2YUJA

Solution structure of human ubiquitin fusion degradation protein 1 homolog ufd1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
190
structure length
190
Chain Sequence
GSSGSSGIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin fusion degradation 1-like
publication title Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2yujA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2yujA02
5C18A 1CZ5A 5FTNA 4KDLA 1QCSA 3CF2A 4KO8A 1ZC1A 5FTMA 5DYGA 2YUJA 3QWZA 5DYIA 5C1BA 4RV0A 2JV2A 4KDIA 1WLFA 1E32A 3HU2A 5FTLA 1S3SA 4KLNA 1CZ4A 3HU3A 5FTKA 3QQ8A 3QQ7A 5GLFA 3TIWA 5EPPA 1CR5A 3QC8A 1R7RA 2PJHB 5B6CA 5FTJA 1QDNA 4KODA 3HU1A
chains in the Genus database with same CATH superfamily
5C18A 1N10A 5D6XA 3ZJTA 4JCWA 1ZYRD 1OGYA 1QCSA 2NYAA 4AYBA 2HCZX 4KO8A 3PLXB 3X2JA 3X2GA 1KQGA 1TMOA 4JP6A 4GA6A 3FPUA 3ZJVA 2QQSA 1SMYD 1TWGA 5C1BA 5ERGB 1PQFA 1AW8B 1VC3B 1Y5IA 3IR5A 1L8FA 2Q1CX 3ZGZA 2PMZA 2JIOA 3HU2A 5GM9A 2E7ZA 1S3SA 2A6HD 4FFTA 5H4UA 1G8JA 3X2NA 5FTLA 1TWFA 4GA5A 2E2IA 3LHDA 2A69D 3HU3A 4ARCA 2WB1A 4FERA 3QQ8A 5FTKA 3TIWA 1FDOA 2YU9A 3ML1A 2VPZA 1BW3A 1DMRA 2PJHB 2IV2X 2B25A 4CRYG 1BW4A 4KODA 3GTPA 2JIRA 3TM7B 4ENGA 2A68D 2R7ZA 5FTNA 4CRZA 2KY9A 2MM0A 4UC4A 3M3GA 2JA5A 5GLYA 2NAPA 1IW7D 4JS7A 4CS0A 5CCXA 3D30A 2PNWA 1KQFA 2Q1DX 2BH0A 3GTOA 2KI8A 2DMRA 5DYIA 4QIWA 2JIMA 3ENGA 1PT0A 1WLFA 2R93A 3FPTA 3GTGA 1DMSA 1E32A 1Y1WA 3X2PA 4KLNA 2QQRA 3GTQA 5CD1A 5GLXA 3SULA 2GFAA 2C45A 2PI8A 4DMRA 4CQNA 4JP7A 3SUJA 5GLFA 3QQ7A 3H0GA 1I3QA 5D6YA 3O5AA 3ZJUA 1EU1A 1AA6A 3CQZA 1G8KA 2G5DA 5EPPA 1CR5A 3SUMA 3X2IA 4FG2A 2V3VA 2JA6A 2E2HA 5B6CA 3GTKA 1E60A 1E61A 2NVYA 1QDNA 2GAEA 1CZ5A 3CF2A 2Q19X 1Y4ZA 3X2OA 1E18A 1ZC1A 3DMRA 3IR6A 2JIQA 1SFOA 2VUMA 2R92A 1OA9A 2NVXA 3QWZA 5EQJB 1PPYA 4AZDA 4RV0A 4C2MA 1H5NA 2JV2A 4ARIA 2VPWA 3CZBA 1OA7A 3SUKA 1HD5A 4D7ZB 1CZ4A 4AQ7A 2VPYA 4FG4A 5D6WA 3X2KA 4NOHA 2WAQA 3GTJA 1O54A 2V45A 4JJOA 5T5ID 1FDIA 2MM2A 1R27A 3QC8A 2GF7A 1R7RA 1WC2A 1TWAA 1YNND 3X2MA 3IR7A 5FTJA 3LGAA 4AOKB 3HU1A 4L48A 4KDLA 2A6ED 1PQEA 1PT1A 2LW6A 2BE5D 2YVLA 3HKZA 1Y1VA 4ZM7A 2AE0X 3OUGA 5FTMA 5DYGA 2YUJA 1TWCA 2Q1AX 4KDIA 3GTLA 1YLEA 1PQHA 3BQBA 1K83A 4AONB 2JA7A 3GTMA 3MB5A 2VPXA 1R9TA 2B63A 1I9GA 4AS1A 1YNJD 2O5JD 5T5MD 1SIWA 1WCMA 2JIPA 4AAYA 2XDPA 2Y0SA 2PJJA 2KQAA 2PICA 1PYUB 3X2LA 3FPRA 2PWYA 1UHEA 3X2HA 1PYQA 1UHDA 1E5VA 2EEOB 4AVRA 1H0HA 1Q16A 4FIBA 1I50A 3FKIA 2CW0D 1TWHA 2G6GA 2ENGA 5CCBA 2Q18X
