2YUJA

Solution structure of human ubiquitin fusion degradation protein 1 homolog ufd1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
190
structure length
190
Chain Sequence
b'GSSGSSGIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin fusion degradation 1-like
publication title Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2yujA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2yujA02
5C1BA 1R7RA 2YUJA 4KDIA 1CZ4A 3QQ8A 3HU1A 5DYGA 3HU3A 5DYIA 5C18A 4KDLA 2JV2A 4KLNA 1E32A 3QQ7A 1QDNA 5B6CA 5EPPA 1WLFA 4RV0A 1ZC1A 3CF2A 3QWZA 4KO8A 5GLFA 3TIWA 4KODA 5FTLA 2PJHB 1S3SA 5FTKA 1CZ5A 1CR5A 3QC8A 5FTMA 5FTJA 5FTNA 3HU2A 1QCSA
chains in the Genus database with same CATH superfamily
1WCMA 3LHDA 4FIBA 4KDIA 1FDIA 2IV2X 2JA7A 2B25A 2Q1AX 5DYGA 3QQ8A 2R7ZA 3HU3A 1OGYA 3SUMA 2B63A 3SUKA 2G5DA 3ZJVA 5GLYA 1DMSA 3X2MA 2R93A 3X2PA 3QQ7A 3D30A 1QDNA 2JIMA 3LGAA 3CQZA 5T5MD 2G6GA 1PT0A 5EPPA 4D7ZB 4AZDA 2GAEA 1G8JA 2BH0A 4RV0A 3X2KA 2VPWA 1I3QA 3FKIA 3QWZA 4FERA 1Y4ZA 3X2OA 1UHEA 2GF7A 2Q1DX 3TIWA 2WAQA 2PJHB 1S3SA 4JJOA 1TWGA 2DMRA 2EEOB 3MB5A 2YU9A 3FPTA 5CCXA 2Q19X 2O5JD 1PQEA 2QQRA 4FG4A 5FTMA 4CQNA 5FTNA 3X2JA 2NAPA 2ENGA 3X2HA 4C2MA 2AE0X 1QCSA 5CCBA 1R7RA 2KQAA 1Y1WA 3PLXB 2XDPA 1UHDA 1CZ4A 1FDOA 1E18A 4NOHA 3X2IA 3HKZA 2PNWA 3GTPA 1SIWA 1E32A 3DMRA 3IR6A 4JCWA 1PPYA 2PI8A 4FFTA 5D6YA 5B6CA 1ZYRD 2NYAA 5CD1A 3O5AA 4AONB 3GTMA 1WLFA 1TWFA 1ZC1A 1OA7A 1O54A 4AQ7A 1E5VA 4QIWA 4UC4A 1PYUB 3IR5A 1K83A 3GTGA 2Q1CX 4AOKB 5EQJB 4KODA 3X2NA 4CRZA 3FPUA 3ZJUA 2MM0A 2KY9A 5D6WA 1OA9A 2BE5D 4JP7A 4ZM7A 5ERGB 2A69D 1E60A 1CR5A 3H0GA 1IW7D 3M3GA 5FTJA 2VPXA 2PJJA 1E61A 4CRYG 3HU2A 2NVXA 2JA6A 1H5NA 5C1BA 3ZJTA 4AVRA 1N10A 1TWAA 2A6ED 2JA5A 2C45A 5DYIA 3SUJA 3X2LA 1TWCA 3OUGA 4KDLA 2VPZA 4KLNA 1YNJD 1PYQA 1BW3A 2WB1A 4AYBA 1R27A 1Y5IA 3ML1A 2PICA 1WC2A 4FG2A 3CF2A 3ENGA 2JIRA 3ZGZA 1SFOA 2LW6A 3X2GA 1H0HA 4GA5A 5FTKA 3BQBA 4L48A 1PQHA 2YVLA 5GLXA 2Y0SA 4ARCA 2JIOA 2VUMA 2PMZA 2R92A 2NVYA 2V45A 4JS7A 3SULA 1YLEA 3TM7B 2YUJA 4ENGA 2E2HA 1YNND 3GTOA 3IR7A 1BW4A 1AW8B 4ARIA 4DMRA 1I9GA 5H4UA 1TWHA 5D6XA 1TMOA 1EU1A 1HD5A 2KI8A 2V3VA 3HU1A 2A6HD 5C18A 2QQSA 1L8FA 1KQFA 2JV2A 2PWYA 5GM9A 2HCZX 2MM2A 1DMRA 1AA6A 2JIPA 1Q16A 1R9TA 2CW0D 2A68D 1G8KA 1SMYD 1PT1A 2JIQA 4JP6A 4KO8A 4AAYA 1KQGA 5GLFA 5T5ID 1I50A 2VPYA 5FTLA 3GTJA 2E2IA 1CZ5A 3CZBA 4GA6A 3GTQA 3QC8A 2Q18X 1VC3B 1PQFA 1Y1VA 3GTLA 3FPRA 4AS1A 2GFAA 2E7ZA 4CS0A 3GTKA
