5D6XA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 23
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6xA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6xA02
1KHCA 3L2RA 2RJEA 5CIUA 4BDZA 2X4XA 4ZTJA 3BDLA 2IG0A 3MEVA 4QQGA 3OYKA 3MEAA 3OYHA 1H3ZA 2MWOA 2JZ2A 2RI2A 3OYFA 5J39A 4OVAA 3OYJA 2LRQA 2RJDA 1OYXA 5J26A 3LLRA 5KE2A 4QQDA 4ZTFA 2QQRA 1N27A 2E6NA 3UT1A 3LX7A 3MO8A 4IURA 2DIGA 2RHYA 4N4GA 3L2UA 4IUTA 3OS2A 3OY9A 2YRVA 2GFUA 2BIVA 5C0MA 2F5KA 4BE0A 1MHNA 5C6SA 2JTFA 2EKOA 2R5AA 3MEUA 1XNIA 3OB9A 3PMTA 4FL6A 4UC4A 3QBYA 3OYNA 1SSFA 5FRMA 2RHZA 3OS1A 1WGSA 3QIIA 2O4XA 3DB3A 3P8DA 5FROA 3FEOA 5D6WA 2RJFA 2CKKA 5KH6A 4E7LA 4EDUA 3DLMA 1WJQA 4A4HA 4E7IA 3LYIA 2R57A 4C5GA 3S3OA 3ZEHA 3Q1JA 5M9OA 3OYDA 4PL6A 3S6WA 2K3YA 4PLIA 4CRIA 1OZ3A 3QJ6A 4HCZA 3ME9A 2D9TA 5IN1A 3OA6A 2G3RA 3MEWA 2HQEA 2RI5A 2WACA 3OYEA 4BD3A 2R58A 4GY5A 3UWNA 3QKJA 2XDPA 4A4GA 3MP8A 4B9WA 3OYGA 4IUQA 3L2VA 2X4YA 2HQXA 3LGFA 4BE1A 3PFSA 4X34A 2L8DA 3NTKA 1OI1A 2GFAA 3OQ5A 2L89A 4C5EA 4C5HA 5D6XA 5FRNA 4QVZA 2M0OA 2EFIA 5KE3A 3OYAA 2EQMA 2XK0A 3OS0A 4LD6A 2RO0A 2K3XA 3LGLA 2DIQA 4E7HA 2E5QA 4Q5WA 3L2WA 2RHIA 2LVMA 2NLUA 3NTHA 3NTIA 4NS5A 2VYTA 3PMIA 4A4FA 3O8VA 1WJSA 2O4XB 2RHUA 2R5MA 3OMGA 2EQUA 4RG2A 4IUVA 3OYMA 3OMCA 1RI0A 2M16A 2RHXA 2GF7A 3OYIA 2FHDA 2P0KA 3FDRA 3PNWC 4IKFA 3OYBA 3E9GA 2BUDA 2QQSA 4E7KA 2MWPA 3C4SA 3H8ZA 3M9QA 4IUPA 1WJRA 3MP6A 4QW2A 5IAYA 4BE2A 2X35A 2M1HA 4BACA 2RI3A 3DB4A 4FU6A 3L2QA 1OZ2A 4A4EA 3FC3A 1G5VA 2LCCA 3KUFA 3P8HA 3H6ZA 5D6YA 4II1A 4QQ6A 3ASKA 3GOXA 2EQJA 4B9XA 2PQWA 3MP1A 3S3MA 4BDYA 2X4WA 3LH0A 2LTOA 3S3NA 5KCOA 2EQKA 4PLLA 4IUUA 4Z02A 2L3RA 2RJCA 3L42A 4E7JA 3META 4N4HA 2BKDN 3SD4A 4L59A 2LDMA 4N4IA 3CEYA 4C5IA 2DAQA 3EAEA 5KCHA 3FLGA 3OYCA 3E9FA 2B8AA 3F70A 3OYLA
chains in the Genus database with same CATH superfamily
2OAUA 1I9GA 2P4RA 5B6CA 3LWIA 4R56A 3OYJA 3CCQT 4KUDK 2NUPB 2DKGA 2QA4A 4N4GA 3CC4A 4DA4A 5CKEA 2DTOA 4M77C 4HVWA 4AG2C 1OEBA 3AHUA 1CZ4A 3EFOA 1QKXA 2DX1A 1AHJB 2LCLA 3CC2T 2DK3A 2K5LA 1WGSA 1K76A 1ZBJA 2V26A 5FROA 1D1CA 4KLNA 3CCJA 5I11A 3GF5A 4LDVA 4C5GA 3JCMd 2X4JA 3UDCA 4BI4A 4BY6B 2SEMA 3HRTA 1T3SA 4M77A 1SHFA 2KNBB 4B9WA 1OU9A 2XICA 4BE1A 1S72Q 3CCEA 1W1FA 1I5LA 3JCMf 2GNCA 3QDRB 2XIDA 5A0GA 2EQMA 3PTAA 3CCLQ 1YITT 1SG5A 2K2VA 5LJ3j 2EGCA 2NLUA 1LNXA 3JB9J 1Q81R 1D0YA 1M27C 4HCBA 4C0DB 2QGFB 4PFPA 5I21A 2R5MA 2DFUA 2EQUA 3SWNB 3RKWA 2RQUA 1SRLA 2EJGA 3JCMg 1FMWA 5A0LA 4HT9A 1QW1A 2QI2A 2Y90A 4FU6A 3NHNA 3QO3A 2Y4YA 4EMKB 3P8HA 1XTDA 4RCCA 1VQKQ 1V76A 1TWBA 1AD5A 3HKSA 4BDYA 3PT9A 1QP2A 4CC4B 3SWNC 2EVRA 1LOJA 3L42A 5DLQE 3X20B 4RUGA 4C0DC 3AT1B 2JM9A 5IH2A 4M75A 2XG8D 2QGGA 3OYCA 1EFNA 3VYGA 5LJ5j 2JMCA 2KYMA 2DEQA 1B34B 2L0AA 1RAFB 3VS2A 1KD1C 1VQPA 1M5Q1 2DD5A 4MMLA 2HKQB 2LJ3A 4P5NA 2DVEA 3PVLA 1KHIA 3EGXB 3H0IA 4J5YA 1PD1A 1PG5B 1VYUA 3OS1A 1IGQA 2NUZA 3X28B 2J6OA 2E6ZA 3FEOA 5D6WA 5CCBA 1BCMA 4OMFB 2K5FA 3G6EA 2GQIA 5KYXB 3HP9A 5LJ5d 2DLPA 3ME9A 5IN1A 4EPCA 3FJ5A 2LW6A 2MPXC 4FYYB 2DXBA 3OYEA 2XDPA 2ZPIB 4IUQA 2YLCA 2JW4A 1TXQA 1GCQC 1E32A 2I2LA 1FYNA 3PE0A 2P0QA 2CZ7B 1UECA 3OYYA 1KK7A 2YUPA 2D0QB 2BTTA 3UATA 1R7RA 4QKUA 1BB9A 3HL8A 3OBYA 3M55A 1KJWA 2O4XB 2DYBA 1FX7A 4J9CA 1KC8R 5IXFA 2EYQA 2GTJA 1VQMA 2LMJA 1IREB 1YHQA 3IQLA 5GAOr 1RLPC 4M78G 3CC2Q 3QC8A 1TS9A 4M7DB 1YFNA 4D8DA 1QVGP 2FPFA 1W2BP 1VQ6Q 1AWXA 4J9IA 3I35A 1RAHB 2ZZDA 3H0HA 2EW3A 3S3MA 1YJ9Q 1OX8A 2CT3A 3CC7T 2DXUA 2K6DA 2FB7A 2MF2A 1KG1A 4M75D 3I55A 2FZCB 1M3CA 2M0YA 5FTJA 1UGQB 2P0PA 3GIBA 2CGHA 1X75C 2LX9A 1BI1A 1K9MC 4HVVA 1AEYA 5LL6S 3UA6A 2C0IA 3HSBA 2QQRA 2O2OA 4NL3A 3OW2S 1G3SA 2V1RA 1MNEA 3OY9A 1ZQ1A 5IHKA 1MHNA 4BI8B 1K8AU 5HK0A 1PWTA 1E6HA 3EFRA 2RHZA 2XI9A 5FU6B 3CXCS 4E7LA 5EC7A 4M77E 3A98A 2MI6A 2QAZA 1BIAA 3ZEHA 4IIMA 2IPOB 4PLIA 2LNVA 4XU1A 2W10A 1QWEA 2HKNA 1Q82C 3G4SA 4D8KA 2WACA 4LD9K 4BD3A 1VQLQ 3MP8A 3QJYA 2AHJB 2FZKB 4PFOA 4AMCA 4HT8A 3GPLA 4J9BA 3VKIA 4OMPA 3L2WA 2O9VA 2DM1A 3CCJQ 1IB8A 2HZYA 4JUVA 5EG2A 4NS5A 2OTLQ 3FPRA 3RKYA 2QQAA 3OYMA 1T0JA 3CCSA 2QTXA 3QWXX 4PJOC 1J3TA 3PNWC 5DY9A 1Q86U 1WI7A 1M2OA 1D0XA 2MM2A 5D7UA 1NE8A 4GLMA 4HXJA 4AFSC 1M90C 2EQJA 1TSFA 1TUCA 1YJNQ 2V8IA 1A0NB 1N8RR 4Z02A 5GAOp 2RJCA 2GCXA 1YJWT 1ZSZC 2V1QA 1K73U 5HKCA 4AG1C 5GANh 4C8QA 2CP3A 4ZTJA 2KGTA 2BE7D 1QVFA 3HHTB 3C12A 3LH5A 5GANd 2JT4A 3U23A 2A36A 2AZSA 2CP5A 5GMKi 3EG3A 1W70A 4XQ3A 5KYUA 4PJJA 4C0ZA 1N6AA 2FYKA 1QVFS 3EGUA 2VVKA 2CT4A 4R0KA 2F2WA 1E6GA 1G8XA 1RAIB 2DL8A 1JB0E 1ZUUA 4EMGA 4PKCC 4E7IA 5M9OA 4PL6A 3SHWA 2D1XA 4HCZA 4CC3A 4C92C 2B86A 1YWOA 4M7DG 2OTLT 1M2VB 1VYVA 9ATCB 5GAN3 2ECZA 3CCLT 4LD6A 1MMGA 4IIOA 1SRMA 4ZNXA 1WPYA 5CCAA 3JCMQ 1M1GA 2HNIA 1S3SA 2E3HA 1U5SA 4PNOA 2PJHB 2HL3A 1R0BG 3OSSC 5DLOA 2EYYA 5DYGA 2E65A 2GBQA 2VC8A 4M7AE 4YTLA 2DEUA 1YJWQ 3CCUT 4C8QG 1KSWA 2QEXA 2CP2A 1JXMA 1ZA1B 2KXDA 2K7AA 1M3BA 3HFNA 4DOWA 4C0GA 4XU2A 3ASKA 5FU7C 1ZX6A 2YXYA 3MKDA 4C8QB 5GAN6 2CP0A 1PM3A 4K11A 2X4WA 2LTOA 2PNIA 4PLLA 2OTJT 1O54A 4L59A 2LDMA 5CVIA 5J3BA 1VQ8Q 1UGVA 2ROLA 4BI3A 2K2MA 2JM8A 5GAMd 1QCOA 1M2VA 1RACB 3G71Q 2V8KA 1ARKA 2DJZA 1VQLA 4OB2B 3PIOA 3LX7A 2CZ1B 4FYXB 2RHYA 1MNDA 3M0TA 4M7AB 2YRVA 2BIVA 2LP5A 4UC4A 2AKLA 1Q7YC 3R6NA 3QIIA 1PCXA 1B7TA 1BI0A 2RJFA 1VA7A 4C8QE 2JNGA 1WQWA 4J8OA 5LJ3h 4MZTA 1O9SA 3S6WA 2HL5C 4DEXA 1W4SA 1NEGA 1PKTA 1VQ4T 1YCSB 3JCMW 1KQ2A 2ROTA 1RAEB 3OBWA 1Y7XA 1JQQA 4LE9A 4MZPA 1QMCA 1G83A 4Q5WA 2CP7A 1GBQA 5CCXA 2KY9A 3CQTA 3RBBB 1W6XA 1JEGA 1PSEA 4KH1B 3OMCA 5GMKj 1BIBA 1WX6A 5GMKl 3PIPA 3REAB 3H8ZA 4KULA 1M8MA 2M1HA 4RTUA 3ZJVA 1W2BA 5D6YA 2KBTA 3CCQA 2EWNA 4B9XA 5KYWB 1NPPA 1X6GA 5GMKh 3LH0A 5KCOA 3BQBA 1UEBA 2ABLA 1S72A 2PWYA 4N4HA 2OAWA 4XU0A 4C5IA 3EH2A 