chains in the Genus database with same CATH topology
5C18A 5D6XA 3ZJTA 1ZYRD 1OGYA 1QCSA 2NYAA 4AYBA 4KO8A 3PLXB 1KQGA 3FPUA 1TMOA 3ZJVA 4GA6A 2QQSA 1SMYD 1TWGA 5C1BA 5ERGB 1PQFA 1AW8B 1VC3B 1Y5IA 3IR5A 2Q1CX 3ZGZA 2PMZA 2JIOA 3HU2A 5FTLA 2E7ZA 1S3SA 2A6HD 2E2IA 4ARCA 1G8JA 1TWFA 4GA5A 3LHDA 2A69D 3HU3A 2WB1A 5FTKA 3QQ8A 3TIWA 1FDOA 2YU9A 3ML1A 2VPZA 1DMRA 2PJHB 2IV2X 2B25A 4CRYG 4KODA 3GTPA 2JIRA 3TM7B 2R7ZA 2A68D 5FTNA 4CRZA 2KY9A 2MM0A 4UC4A 2JA5A 2NAPA 1IW7D 4CS0A 5CCXA 2PNWA 1KQFA 2Q1DX 3GTOA 2KI8A 2DMRA 5DYIA 4QIWA 2JIMA 2R93A 1PT0A 1WLFA 3FPTA 3GTGA 1DMSA 1E32A 1Y1WA 4KLNA 2QQRA 3GTQA 5CD1A 2GFAA 2C45A 2PI8A 4DMRA 4CQNA 5D6YA 5GLFA 3QQ7A 3H0GA 1I3QA 3O5AA 3ZJUA 1EU1A 1AA6A 3CQZA 1G8KA 2G5DA 5EPPA 1CR5A 2V3VA 2JA6A 2E2HA 5B6CA 3GTKA 1E60A 1E61A 2NVYA 1QDNA 2GAEA 1CZ5A 3CF2A 2Q19X 1Y4ZA 1E18A 1ZC1A 3DMRA 3IR6A 2JIQA 1SFOA 2VUMA 2R92A 2NVXA 3QWZA 5EQJB 1PPYA 4AZDA 4RV0A 4C2MA 1H5NA 2JV2A 4ARIA 2VPWA 3CZBA 4D7ZB 4AQ7A 1CZ4A 2VPYA 5D6WA 4NOHA 2WAQA 3GTJA 1O54A 2V45A 5T5ID 1FDIA 2MM2A 1R27A 3QC8A 2GF7A 1R7RA 1TWAA 1YNND 3IR7A 5FTJA 3LGAA 4AOKB 3HU1A 4KDLA 2A6ED 1PQEA 1PT1A 2LW6A 2BE5D 2YVLA 3HKZA 1Y1VA 2AE0X 3OUGA 5FTMA 5DYGA 2YUJA 1TWCA 2Q1AX 4KDIA 3GTLA 1YLEA 1PQHA 3BQBA 1K83A 4AONB 2JA7A 3GTMA 3MB5A 2VPXA 1R9TA 2B63A 1I9GA 4AS1A 1YNJD 2O5JD 5T5MD 1SIWA 1WCMA 2JIPA 4AAYA 2XDPA 2Y0SA 2PJJA 2PICA 1PYUB 3FPRA 2PWYA 1UHEA 1PYQA 1UHDA 1E5VA 2EEOB 1H0HA 1Q16A 4FIBA 1I50A 3FKIA 2CW0D 1TWHA 2G6GA 5CCBA 2Q18X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C18 A;  1CZ5 A;  5FTN A;  4KDL A;  1QCS A;  3CF2 A;  4KO8 A;  1ZC1 A;  5FTM A;  5DYG A;  2YUJ A;  3QWZ A;  5DYI A;  5C1B A;  4RV0 A;  2JV2 A;  4KDI A;  1WLF A;  1E32 A;  3HU2 A;  5FTL A;  1S3S A;  4KLN A;  1CZ4 A;  3HU3 A;  5FTK A;  3QQ8 A;  3QQ7 A;  5GLF A;  3TIW A;  5EPP A;  1CR5 A;  3QC8 A;  1R7R A;  2PJH B;  5B6C A;  5FTJ A;  1QDN A;  4KOD A;  3HU1 A; 
#chains in the Genus database with same CATH topology
