2YUJA

Solution structure of human ubiquitin fusion degradation protein 1 homolog ufd1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
190
structure length
190
Chain Sequence
GSSGSSGIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin fusion degradation 1-like
total genus 25
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2yujA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2yujA02
2PJHB 3TIWA 4KODA 3HU3A 1CR5A 5FTKA 5FTLA 1E32A 5C1BA 3HU2A 5FTMA 1CZ4A 4KDIA 3QC8A 5FTNA 1CZ5A 1R7RA 4RV0A 3QQ7A 5C18A 4KDLA 5DYGA 5FTJA 1QCSA 5DYIA 1S3SA 3QWZA 2YUJA 3CF2A 3QQ8A 5B6CA 4KO8A 5GLFA 1QDNA 4KLNA 1ZC1A 5EPPA 2JV2A 1WLFA 3HU1A
chains in the Genus database with same CATH superfamily
1WC2A 1Y1VA 3SUKA 4ARCA 4KODA 2YU9A 1N10A 1YNJD 2KI8A 3IR5A 3X2OA 4GA6A 1AA6A 1OGYA 3SULA 2B63A 1E18A 1H0HA 1CZ4A 1OA9A 2JIPA 2VPWA 3QC8A 4CRYG 4JP6A 1CZ5A 2YVLA 3ZGZA 3X2KA 1KQGA 1H5NA 1TWAA 2G5DA 3MB5A 5DYGA 2E7ZA 2CW0D 2B25A 3LGAA 5DYIA 4FIBA 3GTGA 5D6YA 3QWZA 5EQJB 3CZBA 2A69D 3CF2A 5GLXA 5T5MD 2PMZA 2QQSA 4CRZA 4KO8A 2G6GA 2IV2X 4AAYA 4AQ7A 1SMYD 2O5JD 3H0GA 4L48A 1UHDA 5H4UA 2E2HA 3GTJA 4KLNA 3BQBA 2A6ED 2GAEA 1ZC1A 5EPPA 3GTOA 3FPUA 1YNND 2JA6A 2LW6A 4D7ZB 2Q19X 4ZM7A 3IR6A 2PJHB 2NVYA 4AYBA 4UC4A 3IR7A 1FDIA 3ENGA 1CR5A 1R27A 3DMRA 5FTLA 2Q18X 1AW8B 1E60A 1PYQA 2A6HD 5C1BA 2DMRA 5FTMA 3X2HA 1BW4A 2KY9A 2Q1DX 3OUGA 3SUJA 4JCWA 1VC3B 4AVRA 2VPZA 3PLXB 3QQ7A 1IW7D 1BW3A 2JIMA 2Y0SA 3ZJVA 2JIRA 2VUMA 1S3SA 2NAPA 3GTQA 3TM7B 3X2MA 3M3GA 4FFTA 4NOHA 5GLFA 1Y5IA 3D30A 4JJOA 3X2JA 2Q1CX 2BH0A 2JA7A 2E2IA 2C45A 2JA5A 4FERA 3HKZA 2JV2A 4CQNA 1E5VA 5D6XA 2PI8A 1Y1WA 4FG4A 3LHDA 2R93A 3SUMA 2GFAA 5CCXA 4ARIA 2VPYA 1PT1A 2NVXA 1DMSA 1PT0A 3HU3A 2PJJA 2ENGA 5FTKA 3X2IA 4AZDA 2A68D 4CS0A 4ENGA 2WAQA 1YLEA 5GLYA 2MM0A 2XDPA 1TWCA 4KDIA 2JIOA 2R7ZA 2PICA 1PYUB 1KQFA 1PQEA 4RV0A 2V3VA 2BE5D 3FKIA 1ZYRD 1O54A 4KDLA 1PQHA 1DMRA 5FTJA 1UHEA 2JIQA 3X2NA 4DMRA 1PPYA 3ML1A 3ZJUA 2PNWA 3O5AA 1HD5A 1TWGA 5CD1A 1QDNA 2V45A 1R9TA 1EU1A 1TWHA 3X2LA 3CQZA 3X2PA 1I9GA 2WB1A 1TWFA 3GTKA 5D6WA 3HU1A 2KQAA 2Q1AX 4GA5A 2PWYA 3TIWA 2AE0X 1WCMA 4QIWA 4AOKB 3GTMA 2R92A 2EEOB 2QQRA 3FPTA 4AS1A 3GTPA 1E32A 2MM2A 3HU2A 4C2MA 1FDOA 5FTNA 1OA7A 1TMOA 4JP7A 2HCZX 1SIWA 2VPXA 1L8FA 1R7RA 3X2GA 5T5ID 3GTLA 1I50A 1Y4ZA 5C18A 3ZJTA 1QCSA 1Q16A 2YUJA 3QQ8A 4AONB 5B6CA 1G8JA 2NYAA 1E61A 5GM9A 1SFOA 3FPRA 4JS7A 5ERGB 4FG2A 5CCBA 2GF7A 1WLFA 1G8KA 1PQFA 1I3QA 1K83A