5KCHA 1UHFA 3G7ZA 1KHCA 4MDXA 4RTZA 3TSWA 2XDDA 3EGXA 3OYHA 4LDXA 3CCVT 1M90R 2QK0A 3I56T 3UPUA 3GLXA 2L5QA 4XAXB 1M30A 4JRIA 2JTMA 1N9SA 3QWZA 2RF0A 1RAAB 3L2UA 4F14A 3A8MB 5KYXA 1M3AA 5GJVB 4AFQC 4BE0A 3V8LA 5IT9E 1OPKA 3CC4Q 2YLBA 1P92A 2H3EB 1UE9A 2O4XA 1WFWA 2EGAA 4E7SA 3CXCA 4KT0E 1QCSA 1VQKA 4DBQA 4KDLA 3LHDA 2HDAA 4M7DE 3OA6A 1Y07A 2HQEA 1VQ7T 5IHNA 3FJPA 2LQWA 1UG1A 1VQOT 4AS1A 3TVTA 3MCAB 2PVDB 4M7AF 2L8DA 4EMKA 3JSCA 3QQ8A 3RESA 5D6XA 5FTLA 2EFIA 2AT1B 1OULA 5GAN5 5DYIA 3M54A 2COZA 3LGLA 1K1ZA 3VRYA 5GAOn 2RK2A 1AZGB 1HK9A 3VS3A 4LDYA 3ZJUA 5GAOm 1WNLA 3BFMA 1VQ8A 1NBEB 4OMQA 2Q1CX 4KGXB 4E7KA 4OB3B 3M9QA 4QW2A 5ERGB 3CMEQ 3FB9A 1WLFA 4XTWA 4BY6C 2ZAEA 1VQPT 2X51A 3QWYA 1C6VX 1RADB 3JCMc 4XU3A 3HFOA 3S3NA 1GXIE 3HU2A 3V7CA 1WHHA 4ESRA 2WSEE 2C0OA 2VWFA 2RQRA 2A3LA 1M1KR 3JRZA 4PJMA 1UTIA 3VUBA 2QASA 3OYFA 4A54A 5J26A 4FT4A 1X2KA 1N27A 3ER0A 3UT1A 4KO8A 3E1SA 1MUZA 4XTUA 3WVDB 1UFFA 6AT1B 5LJ3g 3CPFA 2VXFA 2OTJQ 1QKWA 5GAN7 2J7IA 2DZCA 2DTIA 1SSFA 5L23A 5GAN4 4OGCA 2COWA 4F7UA 3S3OA 4M75E 1VOMA 2LT4A 4AQ7A 1YN8A 4J9DA 1CR5A 3C94A 2HQXA 4HKEA 2MK5A 4VUBA 3NTKA 2GFAA 1Y71A 2VXEA 4QT7A 3CC2A 4WTOB 1YITQ 2K3XA 4F7UE 2RA2A 1UUEA 1KQSS 1W2BS 4FT2A 1PRLC 2JOYA 4L6V5 3INZA 4ZGEB 3UA7A 3CCRT 1YJ9A 1WHMA 1X27A 2BZXA 3SB2A 1UJ0A 1HSQA 2F5TX 1AT1B 3M53A 2FG0A 3CMAQ 3EG1A 5GAOl 3EGDB 3RUXA 1YBYA 1JO8A 5I2SA 1K73R 3C4SA 2MAMA 3VV0A 4M77G 3MJXA 1Q81C 1OZ2A 1V1CA 4QVDA 2YHTA 3CCMA 1C1AA 1NJIC 3CBOA 3CEYA 2KROA 3GNGA 2BZYA 3L1AA 2DXTA 2K5IA 4OB0B 3MHXA 2Y4XA 3F70A 2VV5A 5CIUA 3JB9G 2L3QA 1D3BA 5HK3A 3EHQA 3MEVA 2LT1A 2MM0A 2F1LA 1BI3A 4OVAA 3CXCP 1OYXA 5KE2A 4C0FA 5GMKe 3J80E 1TUDA 1ZUKA 2DO3A 1U1TA 2KK4A 5KYNA 1YIJQ 1M1KU 2GFUA 3C95A 2EKOA 3E2UA 4DQ2A 2J05A 3CCET 3PMTA 1YJNT 2QDYB 4M4ZA 2NUTA 4Z89A 1YITA 3DB3A 1Q86C 1WHKA 2CKKA 1KD1R 1YCYA 4A4HA 2R57A 3NPFA 3TEEA 1YIJT 1OZ3A 4DOVA 2V8JA 1ZUYA 1M9SA 2E4HA 2M51A 4M75F 3EG9A 2X4YA 2KRMA 1SEMA 4GBQA 1JXOA 1Q95G 3CMEA 1NM7A 1UB4A 2E5KA 4FIBA 1K0XA 2Q1AX 1R8OB 2M9UA 1HJDA 1LJOA 1X6OA 1N8RC 4PJOB 1WHGA 2DL5A 3O8VA 1I0CA 3HRUA 3PGGA 1ZBXA 1AWOA 1WXBA 3CCMQ 3O5ZA 3CCMT 4XTXA 3E9GA 2RN8A 1WJRA 3MP6A 1GFDA 1OOTA 2QXFA 3HRSA 1HXDA 1GRIA 4A4EA 3FC3A 4LN2A 3M4YA 5CKHA 2Q1DX 1VQNA 2GQVA 1D1AA 3GP8A 1CZ5A 1D3BB 5HY6A 4PK4A 3C0CA 3KXTA 1TG0A 4GLKA 2F69A 2EYWA 4C92A 3JCMh 3META 1BKBA 4KDIA 2KQWA 3SD4A 1YHQT 2O88A 1YJNA 3EAEA 2B25A 4J7IA 2MYSA 1UJYA 1BYMA 3QG1A 4J9EA 4J9HA 2HCKA 1YI2Q 1EX4A 4FYWB 2IG0A 3JAME 4QQGA 2MWOA 2JZ2A 2CZ6B 1BU1A 5CK9A 4M7DA 3BE3A 2DIGA 1IHVA 4IUTA 1B3QA 3VS1A 1VYTA 1PC0A 3M59A 5FLXE 4V2SA 5AYFA 1VQ4A 2JTFA 3QZ5B 2JTEA 4OGEA 1Q82R 1GCPA 2CH4W 2ZPGB 1YJWA 5KYYB 3THKA 5C1BA 4J6XA 2DJQA 2YUJA 2J06A 4M78D 1I07A 4JRKA 1M4ZA 1T0HA 3CD6T 1JU5C 2DETA 2RMOA 2XDBA 3M4GA 1ZA2B 5FRNA 3TCJA 3EHRA 1M8VA 1QP3A 3QYHB 2LQKA 4OP0A 2DRMA 4JRPA 2L3SA 5LJ3f 2CDTA 2LVMA 4JDSA 4O6JA 3SDZA 3RMQA 1Z9QA 1VQMQ 2QA4Q 1CSKA 4LUDA 4AT1B 1R0CB 3M0QA 2HEQA 2P84A 1VQ9A 2DVJA 2CYZB 2PUKB 2QQSA 3QPHA 2PUOB 5GAMf 1SHGA 2LCCA 2P4TA 2CUDA 3ZGZA 5FU6C 5FTNA 2FZGB 2VGMA 2BZ8A 1BCOA 4QVCA 2QEXQ 3JV3A 4F16A 3I55Q 3H0FA 3MP1A 3HU1A 1YJ9T 2A0FB 4ATOA 2HBWA 2DL3A 2O9SA 4PJLA 3CBMA 4E7JA 4N0AC 3CMAT 5DM7R 2HSEB 3QSUA 3VS7A 5CD1A 2RJEA 3VS6A 3VYHB 4M7DF 4ELYC 1H3ZA 3MEAA 4OMLA 2E12A 4QQDA 1MV3A 1D09B 4OMOA 3OS2A 4FW1A 1OQKA 1G3YA 2CSQA 3FRNA 5CQXA 4DBFA 1WDXA 3ZFJA 2D0NA 3JCMJ 2F2XA 2JV2A 1VQ6A 3QXEB 3QJ6A 4M77D 2YSQA 2QDLA 5A2QE 2ZPEB 1NPRA 2KR3A 4L5GA 5A0DA 1I1JA 2EYZA 1Q81U 1B34A 2LJ1A 4C5HA 2MOXA 2NUPA 4XTZA 1NYFA 4JJNK 2E5QA 4E7HA 2JN0A 2YRDA 1KIKA 2FPDA 2O01E 3CCVQ 2EGEA 5GMKm 2ZCFB 5CKDA 3DKMA 2LX7A 2RHXA 3M56A 1S72T 2PU9B 3OYIA 4ARCA 2P0KA 3J81E 4IKFA 1PSFA 3CF2A 1H641 4BE2A 1YI2A 2X35A 2QQ9A 2K9GA 3JCMV 2RD1A 1YP5A 3I56A 1AOJA 2GGRA 4M75B 3CC4T 1D0ZA 3CCQQ 2PVOB 5GAMg 4LNPA 3OW2P 4M75C 4E6RA 2KI7A 1VQOQ 3FLGA 1BI2A 4RTYA 4EDUA 3OYLA 1JBMA 3JCMe 1VQKT 2RJDA 1MV0B 4J9FA 1FXXA 4A4KA 1KQSP 3RMSA 3G4ST 2OTLA 1I5OB 1VQ7A 4PFZA 3M0SA 1VQPQ 2RPNA 3I55T 2F5KA 1YHQQ 2HAXA 2PVGB 3MEUA 4E7ZA 1NEBA 3OB9A 3QHSA 4XK8E 1RAGB 4FW2A 3G71T 1WHJA 1WJQA 3EFOB 2IIMA 2SRCA 2WSFE 1Z9ZA 2LJ0A 1VIFA 4M7AA 2DE0X 4RTVA 2D9TA 3OW2A 1H3HA 4JJBA 4RG8A 1PKSA 2G3RA 3V7RA 4C92D 3MEWA 1ZHIA 1BK2A 2LZ6B 2EAYA 1JRIA 2CH4A 2MCNA 1X2QA 2HMAA 2JVVA 2RM4A 4O5VA 5EPPA 1G3WA 2GTOA 3ULRB 1VIEA 1BBZA 2KSSA 1QWFA 2KEAA 3OS0A 4D6WA 3CCUQ 3HU3A 4CC7A 2DIQA 1KD1U 1WXUA 3I56Q 3A8LB 1JJ2A 2JJ9A 4M78C 1TUGB 1WJSA 4M75G 2RHUA 5KYYA 2RQVA 1QLYA 4RTWA 1RI0A 2VB6A 3NFCA 2OTJA 4MZMA 2FHDA 1ABQA 2PTKA 3OYBA 4ORZA 2DXCA 2MWPA 2NYSA 1WHLA 4RKUE 2HD0A 3EFSA 1Q7YU 5KYUB 4KH0B 5GANg 4M78A 1RI9A 4PJOE 3H6ZA 2COYA 2FEIA 2CZ0B 2EYXA 2G6FX 2KMTA 4E2FB 2YUOA 4ANJA 2L3RA 2PZ1A 1VQ8T 2CREA 5HCKA 4N4IA 3M57A 5GJWB 4NL2A 2B8AA 2VKNA 5LJ5f 1R77A 2RNAA 1H92A 5GAOq 3G6ET 4DBHA 2DF6A 5J39A 2DD4A 2LRQA 2KE9A 2Q19X 5GAN2 2NWMA 5AT1B 5GLFA 2VASA 1X69A 2OX7A 1I4K1 2W0ZA 1XNIA 3CPWP 3OYNA 2C06A 2YWWA 1TTHB 1I81A 3CCVA 1N9RA 3VUZA 3A1PA 3MPUB 8ATCB 3OYDA 1D1BA 1K8AR 4CRIA 2QQBA 2JUFA 4JRQA 4HCKA 3OYGA 1VQMT 1UHCA 3RNJA 2KVQG 4X1VA 4JLIA 2DL7A 2HQHA 3N5BB 3I5SA 4X34A 4ZGJB 4M77F 1WLPB 2J6KA 4FM4B 1KC8C 2XK0A 2CUBA 4RCBA 4FYVB 2I0NA 1FMVA 1WIEA 3NGPA 4FSXA 1LPLA 4C92B 3V7SA 3DLLA 1XOVA 5LJ5e 2VYTA 1VQ5A 2LC4A 1T3LA 1VQOA 1RABB 4HCCA 1JJ2S 1SF9A 5CKBA 3EH1A 4IUPA 1K9AA 3BDUA 5C18A 1V29B 3JB9D 3FPTA 4CI0C 1Q82U 2H3JA 2CP6A 1XJWB 2PQWA 1OPLA 2K3BA 1PHTA 1OX9A 4MDWA 2XMFA 4ME7A 2YVLA 3CCST 2JS0A 1TH7A 5ECAA 1Q7YR 1MMNA 2DAQA 1YI2T 1NJIU 3M5AA 1IRXA 2X4XA 3OYKA 2K79A 3BY7A 2RI2A 4WF2A 4ZTFA 2YDLA 3ZL7C 2J6FA 2XKOC 2E6NA 2AKKA 5I22A 2OJ2A 4KODA 2KRSA 3D7SB 1AVZC 4Z88A 1K9MR 1M1KC 3X26B 2Z0WA 4EIKA 1C0MA 4JPBW 2FO0A 