 5C18 A;  1N10 A;  5D6X A;  3ZJT A;  4JCW A;  1ZYR D;  1OGY A;  1QCS A;  2NYA A;  4AYB A;  2HCZ X;  4KO8 A;  3PLX B;  3X2J A;  3X2G A;  1KQG A;  1TMO A;  4JP6 A;  4GA6 A;  3FPU A;  3ZJV A;  2QQS A;  1SMY D;  1TWG A;  5C1B A;  5ERG B;  1PQF A;  1AW8 B;  1VC3 B;  1Y5I A;  3IR5 A;  1L8F A;  2Q1C X;  3ZGZ A;  2PMZ A;  2JIO A;  3HU2 A;  5GM9 A;  2E7Z A;  1S3S A;  2A6H D;  4FFT A;  5H4U A;  1G8J A;  3X2N A;  5FTL A;  1TWF A;  4GA5 A;  2E2I A;  3LHD A;  2A69 D;  3HU3 A;  4ARC A;  2WB1 A;  4FER A;  3QQ8 A;  5FTK A;  3TIW A;  1FDO A;  2YU9 A;  3ML1 A;  2VPZ A;  1BW3 A;  1DMR A;  2PJH B;  2IV2 X;  2B25 A;  4CRY G;  1BW4 A;  4KOD A;  3GTP A;  2JIR A;  3TM7 B;  4ENG A;  2A68 D;  2R7Z A;  5FTN A;  4CRZ A;  2KY9 A;  2MM0 A;  4UC4 A;  3M3G A;  2JA5 A;  5GLY A;  2NAP A;  1IW7 D;  4JS7 A;  4CS0 A;  5CCX A;  3D30 A;  2PNW A;  1KQF A;  2Q1D X;  2BH0 A;  3GTO A;  2KI8 A;  2DMR A;  5DYI A;  4QIW A;  2JIM A;  3ENG A;  1PT0 A;  1WLF A;  2R93 A;  3FPT A;  3GTG A;  1DMS A;  1E32 A;  1Y1W A;  3X2P A;  4KLN A;  2QQR A;  3GTQ A;  5CD1 A;  5GLX A;  3SUL A;  2GFA A;  2C45 A;  2PI8 A;  4DMR A;  4CQN A;  4JP7 A;  3SUJ A;  5GLF A;  3QQ7 A;  3H0G A;  1I3Q A;  5D6Y A;  3O5A A;  3ZJU A;  1EU1 A;  1AA6 A;  3CQZ A;  1G8K A;  2G5D A;  5EPP A;  1CR5 A;  3SUM A;  3X2I A;  4FG2 A;  2V3V A;  2JA6 A;  2E2H A;  5B6C A;  3GTK A;  1E60 A;  1E61 A;  2NVY A;  1QDN A;  2GAE A;  1CZ5 A;  3CF2 A;  2Q19 X;  1Y4Z A;  3X2O A;  1E18 A;  1ZC1 A;  3DMR A;  3IR6 A;  2JIQ A;  1SFO A;  2VUM A;  2R92 A;  1OA9 A;  2NVX A;  3QWZ A;  5EQJ B;  1PPY A;  4AZD A;  4RV0 A;  4C2M A;  1H5N A;  2JV2 A;  4ARI A;  2VPW A;  3CZB A;  1OA7 A;  3SUK A;  1HD5 A;  4D7Z B;  1CZ4 A;  4AQ7 A;  2VPY A;  4FG4 A;  5D6W A;  3X2K A;  4NOH A;  2WAQ A;  3GTJ A;  1O54 A;  2V45 A;  4JJO A;  5T5I D;  1FDI A;  2MM2 A;  1R27 A;  3QC8 A;  2GF7 A;  1R7R A;  1WC2 A;  1TWA A;  1YNN D;  3X2M A;  3IR7 A;  5FTJ A;  3LGA A;  4AOK B;  3HU1 A;  4L48 A;  4KDL A;  2A6E D;  1PQE A;  1PT1 A;  2LW6 A;  2BE5 D;  2YVL A;  3HKZ A;  1Y1V A;  4ZM7 A;  2AE0 X;  3OUG A;  5FTM A;  5DYG A;  2YUJ A;  1TWC A;  2Q1A X;  4KDI A;  3GTL A;  1YLE A;  1PQH A;  3BQB A;  1K83 A;  4AON B;  2JA7 A;  3GTM A;  3MB5 A;  2VPX A;  1R9T A;  2B63 A;  1I9G A;  4AS1 A;  1YNJ D;  2O5J D;  5T5M D;  1SIW A;  1WCM A;  2JIP A;  4AAY A;  2XDP A;  2Y0S A;  2PJJ A;  2KQA A;  2PIC A;  1PYU B;  3X2L A;  3FPR A;  2PWY A;  1UHE A;  3X2H A;  1PYQ A;  1UHD A;  1E5V A;  2EEO B;  4AVR A;  1H0H A;  1Q16 A;  4FIB A;  1I50 A;  3FKI A;  2CW0 D;  1TWH A;  2G6G A;  2ENG A;  5CCB A;  2Q18 X; 