chains in the Genus database with same CATH topology
1WCMA 4FIBA 4KDIA 1FDIA 2IV2X 2JA7A 2B25A 2Q1AX 5DYGA 3QQ8A 2R7ZA 3HU3A 1OGYA 2B63A 2G5DA 3ZJVA 1DMSA 2R93A 3QQ7A 3LGAA 1QDNA 2JIMA 3CQZA 5T5MD 2G6GA 1PT0A 5EPPA 4D7ZB 4AZDA 2GAEA 1G8JA 4RV0A 2VPWA 1I3QA 3FKIA 3QWZA 2Q1DX 1Y4ZA 2GF7A 1UHEA 3TIWA 2WAQA 2PJHB 1S3SA 1TWGA 2DMRA 2EEOB 3MB5A 2YU9A 3FPTA 5CCXA 2Q19X 2O5JD 1PQEA 2QQRA 5FTMA 4CQNA 5FTNA 2NAPA 4C2MA 2AE0X 1QCSA 5CCBA 1R7RA 1Y1WA 3PLXB 2XDPA 1UHDA 1CZ4A 1FDOA 1E18A 4NOHA 3HKZA 2PNWA 3GTPA 1SIWA 1E32A 3DMRA 3IR6A 1PPYA 2PI8A 5D6YA 5B6CA 1ZYRD 2NYAA 5CD1A 3O5AA 4AONB 3GTMA 1WLFA 1TWFA 1ZC1A 1O54A 4AQ7A 1E5VA 4QIWA 1PYUB 3IR5A 1K83A 3GTGA 2Q1CX 4AOKB 3ZJUA 4KODA 3FPUA 4CRZA 2MM0A 2KY9A 5D6WA 2BE5D 5ERGB 2A69D 1E60A 1CR5A 3H0GA 1IW7D 5FTJA 2VPXA 2PJJA 1E61A 4CRYG 3HU2A 2NVXA 2JA6A 1H5NA 5C1BA 3ZJTA 1TWAA 2A6ED 2JA5A 2C45A 5DYIA 1TWCA 3OUGA 4KDLA 2VPZA 4KLNA 1YNJD 1PYQA 2WB1A 4AYBA 1R27A 1Y5IA 3ML1A 2PICA 3CF2A 2JIRA 3ZGZA 1SFOA 2LW6A 1H0HA 4GA5A 5FTKA 3BQBA 1PQHA 2YVLA 4ARCA 2Y0SA 2JIOA 2VUMA 2PMZA 2R92A 2NVYA 2V45A 5EQJB 4UC4A 1YLEA 3TM7B 2YUJA 2E2HA 3LHDA 1YNND 3GTOA 3IR7A 4ARIA 1AW8B 4DMRA 1I9GA 1TWHA 5D6XA 1TMOA 1EU1A 2KI8A 3HU1A 2V3VA 5C18A 2A6HD 2QQSA 1KQFA 2JV2A 2PWYA 2MM2A 1DMRA 1AA6A 2JIPA 1Q16A 1R9TA 2CW0D 2A68D 1G8KA 1SMYD 1PT1A 2JIQA 4KO8A 4AAYA 1KQGA 5GLFA 5T5ID 1I50A 2VPYA 5FTLA 3GTJA 2E2IA 1CZ5A 3CZBA 4GA6A 3GTQA 3QC8A 2Q18X 1VC3B 1PQFA 1Y1VA 3GTLA 3FPRA 4AS1A 2GFAA 2E7ZA 4CS0A 3GTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1B A;  1R7R A;  2YUJ A;  4KDI A;  1CZ4 A;  3QQ8 A;  3HU1 A;  5DYG A;  3HU3 A;  5DYI A;  5C18 A;  4KDL A;  2JV2 A;  4KLN A;  1E32 A;  3QQ7 A;  1QDN A;  5B6C A;  5EPP A;  1WLF A;  4RV0 A;  1ZC1 A;  3CF2 A;  3QWZ A;  4KO8 A;  5GLF A;  3TIW A;  4KOD A;  5FTL A;  2PJH B;  1S3S A;  5FTK A;  1CZ5 A;  1CR5 A;  3QC8 A;  5FTM A;  5FTJ A;  5FTN A;  3HU2 A;  1QCS A; 
#chains in the Genus database with same CATH topology