5FRMA 2Q18X 3P8DA 2EKHA 1EIFA 5CAIA 2RQTA 4OMNA 4ARIA 2CS7A 4F7UG 2EJFA 1EZZB 5I2MA 4N0AA 1U8RA 1GBRA 3LGAA 3X24B 1VQ5Q 3CC7Q 4GY5A 3M58A 3UWNA 3L2VA 3M0PA 4ZN1A 4RTTA 3A5ZB 1QDNA 3OQ5A 1NLPC 1ZSGA 1QVGS 3JB9H 5KE3A 4M78E 1IHWA 1QQJA 5EQJB 2RHIA 1PD0A 3G6EQ 1VQNQ 4C8QF 3QDFA 4XTYA 3PMIA 4RG2A 4IUVA 3ZJTA 3V8KA 4Y92A 3FDRA 3OS5A 3RDVA 4JZ3A 2BUDA 5FWBA 3T9NA 2A08A 2QTVA 5FTKA 2EPDA 4M7AD 2DMOA 5GANf 3L2QA 1M90U 5GANj 3GNFB 3EG0A 4NOYA 2DBMA 1UGRB 3X25B 3TQ7P 4PJOD 2LCSA 1SKUB 4AFZC 3URGA 2ATCB 4RV0A 4J83A 4Z8AA 4JS4A 2JMAA 4JLGA 1LCKA 1VQ4Q 3QQ7A 1K73C 1JJ2P 3CD6Q 3L2ZA 3I5RA 4X9DA 4FCYA 2DA9A 1WXTA 2RH2A 1G2BA 3PVQA 5KYWA 1G3TA 3L2RA 3TSZA 1HYOA 3EG2A 2BE9B 4CC2A 2DTHA 1HD3A 4LXCA 2E10A 2E41A 1X43A 2VGNA 3LLRA 2HBPA 2EBPA 3VS5A 2K4YA 1IZ6A 2MIOA 3MO8A 3CC7A 4J7FA 4ZN3A 1KFZA 5FTMA 2E70A 5C0MA 2WSCE 1K4US 3HPWA 1QVFP 2XU8A 3QBYA 4PJOG 3JB9I 4F17A 2X3WD 3TIWA 2OI3A 5LJ3d 4Y28E 3EGDA 2K3YA 1IGUA 3WVEB 3CBPA 1MMAA 3KFVA 3CCRA 5GANe 2RI5A 4A4GA 5IHIA 2YUQA 1SSHA 4MMKA 2QG9B 3G1JA 1Q86R 1VQ9Q 4ELZC 3WXMB 1VQ9T 4M7DC 2AZVA 1OI1A 1GFCA 2L89A 4QVZA 2M0OA 3OYAA 1VUBA 2FRWA 2RO0A 2QEXT 4KBMB 1FWZA 4JJDA 1AWJA 1QCNA 3VS0A 4JS5A 3NTIA 2IVWA 1N8RU 3OMGA 2JS2A 4LUEA 4C8QC 4F7UF 4HVUA 3KBGA 4F7UB 2KT8A 5GAMe 4OF1A 2DYIA 1K0SA 1RUWA 2RK1A 3CPWA 1X01A 4A53A 4BUGA 2DBKA 4II1A 1DJ7B 3SEMA 4R55A 2EQIA 3HTRA 1QCFA 1UGPB 2QA4T 2X3XD 5CO7A 3G4SQ 1VQ5T 2EQKA 2L2PA 4IUUA 3E19A 3RR6A 1SPKA 2BKDN 1PRMC 1UDLA 1YNZA 5FW9A 5CQYA 4BDZA 1GL5A 3JCMP 2K57A 3ZBDA 2LQNA 1VQNT 1YIJA 4LDUA 4HA8A 2KAFA 2EIFA 4IURA 3CCEQ 5C6SA 3CCSQ 2RB6A 3VU3C 2ED1A 8AT1B 2X9HA 1AZEA 3CMET 2H8HA 3SWNA 2D8JA 3V8JA 4DEYA 3DLMA 2D6FA 1WYXA 3LYIA 1XQHA 3Q1JA 3RKXA 4A63B 1WZOA 5L8RE 2AK5A 4PJOF 1WQ7A 5IXBA 5CR2A 1I8FA 1U3OA 1ZSZA 3H41A 3QKJA 4KRTA 4EMKC 2YT6A 3LGFA 1IO6A 2ENMA 1M1FA 1CKBA 4C5EA 1ZLMA 1N5ZA 3RIRA 2KYBA 1ZC1A 1OU8A 1RLQC 4J6WA 1UGSB 1ZSZB 3JCMb 2FPEA 3OSVA 1NZ9A 3REBB 2ED0A 1E7OA 2AIRB 2E3IA 3VJPA 4E47A 4BB7A 1VQ7Q 2M02A 1NG2A 3QYGB 2XD0A 3CPWS 1TOVA 3CD6A 3LWHA 2GF7A 3BW1A 4XTVA 4KGVB 4EMHA 2XHCA 4X9CA 1F1BB 1TU0B 4M77B 1QVPA 4TVRA 1S1NA 4BACA 3DB4A 2QYZA 4C92E 1OV3A 1GCQA 2JXBA 4AFUC 5LJ5h 2D8HA 2LNHB 3EG9B 2DZ9A 2ZPBB 7AT1B 4WCIA 2F2VA 4J9GA 4PJNA 1O75A 2DRKA 2FVUA 4JJCA 2ESWA 1MGQA 2LQ8A 1WA7A 2YRCA 3CCUA 4OB1B 1U1SA 3QUIA 3G71A 5LJ5g 4F04B 1AWWA 3BDLA 2DPPB 4C8QD 2ZGWA 1Y96B 4RTXA 4B6MA 1Y0MA 2L3PA 3JB9F 2ZPHB 4M7DD 2KDSA 3CMAA 1MMDA 2R5AA 2FL7A 4FL6A 2E64A 2C0TA 1NJIR 3A8OB 2DERA 4KGZB 4Y91A 4ZGDB 3FPUA 3SFMA 4PJOA 5KH6A 2CSIA 2A7YA 1FMKA 1U06A 2VUBA 4C92F 2KRNA 1K9MU 1VQLT 3P8BB 3NMZC 3R6OA 4JZ4A 1ACMB 2R58A 2RQWA 4J6YA 2EJ9A 3PFSA 4FSSA 3A8HB 1KQ1A 3JCMX 3TREA 2O31A 4KUIA 1X6BA 2E1HA 5GAMj 3VRZA 2MMPA 2FRYA 3CCJT 3VS4A 2DNUA 1PNJA 4CQNA 1YWPA 1NYGA 5LJ3e 4LDWA 1VQ6T 3NTHA 1IXDA 2A28A 2KT1A 4A4FA 3UF4A 2YUNA 3CCRQ 5GAN8 4M7AC 3M0RA 2M16A 4M78F 1LVKA 1KC8U 3LW5E 4M78B 4C92G 3TU4K 3H9NA 5FWCA 5IAYA 5GAMh 3CCLA 2RI3A 3FIFA 1Y96A 4DBRA 2ZPFB 4M7AG 1Y57A 1G5VA 2KXCA 3KUFA 2A37A 1H8KA 4RMOA 4QQ6A 2DILA 1B07A 3A8GB 1RL2A 3GOXA 3GBQA 3RERA 3QZ9B 3J7AF 3M0UA 5CKFA 2NUTB 1KQSA 3I9QA 3MB5A 2HSPA 1CKAA 5FU7B 1ABOA 1NLOC 2DL4A 4OMMA 1QVGA 1K8AC 3E9FA
chains in the Genus database with same CATH topology
2OAUA 3M5AA 1BYMA 1I9GA 3QG1A 2X4XA 5B6CA 2IG0A 3JAME 4QQGA 3OYKA 2MWOA 3BY7A 2JZ2A 2RI2A 2CZ6B 4WF2A 4R56A 3OYJA 3LWIA 4ZTFA 3CCQT 2V8KA 4KUDK 2DJZA 5CK9A 1VQLA 4OB2B 2XKOC 2E6NA 4M7DA 3PIOA 2DKGA 3LX7A 2QA4A 2CZ1B 2DIGA 2RHYA 4N4GA 4DA4A 3CC4A 4IUTA 5CKEA 4M7AB 2YRVA 2BIVA 4KODA 3M59A 4V2SA 5FLXE 2DTOA 5AYFA 1VQ4A 2JTFA 4M77C 1M1KC 3QZ5B 4OGEA 3X26B 3AHUA 1CZ4A 2ZPGB 4UC4A 1YJWA 1AHJB 2LCLA 3CC2T 2DK3A 1Q7YC 5FRMA 2K5LA 2Q18X 1WGSA 3QIIA 5C1BA 3P8DA 5FROA 1BI0A 2RJFA 4KLNA 3CCJA 3GF5A 4LDVA 1EIFA 4J6XA 2JNGA 4C8QE 5CAIA 4C5GA 1WQWA 4J8OA 3JCMd 2YUJA 5LJ3h 4MZTA 1O9SA 3S6WA 2CS7A 4F7UG 2EJFA 5I2MA 1U8RA 2X4JA 4N0AA 3UDCA 4BI4A 3LGAA 4M78D 4BY6B 3X24B 3HRTA 4JRKA 1W4SA 1M4ZA 4GY5A 3M58A 4M77A 3UWNA 4B9WA 3L2VA 3CD6T 2XICA 4BE1A 1VQ4T 4ZN1A 3JCMW 2XDBA 3M4GA 3CCUA 3CCEA 3A5ZB 1QDNA 3OQ5A 3JCMf 1I5LA 3QDRB 1QVGS 5FRNA 3TCJA 2XIDA 1M8VA 5A0GA 1KQ2A 1QP3A 3JB9H 5KE3A 3QYHB 2EQMA 2LQKA 4OP0A 3OBWA 3PTAA 1YITT 1Y7XA 4M78E 4JRPA 4MZPA 5LJ3f 2K2VA 4Q5WA 5LJ3j 5EQJB 2RHIA 2LVMA 4JDSA 2NLUA 1LNXA 4O6JA 3JB9J 5CCXA 4C8QF 3SDZA 4XTYA 3RMQA 3PMIA 4HCBA 4C0DB 2KY9A 5I21A 2R5MA 2EQUA 4RG2A 3SWNB 4IUVA 3RKWA 3ZJTA 1PSEA 3OMCA 3V8KA 5GMKj 1BIBA 2EJGA 1VQ9A 5GMKl 3FDRA 3OS5A 3JCMg 2BUDA 2CYZB 2PUKB 3T9NA 2QQSA 3PIPA 3QPHA 5A0LA 3H8ZA 1QW1A 2QI2A 4KULA 4HT9A 2M1HA 5FTKA 2PUOB 2Y90A 4FU6A 5GAMf 4M7AD 5GANf 3QO3A 3L2QA 1M90U 2Y4YA 4EMKB 2LCCA 2P4TA 5GANj 3GNFB 3ZJVA 3ZGZA 3P8HA 4NOYA 5FU6C 1W2BA 5FTNA 2VGMA 1XTDA 4RCCA 1UGRB 5D6YA 3X25B 4QVCA 2EWNA 3CCQA 4PJOD 4B9XA 3HU1A 3MP1A 1YJ9T 3URGA 3HKSA 1NPPA 4RV0A 4J83A 4BDYA 3PT9A 4ATOA 1QP2A 5GMKh 3LH0A 4JS4A 4JLGA 5KCOA 3BQBA 3SWNC 1UEBA 5DLQE 1LOJA 3L42A 3X20B 3CBMA 4E7JA 4N0AC 1S72A 3CMAT 4C0DC 5DM7R 1K73C 2PWYA 4N4HA 4XU0A 3QSUA 3QQ7A 3L2ZA 4C5IA 5CD1A 4M75A 2XG8D 4X9DA 5KCHA 2RH2A 3OYCA 3G7ZA 1KHCA 3VYGA 1G3TA 2RJEA 5LJ5j 3L2RA 4MDXA 2DEQA 2XDDA 3VYHB 3OYHA 4M7DF 4ELYC 4LDXA 3MEAA 3CCVT 1H3ZA 1B34B 2DTHA 3I56T 3UPUA 2E10A 2E41A 2VGNA 3GLXA 1KD1C 3LLRA 2E12A 2HBPA 2L5QA 4QQDA 1VQPA 4XAXB 1M5Q1 2DD5A 4JRIA 2K4YA 1IZ6A 2JTMA 1N9SA 3MO8A 4MMLA 3CC7A 4J7FA 3QWZA 4ZN3A 3L2UA 3OS2A 5FTMA 4P5NA 1G3YA 2E70A 3A8MB 5C0MA 2WSCE 3FRNA 5CQXA 4BE0A 2DVEA 3V8LA 1KHIA 5IT9E 3HPWA 2XU8A 3QBYA 4J5YA 3ZFJA 2YLBA 3JCMJ 4PJOG 3OS1A 1P92A 3JB9I 3X28B 2O4XA 2E6ZA 3FEOA 5D6WA 3TIWA 5CCBA 3CXCA 4OMFB 2JV2A 4KT0E 5LJ3d 1QCSA 1VQKA 4Y28E 2K5FA 3G6EA 1VQ6A 4KDLA 3LHDA 3QXEB 3HP9A 2K3YA 