#chains in the Genus database with same CATH homology
 5C18 A;  5D6X A;  3ZJT A;  1ZYR D;  1OGY A;  1QCS A;  2NYA A;  4AYB A;  4KO8 A;  3PLX B;  1KQG A;  3FPU A;  1TMO A;  3ZJV A;  4GA6 A;  2QQS A;  1SMY D;  1TWG A;  5C1B A;  5ERG B;  1PQF A;  1AW8 B;  1VC3 B;  1Y5I A;  3IR5 A;  2Q1C X;  3ZGZ A;  2PMZ A;  2JIO A;  3HU2 A;  5FTL A;  2E7Z A;  1S3S A;  2A6H D;  2E2I A;  4ARC A;  1G8J A;  1TWF A;  4GA5 A;  3LHD A;  2A69 D;  3HU3 A;  2WB1 A;  5FTK A;  3QQ8 A;  3TIW A;  1FDO A;  2YU9 A;  3ML1 A;  2VPZ A;  1DMR A;  2PJH B;  2IV2 X;  2B25 A;  4CRY G;  4KOD A;  3GTP A;  2JIR A;  3TM7 B;  2R7Z A;  2A68 D;  5FTN A;  4CRZ A;  2KY9 A;  2MM0 A;  4UC4 A;  2JA5 A;  2NAP A;  1IW7 D;  4CS0 A;  5CCX A;  2PNW A;  1KQF A;  2Q1D X;  3GTO A;  2KI8 A;  2DMR A;  5DYI A;  4QIW A;  2JIM A;  2R93 A;  1PT0 A;  1WLF A;  3FPT A;  3GTG A;  1DMS A;  1E32 A;  1Y1W A;  4KLN A;  2QQR A;  3GTQ A;  5CD1 A;  2GFA A;  2C45 A;  2PI8 A;  4DMR A;  4CQN A;  5D6Y A;  5GLF A;  3QQ7 A;  3H0G A;  1I3Q A;  3O5A A;  3ZJU A;  1EU1 A;  1AA6 A;  3CQZ A;  1G8K A;  2G5D A;  5EPP A;  1CR5 A;  2V3V A;  2JA6 A;  2E2H A;  5B6C A;  3GTK A;  1E60 A;  1E61 A;  2NVY A;  1QDN A;  2GAE A;  1CZ5 A;  3CF2 A;  2Q19 X;  1Y4Z A;  1E18 A;  1ZC1 A;  3DMR A;  3IR6 A;  2JIQ A;  1SFO A;  2VUM A;  2R92 A;  2NVX A;  3QWZ A;  5EQJ B;  1PPY A;  4AZD A;  4RV0 A;  4C2M A;  1H5N A;  2JV2 A;  4ARI A;  2VPW A;  3CZB A;  4D7Z B;  4AQ7 A;  1CZ4 A;  2VPY A;  5D6W A;  4NOH A;  2WAQ A;  3GTJ A;  1O54 A;  2V45 A;  5T5I D;  1FDI A;  2MM2 A;  1R27 A;  3QC8 A;  2GF7 A;  1R7R A;  1TWA A;  1YNN D;  3IR7 A;  5FTJ A;  3LGA A;  4AOK B;  3HU1 A;  4KDL A;  2A6E D;  1PQE A;  1PT1 A;  2LW6 A;  2BE5 D;  2YVL A;  3HKZ A;  1Y1V A;  2AE0 X;  3OUG A;  5FTM A;  5DYG A;  2YUJ A;  1TWC A;  2Q1A X;  4KDI A;  3GTL A;  1YLE A;  1PQH A;  3BQB A;  1K83 A;  4AON B;  2JA7 A;  3GTM A;  3MB5 A;  2VPX A;  1R9T A;  2B63 A;  1I9G A;  4AS1 A;  1YNJ D;  2O5J D;  5T5M D;  1SIW A;  1WCM A;  2JIP A;  4AAY A;  2XDP A;  2Y0S A;  2PJJ A;  2PIC A;  1PYU B;  3FPR A;  2PWY A;  1UHE A;  1PYQ A;  1UHD A;  1E5V A;  2EEO B;  1H0H A;  1Q16 A;  4FIB A;  1I50 A;  3FKI A;  2CW0 D;  1TWH A;  2G6G A;  5CCB A;  2Q18 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...