chains in the Genus database with same CATH topology
1Y1VA 4ARCA 4KODA 2YU9A 1YNJD 2KI8A 3IR5A 4GA6A 1AA6A 2B63A 1E18A 1H0HA 1CZ4A 2JIPA 2VPWA 3QC8A 4CRYG 1CZ5A 2YVLA 3ZGZA 1KQGA 1H5NA 1TWAA 2G5DA 3MB5A 5DYGA 2E7ZA 2CW0D 2B25A 3LGAA 5DYIA 4FIBA 3GTGA 5D6YA 3QWZA 5EQJB 3CZBA 2A69D 3CF2A 2QQSA 5T5MD 2PMZA 4CRZA 4KO8A 2G6GA 2IV2X 4AAYA 4AQ7A 1SMYD 2O5JD 3H0GA 1UHDA 2E2HA 3GTJA 4KLNA 3BQBA 2A6ED 2GAEA 1ZC1A 5EPPA 3FPUA 1YNND 2JA6A 2LW6A 4D7ZB 2Q19X 4UC4A 3IR6A 2PJHB 2NVYA 4AYBA 3IR7A 1FDIA 1CR5A 1R27A 3DMRA 5FTLA 2Q18X 1AW8B 1E60A 1PYQA 2A6HD 5C1BA 2DMRA 5FTMA 5D6WA 2KY9A 3OUGA 1VC3B 2VPZA 3PLXB 3QQ7A 1IW7D 2JIMA 2Y0SA 3ZJVA 2JIRA 2VUMA 1S3SA 2NAPA 3GTQA 3TM7B 4NOHA 5GLFA 1Y5IA 2Q1CX 2JA7A 2E2IA 2C45A 2JA5A 3HKZA 2JV2A 4CQNA 1E5VA 5D6XA 2PI8A 1Y1WA 3LHDA 2R93A 2GFAA 5CCXA 4ARIA 2VPYA 1PT1A 2NVXA 1DMSA 1PT0A 3HU3A 2PJJA 5FTKA 4CS0A 3GTOA 4AZDA 2A68D 2Q1DX 2WAQA 1YLEA 2MM0A 2XDPA 1TWCA 4KDIA 2JIOA 2R7ZA 2PICA 1PYUB 1KQFA 1PQEA 4RV0A 2V3VA 2BE5D 3FKIA 1ZYRD 1O54A 4KDLA 1PQHA 1DMRA 5FTJA 1UHEA 2JIQA 4DMRA 1PPYA 3ML1A 3ZJUA 2PNWA 3O5AA 1TWGA 5CD1A 1QDNA 2V45A 1R9TA 1EU1A 1TWHA 3CQZA 1I9GA 2WB1A 1TWFA 1PQFA 3GTKA 3HU1A 2Q1AX 4GA5A 2PWYA 3TIWA 2AE0X 1WCMA 4QIWA 4AOKB 3GTMA 2R92A 2EEOB 2QQRA 3FPTA 4AS1A 3GTPA 1E32A 2MM2A 3HU2A 4C2MA 1FDOA 5FTNA 1TMOA 1SIWA 2VPXA 1R7RA 3GTLA 5T5ID 1I50A 1Y4ZA 5C18A 3ZJTA 1QCSA 1Q16A 2YUJA 3QQ8A 4AONB 5B6CA 1G8JA 2NYAA 1E61A 1SFOA 3FPRA 5ERGB 5CCBA 2GF7A 1WLFA 1G8KA 1OGYA 1I3QA 1K83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJH B;  3TIW A;  4KOD A;  3HU3 A;  1CR5 A;  5FTK A;  5FTL A;  1E32 A;  5C1B A;  3HU2 A;  5FTM A;  1CZ4 A;  4KDI A;  3QC8 A;  5FTN A;  1CZ5 A;  1R7R A;  4RV0 A;  3QQ7 A;  5C18 A;  4KDL A;  5DYG A;  5FTJ A;  1QCS A;  5DYI A;  1S3S A;  3QWZ A;  2YUJ A;  3CF2 A;  3QQ8 A;  5B6C A;  4KO8 A;  5GLF A;  1QDN A;  4KLN A;  1ZC1 A;  5EPP A;  2JV2 A;  1WLF A;  3HU1 A; 
#chains in the Genus database with same CATH topology