4M7DE 5LJ5d 3QJ6A 4M77D 3ME9A 5IN1A 3WVEB 4EPCA 2LW6A 3CBPA 3CCRA 3OA6A 5A2QE 1Y07A 2ZPEB 5GANe 1NPRA 2HQEA 2DXBA 2RI5A 4L5GA 3OYEA 1VQ7T 4A4GA 5A0DA 2XDPA 2ZPIB 3FJPA 4IUQA 4MMKA 1VQOT 2YLCA 4AS1A 1E32A 3MCAB 2PVDB 3WXMB 4ELZC 1VQ9T 1B34A 2L8DA 4EMKA 1OI1A 3JSCA 1Q81U 2L89A 3RESA 4C5HA 5D6XA 3QQ8A 2I2LA 4QVZA 2M0OA 5FTLA 2EFIA 3OYAA 4ARIA 5GAN5 2P0QA 1VUBA 2CZ7B 2RO0A 2QEXT 3M54A 3OYYA 4KBMB 4XTZA 5DYIA 3LGLA 4JJNK 1FWZA 2D0QB 2E5QA 4E7HA 5GAOn 4JS5A 2RK2A 1R7RA 2JN0A 2O01E 3NTIA 3HL8A 3OBYA 1HK9A 5GMKm 3M55A 4LDYA 2IVWA 3ZJUA 2O4XB 5GAOm 2ZCFB 1N8RU 5CKDA 3OMGA 3DKMA 1FX7A 1WNLA 2EYQA 1VQMA 3BFMA 2RHXA 3M56A 1S72T 2PU9B 4C8QC 1IREB 1VQ8A 2Q1CX 4F7UF 3OYIA 2P0KA 3J81E 1YHQA 4ARCA 4IKFA 1PSFA 3KBGA 3CF2A 4E7KA 4F7UB 4OB3B 5GAOr 1H641 3M9QA 4M78G 5GAMe 4BE2A 4QW2A 1YI2A 3QC8A 2X35A 2QQ9A 4OF1A 4M7DB 5ERGB 2RK1A 3JCMV 3FB9A 2RD1A 1WLFA 3CPWA 1X01A 4XTWA 4BY6C 4A53A 4BUGA 3I56A 4II1A 1DJ7B 2ZZDA 4R55A 1VQPT 3S3MA 1UGPB 2QA4T 3CC7T 3JCMc 5CO7A 2DXUA 2MF2A 2FB7A 4M75B 3CC4T 2PVOB 4XU3A 3HFOA 5GAMg 2EQKA 3S3NA 1GXIE 1KG1A 4IUUA 4M75D 3I55A 3E19A 3HU2A 3V7CA 4M75C 2BKDN 5FTJA 2WSEE 1UGQB 2P0PA 3GIBA 2A3LA 3FLGA 1BI2A 2CGHA 1X75C 4EDUA 5CQYA 3OYLA 3JRZA 2LX9A 4BDZA 1BI1A 1K9MC 3VUBA 1JBMA 1K73U 3JCMe 3JCMP 2K57A 1VQKT 3OYFA 3ZBDA 1VQNT 2RJDA 5LL6S 4A54A 5J26A 4FT4A 1YIJA 3HSBA 4LDUA 2QQRA 4HA8A 1FXXA 4A4KA 5GAMd 1N27A 2KAFA 3RMSA 3ER0A 4NL3A 3OW2S 3UT1A 3G4ST 2OTLA 1G3SA 2EIFA 4KO8A 4IURA 3E1SA 1VQ7A 4XTUA 3WVDB 4M7DC 3OY9A 3I55T 5LJ3g 2F5KA 2HAXA 1ZQ1A 1MHNA 5C6SA 3CPFA 2VXFA 2RB6A 3VU3C 2PVGB 3MEUA 4BI8B 5GAN7 3OB9A 1K8AU 2DZCA 5HK0A 3QHSA 2DTIA 3CMET 1SSFA 3EFRA 3SWNA 2RHZA 2XI9A 4XK8E 4OGCA 5FU6B 3V8JA 5GAN4 3CXCS 3G71T 4E7LA 3DLMA 1WJQA 2D6FA 4M77E 3LYIA 4F7UA 2WSFE 2MI6A 3S3OA 1BIAA 1XQHA 3Q1JA 2LT4A 1VIFA 4M75E 3RKXA 3ZEHA 4M7AA 4PLIA 2LNVA 5L8RE 2D9TA 4PJOF 4XU1A 3OW2A 4AQ7A 1WQ7A 4RG8A 2G3RA 3V7RA 4C92D 3MEWA 5CR2A 1ZHIA 3G4SA 1Q82C 2EAYA 1I8FA 2WACA 4BD3A 4LD9K 3QKJA 3MP8A 3QJYA 1JRIA 1CR5A 2AHJB 3C94A 4EMKC 2HQXA 4HKEA 3LGFA 2JVVA 2RM4A 4O5VA 4VUBA 1M1FA 3NTKA 5EPPA 1G3WA 2GFAA 4C5EA 1Y71A 1VIEA 2VXEA 2KSSA 4HT8A 3GPLA 3CC2A 3OS0A 3RIRA 3VKIA 4D6WA 2K3XA 4F7UE 1ZC1A 2RA2A 3HU3A 4J6WA 2DIQA 1KD1U 1KQSS 1UGSB 3L2WA 1W2BS 4FT2A 3A8LB 3JCMb 2JOYA 1JJ2A 4L6V5 3INZA 4M78C 4ZGEB 3OSVA 4JUVA 1NZ9A 4NS5A 5EG2A 3FPRA 3RKYA 3CCRT 1YJ9A 4E47A 3VJPA 1WJSA 4M75G 2RHUA 4BB7A 2QQAA 3SB2A 3QYGB 2XD0A 3OYMA 3CPWS 2F5TX 3CD6A 1RI0A 3NFCA 3LWHA 3CCSA 2OTJA 2GF7A 3BW1A 2QTXA 4MZMA 4XTVA 2FHDA 4PJOC 3M53A 3PNWC 4EMHA 5GAOl 3OYBA 2XHCA 4X9CA 5DY9A 1Q86U 2DXCA 1YBYA 3RUXA 5I2SA 2MWPA 1QVPA 3C4SA 2MAMA 4M77B 4TVRA 3VV0A 4M77G 4BACA 1Q81C 4RKUE 3DB4A 2HD0A 3EFSA 4C92E 1Q7YU 1OZ2A 2MM2A 5LJ5h 5GANg 4M78A 1NE8A 4PJOE 3H6ZA 1M90C 2EQJA 2DZ9A 2ZPBB 2CZ0B 4QVDA 2KMTA 2YHTA 2V8IA 4Z02A 5GAOp 2L3RA 2RJCA 1VQ8T 1O75A 2FVUA 2GCXA 3CCMA 4N4IA 1NJIC 3CBOA 3CEYA 3M57A 3GNGA 4NL2A 1MGQA 2LQ8A 3L1AA 1YJWT 2DXTA 2K5IA 3MHXA 4OB0B 2Y4XA 2B8AA 3F70A 5HKCA 5LJ5f 2VV5A 4OB1B 1U1SA 5CIUA 3QUIA 4C8QA 5LJ5g 5GANh 3G71A 3JB9G 1D3BA 4ZTJA 3BDLA 5HK3A 3MEVA 5GAOq 2LT1A 2MM0A 1BI3A 3G6ET 1QVFA 5J39A 2DPPB 2DD4A 2LRQA 4OVAA 1OYXA 3HHTB 4C8QD 5KE2A 2Q19X 4C0FA 3C12A 5GMKe 2ZGWA 3J80E 5GANd 1Y96B 2DO3A 1U1TA 2KK4A 3JB9F 5GMKi 5GAN2 4XQ3A 1M1KU 2GFUA 5GLFA 2ZPHB 3C95A 4M7DD 2KDSA 3CMAA 2EKOA 4DQ2A 1I4K1 1N6AA 2R5AA 2FL7A 1XNIA 2FYKA 4C0ZA 3CCET 1QVFS 3PMTA 4FL6A 2QDYB 1YJNT 2E64A 3OYNA 2C06A 3A8OB 1YITA 4Y91A 3DB3A 4ZGDB 1Q86C 3FPUA 3SFMA 1JB0E 4PJOA 2CKKA 5KH6A 1I81A 2A7YA 1YCYA 4PKCC 4A4HA 4EMGA 1N9RA 2R57A 2VUBA 3VUZA 4C92F 3CCVA 4E7IA 5M9OA 3OYDA 4PL6A 3TEEA 4CRIA 1OZ3A 4HCZA 4C92C 1YIJT 1K9MU 2QQBA 2JUFA 4DOVA 1VQ5T 1VQLT 2V8JA 4JRQA 3P8BB 4M7AF 4M7DG 3R6OA 2OTLT 1M9SA 2R58A 3OYGA 4M75F 1VQMT 4J6YA 2X4YA 2KVQG 2EJ9A 3PFSA 3A8HB 1KQ1A 3JCMX 4JLIA 3N5BB 4X34A 3TREA 4ZGJB 4M77F 5GAN3 4KUIA 4FM4B 3CMEA 1KC8C 1UB4A 2XK0A 4FIBA 3CCLT 4LD6A 4RCBA 2E1HA 5GAMj 1WPYA 4FSXA 5CCAA 2MMPA 3CCJT 2Q1AX 3JCMQ 1M1GA 2HNIA 4CQNA 1R8OB 2M9UA 1LJOA 1X6OA 5LJ3e 4LDWA 4C92B 3NTHA 1N8RC 1VQ6T 1S3SA 3V7SA 3DLLA 1XOVA 5LJ5e 2VYTA 4PJOB 4A4FA 3O8VA 4PNOA 2PJHB 1VQ5A 2LC4A 3HRUA 3PGGA 5GAN8 1ZBXA 4M7AC 2M16A 3OSSC 1VQOA 5DLOA 4M78F 1KC8U 4HCCA 3CCMT 1JJ2S 4XTXA 3E9GA 5CKBA 5DYGA 3LW5E 4M78B 4C92G 2E65A 2VC8A 3TU4K 4M7AE 4YTLA 4IUPA 1WJRA 3BDUA 3MP6A 5IAYA 5C18A 5GAMh 2QXFA 3HRSA 3CCUT 1HXDA 2RI3A 3FIFA 4C8QG 3CCLA 1Y96A 2QEXA 2ZPFB 4M7AG 4A4EA 3FC3A 1G5VA 3KUFA 1V29B 3M4YA 5CKHA 3HFNA 2Q1DX 3JB9D 3FPTA 4DOWA 1VQNA 4CI0C 4C0GA 4RMOA 1Q82U 4QQ6A 3A8GB 2H3JA 2GQVA 1RL2A 3ASKA 4XU2A 5FU7C 3GOXA 3GP8A 2PQWA 3QZ9B 3RERA 1D3BB 3J7AF 1CZ5A 5HY6A 4C8QB 5GAN6 5CKFA 3KXTA 2X4WA 2LTOA 4GLKA 4MDWA 2F69A 4PLLA 1KQSA 4ME7A 2YVLA 3CCST 2OTJT 1TH7A 3JCMh 4C92A 3META 1BKBA 1O54A 3MB5A 2KQWA 3SD4A 1YHQT 4L59A 2LDMA 5CVIA 5J3BA 4KDIA 1YJNA 2DAQA 5FU7B 3EAEA 1YI2T 1NJIU 1QVGA 4BI3A 1K8AC 3E9FA 2B25A 4J7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHC A;  3L2R A;  2RJE A;  5CIU A;  4BDZ A;  2X4X A;  4ZTJ A;  3BDL A;  2IG0 A;  3MEV A;  4QQG A;  3OYK A;  3MEA A;  3OYH A;  1H3Z A;  2MWO A;  2JZ2 A;  2RI2 A;  3OYF A;  5J39 A;  4OVA A;  3OYJ A;  2LRQ A;  2RJD A;  1OYX A;  5J26 A;  3LLR A;  5KE2 A;  4QQD A;  4ZTF A;  2QQR A;  1N27 A;  2E6N A;  3UT1 A;  3LX7 A;  3MO8 A;  4IUR A;  2DIG A;  2RHY A;  4N4G A;  3L2U A;  4IUT A;  3OS2 A;  3OY9 A;  2YRV A;  2GFU A;  2BIV A;  5C0M A;  2F5K A;  4BE0 A;  1MHN A;  5C6S A;  2JTF A;  2EKO A;  2R5A A;  3MEU A;  1XNI A;  3OB9 A;  3PMT A;  4FL6 A;  4UC4 A;  3QBY A;  3OYN A;  1SSF A;  5FRM A;  2RHZ A;  3OS1 A;  1WGS A;  3QII A;  2O4X A;  3DB3 A;  3P8D A;  5FRO A;  3FEO A;  5D6W A;  2RJF A;  2CKK A;  