 1WCM A;  3LHD A;  4FIB A;  4KDI A;  1FDI A;  2IV2 X;  2JA7 A;  2B25 A;  2Q1A X;  5DYG A;  3QQ8 A;  2R7Z A;  3HU3 A;  1OGY A;  3SUM A;  2B63 A;  3SUK A;  2G5D A;  3ZJV A;  5GLY A;  1DMS A;  3X2M A;  2R93 A;  3X2P A;  3QQ7 A;  3D30 A;  1QDN A;  2JIM A;  3LGA A;  3CQZ A;  5T5M D;  2G6G A;  1PT0 A;  5EPP A;  4D7Z B;  4AZD A;  2GAE A;  1G8J A;  2BH0 A;  4RV0 A;  3X2K A;  2VPW A;  1I3Q A;  3FKI A;  3QWZ A;  4FER A;  1Y4Z A;  3X2O A;  1UHE A;  2GF7 A;  2Q1D X;  3TIW A;  2WAQ A;  2PJH B;  1S3S A;  4JJO A;  1TWG A;  2DMR A;  2EEO B;  3MB5 A;  2YU9 A;  3FPT A;  5CCX A;  2Q19 X;  2O5J D;  1PQE A;  2QQR A;  4FG4 A;  5FTM A;  4CQN A;  5FTN A;  3X2J A;  2NAP A;  2ENG A;  3X2H A;  4C2M A;  2AE0 X;  1QCS A;  5CCB A;  1R7R A;  2KQA A;  1Y1W A;  3PLX B;  2XDP A;  1UHD A;  1CZ4 A;  1FDO A;  1E18 A;  4NOH A;  3X2I A;  3HKZ A;  2PNW A;  3GTP A;  1SIW A;  1E32 A;  3DMR A;  3IR6 A;  4JCW A;  1PPY A;  2PI8 A;  4FFT A;  5D6Y A;  5B6C A;  1ZYR D;  2NYA A;  5CD1 A;  3O5A A;  4AON B;  3GTM A;  1WLF A;  1TWF A;  1ZC1 A;  1OA7 A;  1O54 A;  4AQ7 A;  1E5V A;  4QIW A;  4UC4 A;  1PYU B;  3IR5 A;  1K83 A;  3GTG A;  2Q1C X;  4AOK B;  5EQJ B;  4KOD A;  3X2N A;  4CRZ A;  3FPU A;  3ZJU A;  2MM0 A;  2KY9 A;  5D6W A;  1OA9 A;  2BE5 D;  4JP7 A;  4ZM7 A;  5ERG B;  2A69 D;  1E60 A;  1CR5 A;  3H0G A;  1IW7 D;  3M3G A;  5FTJ A;  2VPX A;  2PJJ A;  1E61 A;  4CRY G;  3HU2 A;  2NVX A;  2JA6 A;  1H5N A;  5C1B A;  3ZJT A;  4AVR A;  1N10 A;  1TWA A;  2A6E D;  2JA5 A;  2C45 A;  5DYI A;  3SUJ A;  3X2L A;  1TWC A;  3OUG A;  4KDL A;  2VPZ A;  4KLN A;  1YNJ D;  1PYQ A;  1BW3 A;  2WB1 A;  4AYB A;  1R27 A;  1Y5I A;  3ML1 A;  2PIC A;  1WC2 A;  4FG2 A;  3CF2 A;  3ENG A;  2JIR A;  3ZGZ A;  1SFO A;  2LW6 A;  3X2G A;  1H0H A;  4GA5 A;  5FTK A;  3BQB A;  4L48 A;  1PQH A;  2YVL A;  5GLX A;  2Y0S A;  4ARC A;  2JIO A;  2VUM A;  2PMZ A;  2R92 A;  2NVY A;  2V45 A;  4JS7 A;  3SUL A;  1YLE A;  3TM7 B;  2YUJ A;  4ENG A;  2E2H A;  1YNN D;  3GTO A;  3IR7 A;  1BW4 A;  1AW8 B;  4ARI A;  4DMR A;  1I9G A;  5H4U A;  1TWH A;  5D6X A;  1TMO A;  1EU1 A;  1HD5 A;  2KI8 A;  2V3V A;  3HU1 A;  2A6H D;  5C18 A;  2QQS A;  1L8F A;  1KQF A;  2JV2 A;  2PWY A;  5GM9 A;  2HCZ X;  2MM2 A;  1DMR A;  1AA6 A;  2JIP A;  1Q16 A;  1R9T A;  2CW0 D;  2A68 D;  1G8K A;  1SMY D;  1PT1 A;  2JIQ A;  4JP6 A;  4KO8 A;  4AAY A;  1KQG A;  5GLF A;  5T5I D;  1I50 A;  2VPY A;  5FTL A;  3GTJ A;  2E2I A;  1CZ5 A;  3CZB A;  4GA6 A;  3GTQ A;  3QC8 A;  2Q18 X;  1VC3 B;  1PQF A;  1Y1V A;  3GTL A;  3FPR A;  4AS1 A;  2GFA A;  2E7Z A;  4CS0 A;  3GTK A; 