 1WC2 A;  1Y1V A;  3SUK A;  4ARC A;  4KOD A;  2YU9 A;  1N10 A;  1YNJ D;  2KI8 A;  3IR5 A;  3X2O A;  4GA6 A;  1AA6 A;  1OGY A;  3SUL A;  2B63 A;  1E18 A;  1H0H A;  1CZ4 A;  1OA9 A;  2JIP A;  2VPW A;  3QC8 A;  4CRY G;  4JP6 A;  1CZ5 A;  2YVL A;  3ZGZ A;  3X2K A;  1KQG A;  1H5N A;  1TWA A;  2G5D A;  3MB5 A;  5DYG A;  2E7Z A;  2CW0 D;  2B25 A;  3LGA A;  5DYI A;  4FIB A;  3GTG A;  5D6Y A;  3QWZ A;  5EQJ B;  3CZB A;  2A69 D;  3CF2 A;  5GLX A;  5T5M D;  2PMZ A;  2QQS A;  4CRZ A;  4KO8 A;  2G6G A;  2IV2 X;  4AAY A;  4AQ7 A;  1SMY D;  2O5J D;  3H0G A;  4L48 A;  1UHD A;  5H4U A;  2E2H A;  3GTJ A;  4KLN A;  3BQB A;  2A6E D;  2GAE A;  1ZC1 A;  5EPP A;  3GTO A;  3FPU A;  1YNN D;  2JA6 A;  2LW6 A;  4D7Z B;  2Q19 X;  4ZM7 A;  3IR6 A;  2PJH B;  2NVY A;  4AYB A;  4UC4 A;  3IR7 A;  1FDI A;  3ENG A;  1CR5 A;  1R27 A;  3DMR A;  5FTL A;  2Q18 X;  1AW8 B;  1E60 A;  1PYQ A;  2A6H D;  5C1B A;  2DMR A;  5FTM A;  3X2H A;  1BW4 A;  2KY9 A;  2Q1D X;  3OUG A;  3SUJ A;  4JCW A;  1VC3 B;  4AVR A;  2VPZ A;  3PLX B;  3QQ7 A;  1IW7 D;  1BW3 A;  2JIM A;  2Y0S A;  3ZJV A;  2JIR A;  2VUM A;  1S3S A;  2NAP A;  3GTQ A;  3TM7 B;  3X2M A;  3M3G A;  4FFT A;  4NOH A;  5GLF A;  1Y5I A;  3D30 A;  4JJO A;  3X2J A;  2Q1C X;  2BH0 A;  2JA7 A;  2E2I A;  2C45 A;  2JA5 A;  4FER A;  3HKZ A;  2JV2 A;  4CQN A;  1E5V A;  5D6X A;  2PI8 A;  1Y1W A;  4FG4 A;  3LHD A;  2R93 A;  3SUM A;  2GFA A;  5CCX A;  4ARI A;  2VPY A;  1PT1 A;  2NVX A;  1DMS A;  1PT0 A;  3HU3 A;  2PJJ A;  2ENG A;  5FTK A;  3X2I A;  4AZD A;  2A68 D;  4CS0 A;  4ENG A;  2WAQ A;  1YLE A;  5GLY A;  2MM0 A;  2XDP A;  1TWC A;  4KDI A;  2JIO A;  2R7Z A;  2PIC A;  1PYU B;  1KQF A;  1PQE A;  4RV0 A;  2V3V A;  2BE5 D;  3FKI A;  1ZYR D;  1O54 A;  4KDL A;  1PQH A;  1DMR A;  5FTJ A;  1UHE A;  2JIQ A;  3X2N A;  4DMR A;  1PPY A;  3ML1 A;  3ZJU A;  2PNW A;  3O5A A;  1HD5 A;  1TWG A;  5CD1 A;  1QDN A;  2V45 A;  1R9T A;  1EU1 A;  1TWH A;  3X2L A;  3CQZ A;  3X2P A;  1I9G A;  2WB1 A;  1TWF A;  3GTK A;  5D6W A;  3HU1 A;  2KQA A;  2Q1A X;  4GA5 A;  2PWY A;  3TIW A;  2AE0 X;  1WCM A;  4QIW A;  4AOK B;  3GTM A;  2R92 A;  2EEO B;  2QQR A;  3FPT A;  4AS1 A;  3GTP A;  1E32 A;  2MM2 A;  3HU2 A;  4C2M A;  1FDO A;  5FTN A;  1OA7 A;  1TMO A;  4JP7 A;  2HCZ X;  1SIW A;  2VPX A;  1L8F A;  1R7R A;  3X2G A;  5T5I D;  3GTL A;  1I50 A;  1Y4Z A;  5C18 A;  3ZJT A;  1QCS A;  1Q16 A;  2YUJ A;  3QQ8 A;  4AON B;  5B6C A;  1G8J A;  2NYA A;  1E61 A;  5GM9 A;  1SFO A;  3FPR A;  4JS7 A;  5ERG B;  4FG2 A;  5CCB A;  2GF7 A;  1WLF A;  1G8K A;  1PQF A;  1I3Q A;  1K83 A; 