5KH6 A;  4E7L A;  4EDU A;  3DLM A;  1WJQ A;  4A4H A;  4E7I A;  3LYI A;  2R57 A;  4C5G A;  3S3O A;  3ZEH A;  3Q1J A;  5M9O A;  3OYD A;  4PL6 A;  3S6W A;  2K3Y A;  4PLI A;  4CRI A;  1OZ3 A;  3QJ6 A;  4HCZ A;  3ME9 A;  2D9T A;  5IN1 A;  3OA6 A;  2G3R A;  3MEW A;  2HQE A;  2RI5 A;  2WAC A;  3OYE A;  4BD3 A;  2R58 A;  4GY5 A;  3UWN A;  3QKJ A;  2XDP A;  4A4G A;  3MP8 A;  4B9W A;  3OYG A;  4IUQ A;  3L2V A;  2X4Y A;  2HQX A;  3LGF A;  4BE1 A;  3PFS A;  4X34 A;  2L8D A;  3NTK A;  1OI1 A;  2GFA A;  3OQ5 A;  2L89 A;  4C5E A;  4C5H A;  5D6X A;  5FRN A;  4QVZ A;  2M0O A;  2EFI A;  5KE3 A;  3OYA A;  2EQM A;  2XK0 A;  3OS0 A;  4LD6 A;  2RO0 A;  2K3X A;  3LGL A;  2DIQ A;  4E7H A;  2E5Q A;  4Q5W A;  3L2W A;  2RHI A;  2LVM A;  2NLU A;  3NTH A;  3NTI A;  4NS5 A;  2VYT A;  3PMI A;  4A4F A;  3O8V A;  1WJS A;  2O4X B;  2RHU A;  2R5M A;  3OMG A;  2EQU A;  4RG2 A;  4IUV A;  3OYM A;  3OMC A;  1RI0 A;  2M16 A;  2RHX A;  2GF7 A;  3OYI A;  2FHD A;  2P0K A;  3FDR A;  3PNW C;  4IKF A;  3OYB A;  3E9G A;  2BUD A;  2QQS A;  4E7K A;  2MWP A;  3C4S A;  3H8Z A;  3M9Q A;  4IUP A;  1WJR A;  3MP6 A;  4QW2 A;  5IAY A;  4BE2 A;  2X35 A;  2M1H A;  4BAC A;  2RI3 A;  3DB4 A;  4FU6 A;  3L2Q A;  1OZ2 A;  4A4E A;  3FC3 A;  1G5V A;  2LCC A;  3KUF A;  3P8H A;  3H6Z A;  5D6Y A;  4II1 A;  4QQ6 A;  3ASK A;  3GOX A;  2EQJ A;  4B9X A;  2PQW A;  3MP1 A;  3S3M A;  4BDY A;  2X4W A;  3LH0 A;  2LTO A;  3S3N A;  5KCO A;  2EQK A;  4PLL A;  4IUU A;  4Z02 A;  2L3R A;  2RJC A;  3L42 A;  4E7J A;  3MET A;  4N4H A;  2BKD N;  3SD4 A;  4L59 A;  2LDM A;  4N4I A;  3CEY A;  4C5I A;  2DAQ A;  3EAE A;  5KCH A;  3FLG A;  3OYC A;  3E9F A;  2B8A A;  3F70 A;  3OYL A; 
#chains in the Genus database with same CATH topology
 2OAU A;  1I9G A;  2P4R A;  5B6C A;  3LWI A;  4R56 A;  3OYJ A;  3CCQ T;  4KUD K;  2NUP B;  2DKG A;  2QA4 A;  4N4G A;  3CC4 A;  4DA4 A;  5CKE A;  2DTO A;  4M77 C;  4HVW A;  4AG2 C;  1OEB A;  3AHU A;  1CZ4 A;  3EFO A;  1QKX A;  2DX1 A;  1AHJ B;  2LCL A;  3CC2 T;  2DK3 A;  2K5L A;  1WGS A;  1K76 A;  1ZBJ A;  2V26 A;  5FRO A;  1D1C A;  4KLN A;  3CCJ A;  5I11 A;  3GF5 A;  4LDV A;  4C5G A;  3JCM d;  2X4J A;  3UDC A;  4BI4 A;  4BY6 B;  2SEM A;  3HRT A;  1T3S A;  4M77 A;  1SHF A;  2KNB B;  4B9W A;  1OU9 A;  2XIC A;  4BE1 A;  1S72 Q;  3CCE A;  1W1F A;  1I5L A;  3JCM f;  2GNC A;  3QDR B;  2XID A;  5A0G A;  2EQM A;  3PTA A;  3CCL Q;  1YIT T;  1SG5 A;  2K2V A;  5LJ3 j;  2EGC A;  2NLU A;  1LNX A;  3JB9 J;  1Q81 R;  1D0Y A;  1M27 C;  4HCB A;  4C0D B;  2QGF B;  4PFP A;  5I21 A;  2R5M A;  2DFU A;  2EQU A;  3SWN B;  3RKW A;  2RQU A;  1SRL A;  2EJG A;  3JCM g;  1FMW A;  5A0L A;  4HT9 A;  1QW1 A;  2QI2 A;  2Y90 A;  4FU6 A;  3NHN A;  3QO3 A;  2Y4Y A;  4EMK B;  3P8H A;  1XTD A;  4RCC A;  1VQK Q;  1V76 A;  1TWB A;  1AD5 A;  3HKS A;  4BDY A;  3PT9 A;  1QP2 A;  4CC4 B;  3SWN C;  2EVR A;  1LOJ A;  3L42 A;  5DLQ E;  3X20 B;  4RUG A;  4C0D C;  3AT1 B;  2JM9 A;  5IH2 A;  4M75 A;  2XG8 D;  2QGG A;  3OYC A;  1EFN A;  3VYG A;  5LJ5 j;  2JMC A;  2KYM A;  2DEQ A;  1B34 B;  2L0A A;  1RAF B;  3VS2 A;  1KD1 C;  1VQP A;  1M5Q 1;  2DD5 A;  4MML A;  2HKQ B;  2LJ3 A;  4P5N A;  2DVE A;  3PVL A;  1KHI A;  3EGX B;  3H0I A;  4J5Y A;  1PD1 A;  1PG5 B;  1VYU A;  3OS1 A;  1IGQ A;  2NUZ A;  3X28 B;  2J6O A;  2E6Z A;  3FEO A;  5D6W A;  5CCB A;  1BCM A;  4OMF B;  2K5F A;  3G6E A;  2GQI A;  5KYX B;  3HP9 A;  5LJ5 d;  2DLP A;  3ME9 A;  5IN1 A;  4EPC A;  3FJ5 A;  2LW6 A;  2MPX C;  4FYY B;  2DXB A;  3OYE A;  2XDP A;  2ZPI B;  4IUQ A;  2YLC A;  2JW4 A;  1TXQ A;  1GCQ C;  1E32 A;  2I2L A;  1FYN A;  3PE0 A;  2P0Q A;  2CZ7 B;  1UEC A;  3OYY A;  1KK7 A;  2YUP A;  2D0Q B;  2BTT A;  3UAT A;  1R7R A;  4QKU A;  1BB9 A;  3HL8 A;  3OBY A;  3M55 A;  1KJW A;  2O4X B;  2DYB A;  1FX7 A;  4J9C A;  1KC8 R;  5IXF A;  2EYQ A;  2GTJ A;  1VQM A;  2LMJ A;  1IRE B;  1YHQ A;  3IQL A;  5GAO r;  1RLP C;  4M78 G;  3CC2 Q;  3QC8 A;  1TS9 A;  4M7D B;  1YFN A;  4D8D A;  1QVG P;  2FPF A;  1W2B P;  1VQ6 Q;  1AWX A;  4J9I A;  3I35 A;  1RAH B;  2ZZD A;  3H0H A;  2EW3 A;  3S3M A;  1YJ9 Q;  1OX8 A;  2CT3 A;  3CC7 T;  2DXU A;  2K6D A;  2FB7 A;  2MF2 A;  1KG1 A;  4M75 D;  3I55 A;  2FZC B;  1M3C A;  2M0Y A;  5FTJ A;  1UGQ B;  2P0P A;  3GIB A;  2CGH A;  1X75 C;  2LX9 A;  1BI1 A;  1K9M C;  4HVV A;  1AEY A;  5LL6 S;  3UA6 A;  2C0I A;  3HSB A;  2QQR A;  2O2O A;  4NL3 A;  3OW2 S;  1G3S A;  2V1R A;  1MNE A;  3OY9 A;  1ZQ1 A;  5IHK A;  1MHN A;  4BI8 B;  1K8A U;  5HK0 A;  1PWT A;  1E6H A;  3EFR A;  2RHZ A;  2XI9 A;  5FU6 B;  3CXC S;  4E7L A;  5EC7 A;  4M77 E;  3A98 A;  2MI6 A;  2QAZ A;  1BIA A;  3ZEH A;  4IIM A;  2IPO B;  4PLI A;  2LNV A;  4XU1 A;  2W10 A;  1QWE A;  2HKN A;  1Q82 C;  3G4S A;  4D8K A;  2WAC A;  4LD9 K;  4BD3 A;  1VQL Q;  3MP8 A;  3QJY A;  2AHJ B;  2FZK B;  4PFO A;  4AMC A;  4HT8 A;  3GPL A;  4J9B A;  3VKI A;  4OMP A;  3L2W A;  2O9V A;  2DM1 A;  3CCJ Q;  1IB8 A;  2HZY A;  4JUV A;  5EG2 A;  4NS5 A;  2OTL Q;  3FPR A;  3RKY A;  2QQA A;  3OYM A;  1T0J A;  3CCS A;  2QTX A;  3QWX X;  4PJO C;  1J3T A;  3PNW C;  5DY9 A;  1Q86 U;  1WI7 A;  1M2O A;  1D0X A;  2MM2 A;  5D7U A;  1NE8 A;  4GLM A;  4HXJ A;  4AFS C;  1M90 C;  2EQJ A;  1TSF A;  1TUC A;  1YJN Q;  2V8I A;  1A0N B;  1N8R R;  4Z02 A;  5GAO p;  2RJC A;  2GCX A;  1YJW T;  1ZSZ C;  2V1Q A;  1K73 U;  5HKC A;  4AG1 C;  5GAN h;  4C8Q A;  2CP3 A;  4ZTJ A;  2KGT A;  2BE7 D;  1QVF A;  3HHT B;  3C12 A;  3LH5 A;  5GAN d;  2JT4 A;  3U23 A;  2A36 A;  2AZS A;  2CP5 A;  5GMK i;  3EG3 A;  1W70 A;  4XQ3 A;  5KYU A;  4PJJ A;  4C0Z A;  1N6A A;  2FYK A;  1QVF S;  3EGU A;  2VVK A;  2CT4 A;  4R0K A;  2F2W A;  1E6G A;  1G8X A;  1RAI B;  2DL8 A;  1JB0 E;  