  1BW4 A;  3QC8 A;  2GAE A;  2PIC A;  2WAQ A;  3HU1 A;  1ZC1 A;  2LW6 A;  4FG4 A;  2MM0 A;  1DMR A;  1WC2 A;  3SUJ A;  3GTL A;  3ZJV A;  1I3Q A;  2JA5 A;  3CQZ A;  2VPY A;  1O54 A;  2A69 D;  2KI8 A;  2QQS A;  1E32 A;  4RV0 A;  4FFT A;  3ZGZ A;  4CRY G;  1AW8 B;  1Y5I A;  2CW0 D;  3PLX B;  1N10 A;  1Y1V A;  5C18 A;  2B63 A;  3ML1 A;  1R27 A;  1E60 A;  4C2M A;  3BQB A;  2NVY A;  2JA6 A;  2G5D A;  2JIQ A;  3GTG A;  1BW3 A;  1OGY A;  2ENG A;  3GTM A;  2Y0S A;  3X2N A;  2E2H A;  4DMR A; 
#chains in the Genus database with same CATH homology
 2V45 A;  2Q1D X;  1SMY D;  1EU1 A;  2A6H D;  2E7Z A;  1UHD A;  1Q16 A;  3TM7 B;  4QIW A;  3MB5 A;  2NAP A;  1PPY A;  3IR5 A;  2DMR A;  3HU2 A;  1PQE A;  1E61 A;  2MM2 A;  4AYB A;  2E2I A;  2IV2 X;  5CCB A;  3GTJ A;  2JV2 A;  3IR7 A;  4KDL A;  2PI8 A;  3CF2 A;  3HU3 A;  1I9G A;  1E5V A;  5C1B A;  2YU9 A;  1S3S A;  5ERG B;  4KO8 A;  4GA5 A;  1KQF A;  1H5N A;  5FTN A;  2AE0 X;  2G6G A;  4KOD A;  1PQH A;  1TMO A;  2BE5 D;  1K83 A;  4AAY A;  1CR5 A;  2VPZ A;  5DYG A;  1TWA A;  3CZB A;  2PWY A;  1E18 A;  3GTQ A;  1Y1W A;  2V3V A;  1TWF A;  1WCM A;  5D6Y A;  4CQN A;  2R93 A;  5EPP A;  1CZ4 A;  2Q18 X;  2B25 A;  3FPR A;  2A68 D;  3O5A A;  2GFA A;  1PT1 A;  2QQR A;  2YVL A;  3QQ7 A;  2JIP A;  2Q1C X;  2JIO A;  1R7R A;  2R92 A;  1UHE A;  1ZYR D;  5GLF A;  3GTP A;  4GA6 A;  1FDI A;  1PQF A;  1PYU B;  4AON B;  2GF7 A;  2JIR A;  1YNJ D;  2R7Z A;  2VUM A;  1WLF A;  3TIW A;  1SFO A;  2JA7 A;  5EQJ B;  1G8J A;  2KY9 A;  3ZJT A;  5T5M D;  1PT0 A;  3LGA A;  2WB1 A;  2O5J D;  2NVX A;  1I50 A;  1Y4Z A;  1QCS A;  1SIW A;  2A6E D;  3IR6 A;  5T5I D;  1FDO A;  1YNN D;  2VPX A;  1YLE A;  4ARI A;  1G8K A;  2PMZ A;  1TWC A;  5CCX A;  4AS1 A;  2PJJ A;  1VC3 B;  3QQ8 A;  3OUG A;  2VPW A;  2JIM A;  3HKZ A;  1PYQ A;  4NOH A;  4AQ7 A;  1IW7 D;  2EEO B;  5B6C A;  3DMR A;  1AA6 A;  3LHD A;  5FTL A;  4UC4 A;  4CS0 A;  5D6X A;  4CRZ A;  4AZD A;  1QDN A;  3FKI A;  4D7Z B;  5FTM A;  4KLN A;  2Q1A X;  2YUJ A;  1TWH A;  3GTO A;  4ARC A;  1R9T A;  4FIB A;  2PNW A;  2Q19 X;  1CZ5 A;  3FPT A;  2NYA A;  3H0G A;  3FPU A;  1TWG A;  1KQG A;  5CD1 A;  4AOK B;  3ZJU A;  3GTK A;  1DMS A;  4KDI A;  3QWZ A;  5FTJ A;  5DYI A;  1H0H A;  2PJH B;  5D6W A;  2XDP A;  2C45 A;  5FTK A;  3QC8 A;  2GAE A;  2PIC A;  2WAQ A;  3HU1 A;  1ZC1 A;  2LW6 A;  2MM0 A;  1DMR A;  3ZJV A;  3GTL A;  1I3Q A;  2JA5 A;  3CQZ A;  2VPY A;  1O54 A;  2A69 D;  2KI8 A;  2QQS A;  1E32 A;  4RV0 A;  3ZGZ A;  4CRY G;  1AW8 B;  1Y5I A;  2CW0 D;  3PLX B;  1Y1V A;  5C18 A;  2B63 A;  3ML1 A;  1R27 A;  1E60 A;  4C2M A;  3BQB A;  2NVY A;  2JA6 A;  2G5D A;  2JIQ A;  3GTG A;  1OGY A;  3GTM A;  2Y0S A;  2E2H A;  4DMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...