#chains in the Genus database with same CATH homology
 1WCM A;  4FIB A;  4KDI A;  1FDI A;  2IV2 X;  2JA7 A;  2B25 A;  2Q1A X;  5DYG A;  3QQ8 A;  2R7Z A;  3HU3 A;  1OGY A;  2B63 A;  2G5D A;  3ZJV A;  1DMS A;  2R93 A;  3QQ7 A;  3LGA A;  1QDN A;  2JIM A;  3CQZ A;  5T5M D;  2G6G A;  1PT0 A;  5EPP A;  4D7Z B;  4AZD A;  2GAE A;  1G8J A;  4RV0 A;  2VPW A;  1I3Q A;  3FKI A;  3QWZ A;  2Q1D X;  1Y4Z A;  2GF7 A;  1UHE A;  3TIW A;  2WAQ A;  2PJH B;  1S3S A;  1TWG A;  2DMR A;  2EEO B;  3MB5 A;  2YU9 A;  3FPT A;  5CCX A;  2Q19 X;  2O5J D;  1PQE A;  2QQR A;  5FTM A;  4CQN A;  5FTN A;  2NAP A;  4C2M A;  2AE0 X;  1QCS A;  5CCB A;  1R7R A;  1Y1W A;  3PLX B;  2XDP A;  1UHD A;  1CZ4 A;  1FDO A;  1E18 A;  4NOH A;  3HKZ A;  2PNW A;  3GTP A;  1SIW A;  1E32 A;  3DMR A;  3IR6 A;  1PPY A;  2PI8 A;  5D6Y A;  5B6C A;  1ZYR D;  2NYA A;  5CD1 A;  3O5A A;  4AON B;  3GTM A;  1WLF A;  1TWF A;  1ZC1 A;  1O54 A;  4AQ7 A;  1E5V A;  4QIW A;  1PYU B;  3IR5 A;  1K83 A;  3GTG A;  2Q1C X;  4AOK B;  3ZJU A;  4KOD A;  3FPU A;  4CRZ A;  2MM0 A;  2KY9 A;  5D6W A;  2BE5 D;  5ERG B;  2A69 D;  1E60 A;  1CR5 A;  3H0G A;  1IW7 D;  5FTJ A;  2VPX A;  2PJJ A;  1E61 A;  4CRY G;  3HU2 A;  2NVX A;  2JA6 A;  1H5N A;  5C1B A;  3ZJT A;  1TWA A;  2A6E D;  2JA5 A;  2C45 A;  5DYI A;  1TWC A;  3OUG A;  4KDL A;  2VPZ A;  4KLN A;  1YNJ D;  1PYQ A;  2WB1 A;  4AYB A;  1R27 A;  1Y5I A;  3ML1 A;  2PIC A;  3CF2 A;  2JIR A;  3ZGZ A;  1SFO A;  2LW6 A;  1H0H A;  4GA5 A;  5FTK A;  3BQB A;  1PQH A;  2YVL A;  4ARC A;  2Y0S A;  2JIO A;  2VUM A;  2PMZ A;  2R92 A;  2NVY A;  2V45 A;  5EQJ B;  4UC4 A;  1YLE A;  3TM7 B;  2YUJ A;  2E2H A;  3LHD A;  1YNN D;  3GTO A;  3IR7 A;  4ARI A;  1AW8 B;  4DMR A;  1I9G A;  1TWH A;  5D6X A;  1TMO A;  1EU1 A;  2KI8 A;  3HU1 A;  2V3V A;  5C18 A;  2A6H D;  2QQS A;  1KQF A;  2JV2 A;  2PWY A;  2MM2 A;  1DMR A;  1AA6 A;  2JIP A;  1Q16 A;  1R9T A;  2CW0 D;  2A68 D;  1G8K A;  1SMY D;  1PT1 A;  2JIQ A;  4KO8 A;  4AAY A;  1KQG A;  5GLF A;  5T5I D;  1I50 A;  2VPY A;  5FTL A;  3GTJ A;  2E2I A;  1CZ5 A;  3CZB A;  4GA6 A;  3GTQ A;  3QC8 A;  2Q18 X;  1VC3 B;  1PQF A;  1Y1V A;  3GTL A;  3FPR A;  4AS1 A;  2GFA A;  2E7Z A;  4CS0 A;  3GTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...