1ZUU A;  4EMG A;  4PKC C;  4E7I A;  5M9O A;  4PL6 A;  3SHW A;  2D1X A;  4HCZ A;  4CC3 A;  4C92 C;  2B86 A;  1YWO A;  4M7D G;  2OTL T;  1M2V B;  1VYV A;  9ATC B;  5GAN 3;  2ECZ A;  3CCL T;  4LD6 A;  1MMG A;  4IIO A;  1SRM A;  4ZNX A;  1WPY A;  5CCA A;  3JCM Q;  1M1G A;  2HNI A;  1S3S A;  2E3H A;  1U5S A;  4PNO A;  2PJH B;  2HL3 A;  1R0B G;  3OSS C;  5DLO A;  2EYY A;  5DYG A;  2E65 A;  2GBQ A;  2VC8 A;  4M7A E;  4YTL A;  2DEU A;  1YJW Q;  3CCU T;  4C8Q G;  1KSW A;  2QEX A;  2CP2 A;  1JXM A;  1ZA1 B;  2KXD A;  2K7A A;  1M3B A;  3HFN A;  4DOW A;  4C0G A;  4XU2 A;  3ASK A;  5FU7 C;  1ZX6 A;  2YXY A;  3MKD A;  4C8Q B;  5GAN 6;  2CP0 A;  1PM3 A;  4K11 A;  2X4W A;  2LTO A;  2PNI A;  4PLL A;  2OTJ T;  1O54 A;  4L59 A;  2LDM A;  5CVI A;  5J3B A;  1VQ8 Q;  1UGV A;  2ROL A;  4BI3 A;  2K2M A;  2JM8 A;  5GAM d;  1QCO A;  1M2V A;  1RAC B;  3G71 Q;  2V8K A;  1ARK A;  2DJZ A;  1VQL A;  4OB2 B;  3PIO A;  3LX7 A;  2CZ1 B;  4FYX B;  2RHY A;  1MND A;  3M0T A;  4M7A B;  2YRV A;  2BIV A;  2LP5 A;  4UC4 A;  2AKL A;  1Q7Y C;  3R6N A;  3QII A;  1PCX A;  1B7T A;  1BI0 A;  2RJF A;  1VA7 A;  4C8Q E;  2JNG A;  1WQW A;  4J8O A;  5LJ3 h;  4MZT A;  1O9S A;  3S6W A;  2HL5 C;  4DEX A;  1W4S A;  1NEG A;  1PKT A;  1VQ4 T;  1YCS B;  3JCM W;  1KQ2 A;  2ROT A;  1RAE B;  3OBW A;  1Y7X A;  1JQQ A;  4LE9 A;  4MZP A;  1QMC A;  1G83 A;  4Q5W A;  2CP7 A;  1GBQ A;  5CCX A;  2KY9 A;  3CQT A;  3RBB B;  1W6X A;  1JEG A;  1PSE A;  4KH1 B;  3OMC A;  5GMK j;  1BIB A;  1WX6 A;  5GMK l;  3PIP A;  3REA B;  3H8Z A;  4KUL A;  1M8M A;  2M1H A;  4RTU A;  3ZJV A;  1W2B A;  5D6Y A;  2KBT A;  3CCQ A;  2EWN A;  4B9X A;  5KYW B;  1NPP A;  1X6G A;  5GMK h;  3LH0 A;  5KCO A;  3BQB A;  1UEB A;  2ABL A;  1S72 A;  2PWY A;  4N4H A;  2OAW A;  4XU0 A;  4C5I A;  3EH2 A;  5KCH A;  1UHF A;  3G7Z A;  1KHC A;  4MDX A;  4RTZ A;  3TSW A;  2XDD A;  3EGX A;  3OYH A;  4LDX A;  3CCV T;  1M90 R;  2QK0 A;  3I56 T;  3UPU A;  3GLX A;  2L5Q A;  4XAX B;  1M30 A;  4JRI A;  2JTM A;  1N9S A;  3QWZ A;  2RF0 A;  1RAA B;  3L2U A;  4F14 A;  3A8M B;  5KYX A;  1M3A A;  5GJV B;  4AFQ C;  4BE0 A;  3V8L A;  5IT9 E;  1OPK A;  3CC4 Q;  2YLB A;  1P92 A;  2H3E B;  1UE9 A;  2O4X A;  1WFW A;  2EGA A;  4E7S A;  3CXC A;  4KT0 E;  1QCS A;  1VQK A;  4DBQ A;  4KDL A;  3LHD A;  2HDA A;  4M7D E;  3OA6 A;  1Y07 A;  2HQE A;  1VQ7 T;  5IHN A;  3FJP A;  2LQW A;  1UG1 A;  1VQO T;  4AS1 A;  3TVT A;  3MCA B;  2PVD B;  4M7A F;  2L8D A;  4EMK A;  3JSC A;  3QQ8 A;  3RES A;  5D6X A;  5FTL A;  2EFI A;  2AT1 B;  1OUL A;  5GAN 5;  5DYI A;  3M54 A;  2COZ A;  3LGL A;  1K1Z A;  3VRY A;  5GAO n;  2RK2 A;  1AZG B;  1HK9 A;  3VS3 A;  4LDY A;  3ZJU A;  5GAO m;  1WNL A;  3BFM A;  1VQ8 A;  1NBE B;  4OMQ A;  2Q1C X;  4KGX B;  4E7K A;  4OB3 B;  3M9Q A;  4QW2 A;  5ERG B;  3CME Q;  3FB9 A;  1WLF A;  4XTW A;  4BY6 C;  2ZAE A;  1VQP T;  2X51 A;  3QWY A;  1C6V X;  1RAD B;  3JCM c;  4XU3 A;  3HFO A;  3S3N A;  1GXI E;  3HU2 A;  3V7C A;  1WHH A;  4ESR A;  2WSE E;  2C0O A;  2VWF A;  2RQR A;  2A3L A;  1M1K R;  3JRZ A;  4PJM A;  1UTI A;  3VUB A;  2QAS A;  3OYF A;  4A54 A;  5J26 A;  4FT4 A;  1X2K A;  1N27 A;  3ER0 A;  3UT1 A;  4KO8 A;  3E1S A;  1MUZ A;  4XTU A;  3WVD B;  1UFF A;  6AT1 B;  5LJ3 g;  3CPF A;  2VXF A;  2OTJ Q;  1QKW A;  5GAN 7;  2J7I A;  2DZC A;  2DTI A;  1SSF A;  5L23 A;  5GAN 4;  4OGC A;  2COW A;  4F7U A;  3S3O A;  4M75 E;  1VOM A;  2LT4 A;  4AQ7 A;  1YN8 A;  4J9D A;  1CR5 A;  3C94 A;  2HQX A;  4HKE A;  2MK5 A;  4VUB A;  3NTK A;  2GFA A;  1Y71 A;  2VXE A;  4QT7 A;  3CC2 A;  4WTO B;  1YIT Q;  2K3X A;  4F7U E;  2RA2 A;  1UUE A;  1KQS S;  1W2B S;  4FT2 A;  1PRL C;  2JOY A;  4L6V 5;  3INZ A;  4ZGE B;  3UA7 A;  3CCR T;  1YJ9 A;  1WHM A;  1X27 A;  2BZX A;  3SB2 A;  1UJ0 A;  1HSQ A;  2F5T X;  1AT1 B;  3M53 A;  2FG0 A;  3CMA Q;  3EG1 A;  5GAO l;  3EGD B;  3RUX A;  1YBY A;  1JO8 A;  5I2S A;  1K73 R;  3C4S A;  2MAM A;  3VV0 A;  4M77 G;  3MJX A;  1Q81 C;  1OZ2 A;  1V1C A;  4QVD A;  2YHT A;  3CCM A;  1C1A A;  1NJI C;  3CBO A;  3CEY A;  2KRO A;  3GNG A;  2BZY A;  3L1A A;  2DXT A;  2K5I A;  4OB0 B;  3MHX A;  2Y4X A;  3F70 A;  2VV5 A;  5CIU A;  3JB9 G;  2L3Q A;  1D3B A;  5HK3 A;  3EHQ A;  3MEV A;  2LT1 A;  2MM0 A;  2F1L A;  1BI3 A;  4OVA A;  3CXC P;  1OYX A;  5KE2 A;  4C0F A;  5GMK e;  3J80 E;  1TUD A;  1ZUK A;  2DO3 A;  1U1T A;  2KK4 A;  5KYN A;  1YIJ Q;  1M1K U;  2GFU A;  3C95 A;  2EKO A;  3E2U A;  4DQ2 A;  2J05 A;  3CCE T;  3PMT A;  1YJN T;  2QDY B;  4M4Z A;  2NUT A;  4Z89 A;  1YIT A;  3DB3 A;  1Q86 C;  1WHK A;  2CKK A;  1KD1 R;  1YCY A;  4A4H A;  2R57 A;  3NPF A;  3TEE A;  1YIJ T;  1OZ3 A;  4DOV A;  2V8J A;  1ZUY A;  1M9S A;  2E4H A;  2M51 A;  4M75 F;  3EG9 A;  2X4Y A;  2KRM A;  1SEM A;  4GBQ A;  1JXO A;  1Q95 G;  3CME A;  1NM7 A;  1UB4 A;  2E5K A;  4FIB A;  1K0X A;  2Q1A X;  1R8O B;  2M9U A;  1HJD A;  1LJO A;  1X6O A;  1N8R C;  4PJO B;  1WHG A;  2DL5 A;  3O8V A;  1I0C A;  3HRU A;  3PGG A;  1ZBX A;  1AWO A;  1WXB A;  3CCM Q;  3O5Z A;  3CCM T;  4XTX A;  3E9G A;  2RN8 A;  1WJR A;  3MP6 A;  1GFD A;  1OOT A;  2QXF A;  3HRS A;  1HXD A;  1GRI A;  4A4E A;  3FC3 A;  4LN2 A;  3M4Y A;  5CKH A;  2Q1D X;  1VQN A;  2GQV A;  1D1A A;  3GP8 A;  1CZ5 A;  1D3B B;  5HY6 A;  4PK4 A;  3C0C A;  3KXT A;  1TG0 A;  4GLK A;  2F69 A;  2EYW A;  4C92 A;  3JCM h;  3MET A;  1BKB A;  4KDI A;  2KQW A;  3SD4 A;  1YHQ T;  2O88 A;  1YJN A;  3EAE A;  2B25 A;  4J7I A;  2MYS A;  1UJY A;  1BYM A;  3QG1 A;  4J9E A;  4J9H A;  2HCK A;  1YI2 Q;  1EX4 A;  4FYW B;  2IG0 A;  3JAM E;  4QQG A;  2MWO A;  2JZ2 A;  2CZ6 B;  1BU1 A;  5CK9 A;  4M7D A;  3BE3 A;  2DIG A;  1IHV A;  4IUT A;  1B3Q A;  3VS1 A;  1VYT A;  1PC0 A;  3M59 A;  