#chains in the Genus database with same CATH homology
 1Y1V A;  4ARC A;  4KOD A;  2YU9 A;  1YNJ D;  2KI8 A;  3IR5 A;  4GA6 A;  1AA6 A;  2B63 A;  1E18 A;  1H0H A;  1CZ4 A;  2JIP A;  2VPW A;  3QC8 A;  4CRY G;  1CZ5 A;  2YVL A;  3ZGZ A;  1KQG A;  1H5N A;  1TWA A;  2G5D A;  3MB5 A;  5DYG A;  2E7Z A;  2CW0 D;  2B25 A;  3LGA A;  5DYI A;  4FIB A;  3GTG A;  5D6Y A;  3QWZ A;  5EQJ B;  3CZB A;  2A69 D;  3CF2 A;  2QQS A;  5T5M D;  2PMZ A;  4CRZ A;  4KO8 A;  2G6G A;  2IV2 X;  4AAY A;  4AQ7 A;  1SMY D;  2O5J D;  3H0G A;  1UHD A;  2E2H A;  3GTJ A;  4KLN A;  3BQB A;  2A6E D;  2GAE A;  1ZC1 A;  5EPP A;  3FPU A;  1YNN D;  2JA6 A;  2LW6 A;  4D7Z B;  2Q19 X;  4UC4 A;  3IR6 A;  2PJH B;  2NVY A;  4AYB A;  3IR7 A;  1FDI A;  1CR5 A;  1R27 A;  3DMR A;  5FTL A;  2Q18 X;  1AW8 B;  1E60 A;  1PYQ A;  2A6H D;  5C1B A;  2DMR A;  5FTM A;  5D6W A;  2KY9 A;  3OUG A;  1VC3 B;  2VPZ A;  3PLX B;  3QQ7 A;  1IW7 D;  2JIM A;  2Y0S A;  3ZJV A;  2JIR A;  2VUM A;  1S3S A;  2NAP A;  3GTQ A;  3TM7 B;  4NOH A;  5GLF A;  1Y5I A;  2Q1C X;  2JA7 A;  2E2I A;  2C45 A;  2JA5 A;  3HKZ A;  2JV2 A;  4CQN A;  1E5V A;  5D6X A;  2PI8 A;  1Y1W A;  3LHD A;  2R93 A;  2GFA A;  5CCX A;  4ARI A;  2VPY A;  1PT1 A;  2NVX A;  1DMS A;  1PT0 A;  3HU3 A;  2PJJ A;  5FTK A;  4CS0 A;  3GTO A;  4AZD A;  2A68 D;  2Q1D X;  2WAQ A;  1YLE A;  2MM0 A;  2XDP A;  1TWC A;  4KDI A;  2JIO A;  2R7Z A;  2PIC A;  1PYU B;  1KQF A;  1PQE A;  4RV0 A;  2V3V A;  2BE5 D;  3FKI A;  1ZYR D;  1O54 A;  4KDL A;  1PQH A;  1DMR A;  5FTJ A;  1UHE A;  2JIQ A;  4DMR A;  1PPY A;  3ML1 A;  3ZJU A;  2PNW A;  3O5A A;  1TWG A;  5CD1 A;  1QDN A;  2V45 A;  1R9T A;  1EU1 A;  1TWH A;  3CQZ A;  1I9G A;  2WB1 A;  1TWF A;  1PQF A;  3GTK A;  3HU1 A;  2Q1A X;  4GA5 A;  2PWY A;  3TIW A;  2AE0 X;  1WCM A;  4QIW A;  4AOK B;  3GTM A;  2R92 A;  2EEO B;  2QQR A;  3FPT A;  4AS1 A;  3GTP A;  1E32 A;  2MM2 A;  3HU2 A;  4C2M A;  1FDO A;  5FTN A;  1TMO A;  1SIW A;  2VPX A;  1R7R A;  3GTL A;  5T5I D;  1I50 A;  1Y4Z A;  5C18 A;  3ZJT A;  1QCS A;  1Q16 A;  2YUJ A;  3QQ8 A;  4AON B;  5B6C A;  1G8J A;  2NYA A;  1E61 A;  1SFO A;  3FPR A;  5ERG B;  5CCB A;  2GF7 A;  1WLF A;  1G8K A;  1OGY A;  1I3Q A;  1K83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...