5FLX E;  4V2S A;  5AYF A;  1VQ4 A;  2JTF A;  3QZ5 B;  2JTE A;  4OGE A;  1Q82 R;  1GCP A;  2CH4 W;  2ZPG B;  1YJW A;  5KYY B;  3THK A;  5C1B A;  4J6X A;  2DJQ A;  2YUJ A;  2J06 A;  4M78 D;  1I07 A;  4JRK A;  1M4Z A;  1T0H A;  3CD6 T;  1JU5 C;  2DET A;  2RMO A;  2XDB A;  3M4G A;  1ZA2 B;  5FRN A;  3TCJ A;  3EHR A;  1M8V A;  1QP3 A;  3QYH B;  2LQK A;  4OP0 A;  2DRM A;  4JRP A;  2L3S A;  5LJ3 f;  2CDT A;  2LVM A;  4JDS A;  4O6J A;  3SDZ A;  3RMQ A;  1Z9Q A;  1VQM Q;  2QA4 Q;  1CSK A;  4LUD A;  4AT1 B;  1R0C B;  3M0Q A;  2HEQ A;  2P84 A;  1VQ9 A;  2DVJ A;  2CYZ B;  2PUK B;  2QQS A;  3QPH A;  2PUO B;  5GAM f;  1SHG A;  2LCC A;  2P4T A;  2CUD A;  3ZGZ A;  5FU6 C;  5FTN A;  2FZG B;  2VGM A;  2BZ8 A;  1BCO A;  4QVC A;  2QEX Q;  3JV3 A;  4F16 A;  3I55 Q;  3H0F A;  3MP1 A;  3HU1 A;  1YJ9 T;  2A0F B;  4ATO A;  2HBW A;  2DL3 A;  2O9S A;  4PJL A;  3CBM A;  4E7J A;  4N0A C;  3CMA T;  5DM7 R;  2HSE B;  3QSU A;  3VS7 A;  5CD1 A;  2RJE A;  3VS6 A;  3VYH B;  4M7D F;  4ELY C;  1H3Z A;  3MEA A;  4OML A;  2E12 A;  4QQD A;  1MV3 A;  1D09 B;  4OMO A;  3OS2 A;  4FW1 A;  1OQK A;  1G3Y A;  2CSQ A;  3FRN A;  5CQX A;  4DBF A;  1WDX A;  3ZFJ A;  2D0N A;  3JCM J;  2F2X A;  2JV2 A;  1VQ6 A;  3QXE B;  3QJ6 A;  4M77 D;  2YSQ A;  2QDL A;  5A2Q E;  2ZPE B;  1NPR A;  2KR3 A;  4L5G A;  5A0D A;  1I1J A;  2EYZ A;  1Q81 U;  1B34 A;  2LJ1 A;  4C5H A;  2MOX A;  2NUP A;  4XTZ A;  1NYF A;  4JJN K;  2E5Q A;  4E7H A;  2JN0 A;  2YRD A;  1KIK A;  2FPD A;  2O01 E;  3CCV Q;  2EGE A;  5GMK m;  2ZCF B;  5CKD A;  3DKM A;  2LX7 A;  2RHX A;  3M56 A;  1S72 T;  2PU9 B;  3OYI A;  4ARC A;  2P0K A;  3J81 E;  4IKF A;  1PSF A;  3CF2 A;  1H64 1;  4BE2 A;  1YI2 A;  2X35 A;  2QQ9 A;  2K9G A;  3JCM V;  2RD1 A;  1YP5 A;  3I56 A;  1AOJ A;  2GGR A;  4M75 B;  3CC4 T;  1D0Z A;  3CCQ Q;  2PVO B;  5GAM g;  4LNP A;  3OW2 P;  4M75 C;  4E6R A;  2KI7 A;  1VQO Q;  3FLG A;  1BI2 A;  4RTY A;  4EDU A;  3OYL A;  1JBM A;  3JCM e;  1VQK T;  2RJD A;  1MV0 B;  4J9F A;  1FXX A;  4A4K A;  1KQS P;  3RMS A;  3G4S T;  2OTL A;  1I5O B;  1VQ7 A;  4PFZ A;  3M0S A;  1VQP Q;  2RPN A;  3I55 T;  2F5K A;  1YHQ Q;  2HAX A;  2PVG B;  3MEU A;  4E7Z A;  1NEB A;  3OB9 A;  3QHS A;  4XK8 E;  1RAG B;  4FW2 A;  3G71 T;  1WHJ A;  1WJQ A;  3EFO B;  2IIM A;  2SRC A;  2WSF E;  1Z9Z A;  2LJ0 A;  1VIF A;  4M7A A;  2DE0 X;  4RTV A;  2D9T A;  3OW2 A;  1H3H A;  4JJB A;  4RG8 A;  1PKS A;  2G3R A;  3V7R A;  4C92 D;  3MEW A;  1ZHI A;  1BK2 A;  2LZ6 B;  2EAY A;  1JRI A;  2CH4 A;  2MCN A;  1X2Q A;  2HMA A;  2JVV A;  2RM4 A;  4O5V A;  5EPP A;  1G3W A;  2GTO A;  3ULR B;  1VIE A;  1BBZ A;  2KSS A;  1QWF A;  2KEA A;  3OS0 A;  4D6W A;  3CCU Q;  3HU3 A;  4CC7 A;  2DIQ A;  1KD1 U;  1WXU A;  3I56 Q;  3A8L B;  1JJ2 A;  2JJ9 A;  4M78 C;  1TUG B;  1WJS A;  4M75 G;  2RHU A;  5KYY A;  2RQV A;  1QLY A;  4RTW A;  1RI0 A;  2VB6 A;  3NFC A;  2OTJ A;  4MZM A;  2FHD A;  1ABQ A;  2PTK A;  3OYB A;  4ORZ A;  2DXC A;  2MWP A;  2NYS A;  1WHL A;  4RKU E;  2HD0 A;  3EFS A;  1Q7Y U;  5KYU B;  4KH0 B;  5GAN g;  4M78 A;  1RI9 A;  4PJO E;  3H6Z A;  2COY A;  2FEI A;  2CZ0 B;  2EYX A;  2G6F X;  2KMT A;  4E2F B;  2YUO A;  4ANJ A;  2L3R A;  2PZ1 A;  1VQ8 T;  2CRE A;  5HCK A;  4N4I A;  3M57 A;  5GJW B;  4NL2 A;  2B8A A;  2VKN A;  5LJ5 f;  1R77 A;  2RNA A;  1H92 A;  5GAO q;  3G6E T;  4DBH A;  2DF6 A;  5J39 A;  2DD4 A;  2LRQ A;  2KE9 A;  2Q19 X;  5GAN 2;  2NWM A;  5AT1 B;  5GLF A;  2VAS A;  1X69 A;  2OX7 A;  1I4K 1;  2W0Z A;  1XNI A;  3CPW P;  3OYN A;  2C06 A;  2YWW A;  1TTH B;  1I81 A;  3CCV A;  1N9R A;  3VUZ A;  3A1P A;  3MPU B;  8ATC B;  3OYD A;  1D1B A;  1K8A R;  4CRI A;  2QQB A;  2JUF A;  4JRQ A;  4HCK A;  3OYG A;  1VQM T;  1UHC A;  3RNJ A;  2KVQ G;  4X1V A;  4JLI A;  2DL7 A;  2HQH A;  3N5B B;  3I5S A;  4X34 A;  4ZGJ B;  4M77 F;  1WLP B;  2J6K A;  4FM4 B;  1KC8 C;  2XK0 A;  2CUB A;  4RCB A;  4FYV B;  2I0N A;  1FMV A;  1WIE A;  3NGP A;  4FSX A;  1LPL A;  4C92 B;  3V7S A;  3DLL A;  1XOV A;  5LJ5 e;  2VYT A;  1VQ5 A;  2LC4 A;  1T3L A;  1VQO A;  1RAB B;  4HCC A;  1JJ2 S;  1SF9 A;  5CKB A;  3EH1 A;  4IUP A;  1K9A A;  3BDU A;  5C18 A;  1V29 B;  3JB9 D;  3FPT A;  4CI0 C;  1Q82 U;  2H3J A;  2CP6 A;  1XJW B;  2PQW A;  1OPL A;  2K3B A;  1PHT A;  1OX9 A;  4MDW A;  2XMF A;  4ME7 A;  2YVL A;  3CCS T;  2JS0 A;  1TH7 A;  5ECA A;  1Q7Y R;  1MMN A;  2DAQ A;  1YI2 T;  1NJI U;  3M5A A;  1IRX A;  2X4X A;  3OYK A;  2K79 A;  3BY7 A;  2RI2 A;  4WF2 A;  4ZTF A;  2YDL A;  3ZL7 C;  2J6F A;  2XKO C;  2E6N A;  2AKK A;  5I22 A;  2OJ2 A;  4KOD A;  2KRS A;  3D7S B;  1AVZ C;  4Z88 A;  1K9M R;  1M1K C;  3X26 B;  2Z0W A;  4EIK A;  1C0M A;  4JPB W;  2FO0 A;  5FRM A;  2Q18 X;  3P8D A;  2EKH A;  1EIF A;  5CAI A;  2RQT A;  4OMN A;  4ARI A;  2CS7 A;  4F7U G;  2EJF A;  1EZZ B;  5I2M A;  4N0A A;  1U8R A;  1GBR A;  3LGA A;  3X24 B;  1VQ5 Q;  3CC7 Q;  4GY5 A;  3M58 A;  3UWN A;  3L2V A;  3M0P A;  4ZN1 A;  4RTT A;  3A5Z B;  1QDN A;  3OQ5 A;  1NLP C;  1ZSG A;  1QVG S;  3JB9 H;  5KE3 A;  4M78 E;  1IHW A;  1QQJ A;  5EQJ B;  2RHI A;  1PD0 A;  3G6E Q;  1VQN Q;  4C8Q F;  3QDF A;  4XTY A;  3PMI A;  4RG2 A;  4IUV A;  3ZJT A;  3V8K A;  4Y92 A;  3FDR A;  3OS5 A;  3RDV A;  4JZ3 A;  2BUD A;  5FWB A;  3T9N A;  2A08 A;  2QTV A;  5FTK A;  2EPD A;  4M7A D;  2DMO A;  5GAN f;  3L2Q A;  1M90 U;  5GAN j;  3GNF B;  3EG0 A;  4NOY A;  2DBM A;  1UGR B;  3X25 B;  3TQ7 P;  4PJO D;  2LCS A;  1SKU B;  4AFZ C;  3URG A;  2ATC B;  4RV0 A;  4J83 A;  4Z8A A;  4JS4 A;  2JMA A;  4JLG A;  1LCK A;  1VQ4 Q;  3QQ7 A;  1K73 C;  1JJ2 P;  3CD6 Q;  3L2Z A;  3I5R A;  4X9D A;  4FCY A;  2DA9 A;  1WXT A;  2RH2 A;  1G2B A;  3PVQ A;  5KYW A;  1G3T A;  3L2R A;  3TSZ A;  1HYO A;  3EG2 A;  2BE9 B;  4CC2 A;  2DTH A;  1HD3 A;  4LXC A;  2E10 A;  2E41 A;  1X43 A;  2VGN A;  3LLR A;  2HBP A;  2EBP A;  3VS5 A;  2K4Y A;  1IZ6 A;  2MIO A;  3MO8 A;  3CC7 A;  4J7F A;  4ZN3 A;  1KFZ A;  5FTM A;  2E70 A;  5C0M A;  2WSC E;  1K4U S;  3HPW A;  1QVF P;  2XU8 A;  3QBY A;  4PJO G;  3JB9 I;  4F17 A;  2X3W D;  3TIW A;  2OI3 A;  5LJ3 d;  4Y28 E;  3EGD A;  2K3Y A;  1IGU A;  3WVE B;  3CBP A;  1MMA A;  3KFV A;  3CCR A;  5GAN e;  2RI5 A;  4A4G A;  5IHI A;  2YUQ A;  1SSH A;  4MMK A;  2QG9 B;  3G1J A;  1Q86 R;  1VQ9 Q;  4ELZ C;  3WXM B;  1VQ9 T;  4M7D C;  2AZV A;  1OI1 A;  1GFC A;  2L89 A;  4QVZ A;  2M0O A;  3OYA A;  1VUB A;  2FRW A;  2RO0 A;  2QEX T;  4KBM B;  1FWZ A;  4JJD A;  1AWJ A;  1QCN A;  3VS0 A;  4JS5 A;  3NTI A;  2IVW A;  1N8R U;  3OMG A;  2JS2 A;  4LUE A;  4C8Q C;  4F7U F;  4HVU A;  3KBG A;  4F7U B;  2KT8 A;  5GAM e;  4OF1 A;  2DYI A;  1K0S A;  1RUW A;  2RK1 A;  3CPW A;  1X01 A;  4A53 A;  4BUG A;  2DBK A;  4II1 A;  1DJ7 B;  3SEM A;  4R55 A;  2EQI A;  3HTR A;  1QCF A;  1UGP B;  2QA4 T;  2X3X D;  5CO7 A;  3G4S Q;  1VQ5 T;  2EQK A;  2L2P A;  4IUU A;  3E19 A;  3RR6 A;  1SPK A;  2BKD N;  1PRM C;  1UDL A;  1YNZ A;  5FW9 A;  5CQY A;  4BDZ A;  1GL5 A;  3JCM P;  2K57 A;  3ZBD A;  2LQN A;  1VQN T;  1YIJ A;  4LDU A;  4HA8 A;  2KAF A;  2EIF A;  4IUR A;  3CCE Q;  5C6S A;  3CCS Q;  2RB6 A;  3VU3 C;  2ED1 A;  8AT1 B;  2X9H A;  1AZE A;  3CME T;  2H8H A;  3SWN A;  2D8J A;  3V8J A;  4DEY A;  3DLM A;  2D6F A;  1WYX A;  3LYI A;  1XQH A;  3Q1J A;  3RKX A;  4A63 B;  1WZO A;  5L8R E;  2AK5 A;  4PJO F;  1WQ7 A;  5IXB A;  5CR2 A;  1I8F A;  1U3O A;  1ZSZ A;  3H41 A;  3QKJ A;  4KRT A;  4EMK C;  2YT6 A;  3LGF A;  1IO6 A;  2ENM A;  1M1F A;  1CKB A;  4C5E A;  1ZLM A;  1N5Z A;  3RIR A;  2KYB A;  1ZC1 A;  1OU8 A;  1RLQ C;  4J6W A;  1UGS B;  1ZSZ B;  3JCM b;  2FPE A;  3OSV A;  1NZ9 A;  3REB B;  2ED0 A;  1E7O A;  2AIR B;  2E3I A;  3VJP A;  4E47 A;  4BB7 A;  1VQ7 Q;  2M02 A;  1NG2 A;  3QYG B;  2XD0 A;  3CPW S;  1TOV A;  3CD6 A;  3LWH A;  2GF7 A;  3BW1 A;  4XTV A;  4KGV B;  4EMH A;  2XHC A;  4X9C A;  1F1B B;  1TU0 B;  4M77 B;  1QVP A;  4TVR A;  1S1N A;  4BAC A;  3DB4 A;  2QYZ A;  4C92 E;  1OV3 A;  1GCQ A;  2JXB A;  4AFU C;  5LJ5 h;  2D8H A;  2LNH B;  3EG9 B;  2DZ9 A;  2ZPB B;  7AT1 B;  4WCI A;  2F2V A;  4J9G A;  4PJN A;  1O75 A;  2DRK A;  2FVU A;  4JJC A;  2ESW A;  1MGQ A;  2LQ8 A;  1WA7 A;  2YRC A;  3CCU A;  4OB1 B;  1U1S A;  3QUI A;  3G71 A;  5LJ5 g;  4F04 B;  1AWW A;  3BDL A;  2DPP B;  4C8Q D;  2ZGW A;  1Y96 B;  4RTX A;  4B6M A;  1Y0M A;  2L3P A;  3JB9 F;  2ZPH B;  4M7D D;  2KDS A;  3CMA A;  1MMD A;  2R5A A;  2FL7 A;  4FL6 A;  2E64 A;  2C0T A;  1NJI R;  3A8O B;  2DER A;  4KGZ B;  4Y91 A;  4ZGD B;  3FPU A;  3SFM A;  4PJO A;  5KH6 A;  2CSI A;  2A7Y A;  1FMK A;  1U06 A;  2VUB A;  4C92 F;  2KRN A;  1K9M U;  1VQL T;  3P8B B;  3NMZ C;  3R6O A;  4JZ4 A;  1ACM B;  2R58 A;  2RQW A;  4J6Y A;  2EJ9 A;  3PFS A;  4FSS A;  3A8H B;  1KQ1 A;  3JCM X;  3TRE A;  2O31 A;  4KUI A;  1X6B A;  2E1H A;  5GAM j;  3VRZ A;  2MMP A;  2FRY A;  3CCJ T;  3VS4 A;  2DNU A;  1PNJ A;  4CQN A;  1YWP A;  1NYG A;  5LJ3 e;  4LDW A;  1VQ6 T;  3NTH A;  1IXD A;  2A28 A;  2KT1 A;  4A4F A;  3UF4 A;  2YUN A;  3CCR Q;  5GAN 8;  4M7A C;  3M0R A;  2M16 A;  4M78 F;  1LVK A;  1KC8 U;  3LW5 E;  4M78 B;  4C92 G;  3TU4 K;  3H9N A;  5FWC A;  5IAY A;  5GAM h;  3CCL A;  2RI3 A;  3FIF A;  1Y96 A;  4DBR A;  2ZPF B;  4M7A G;  1Y57 A;  1G5V A;  2KXC A;  3KUF A;  2A37 A;  1H8K A;  4RMO A;  4QQ6 A;  2DIL A;  1B07 A;  3A8G B;  1RL2 A;  3GOX A;  3GBQ A;  3RER A;  3QZ9 B;  3J7A F;  3M0U A;  5CKF A;  2NUT B;  1KQS A;  3I9Q A;  3MB5 A;  2HSP A;  1CKA A;  5FU7 B;  1ABO A;  1NLO C;  2DL4 A;  4OMM A;  1QVG A;  1K8A C;  3E9F A; 
#chains in the Genus database with same CATH homology
 2OAU A;  3M5A A;  1BYM A;  1I9G A;  3QG1 A;  2X4X A;  5B6C A;  2IG0 A;  3JAM E;  4QQG A;  3OYK A;  2MWO A;  3BY7 A;  2JZ2 A;  2RI2 A;  2CZ6 B;  4WF2 A;  4R56 A;  3OYJ A;  3LWI A;  4ZTF A;  3CCQ T;  2V8K A;  4KUD K;  2DJZ A;  5CK9 A;  1VQL A;  4OB2 B;  2XKO C;  2E6N A;  4M7D A;  3PIO A;  2DKG A;  3LX7 A;  2QA4 A;  2CZ1 B;  2DIG A;  2RHY A;  4N4G A;  4DA4 A;  3CC4 A;  4IUT A;  5CKE A;  4M7A B;  2YRV A;  2BIV A;  4KOD A;  3M59 A;  4V2S A;  5FLX E;  2DTO A;  5AYF A;  1VQ4 A;  2JTF A;  4M77 C;  1M1K C;  3QZ5 B;  4OGE A;  3X26 B;  3AHU A;  1CZ4 A;  2ZPG B;  4UC4 A;  1YJW A;  1AHJ B;  2LCL A;  3CC2 T;  2DK3 A;  1Q7Y C;  5FRM A;  2K5L A;  2Q18 X;  1WGS A;  3QII A;  5C1B A;  3P8D A;  5FRO A;  1BI0 A;  2RJF A;  4KLN A;  3CCJ A;  3GF5 A;  4LDV A;  1EIF A;  4J6X A;  2JNG A;  4C8Q E;  5CAI A;  4C5G A;  1WQW A;  4J8O A;  3JCM d;  2YUJ A;  5LJ3 h;  4MZT A;  1O9S A;  3S6W A;  2CS7 A;  4F7U G;  2EJF A;  5I2M A;  1U8R A;  2X4J A;  4N0A A;  3UDC A;  4BI4 A;  3LGA A;  4M78 D;  4BY6 B;  3X24 B;  3HRT A;  4JRK A;  1W4S A;  1M4Z A;  4GY5 A;  3M58 A;  4M77 A;  3UWN A;  4B9W A;  3L2V A;  3CD6 T;  2XIC A;  4BE1 A;  1VQ4 T;  4ZN1 A;  3JCM W;  2XDB A;  3M4G A;  3CCU A;  3CCE A;  3A5Z B;  1QDN A;  3OQ5 A;  3JCM f;  1I5L A;  3QDR B;  1QVG S;  5FRN A;  3TCJ A;  2XID A;  1M8V A;  5A0G A;  1KQ2 A;  1QP3 A;  3JB9 H;  5KE3 A;  3QYH B;  2EQM A;  2LQK A;  4OP0 A;  3OBW A;  3PTA A;  1YIT T;  1Y7X A;  4M78 E;  4JRP A;  4MZP A;  5LJ3 f;  2K2V A;  4Q5W A;  5LJ3 j;  5EQJ B;  2RHI A;  2LVM A;  4JDS A;  2NLU A;  1LNX A;  4O6J A;  3JB9 J;  5CCX A;  4C8Q F;  3SDZ A;  4XTY A;  3RMQ A;  3PMI A;  4HCB A;  4C0D B;  2KY9 A;  5I21 A;  2R5M A;  2EQU A;  4RG2 A;  3SWN B;  4IUV A;  3RKW A;  3ZJT A;  1PSE A;  3OMC A;  3V8K A;  5GMK j;  1BIB A;  2EJG A;  1VQ9 A;  5GMK l;  3FDR A;  3OS5 A;  3JCM g;  2BUD A;  2CYZ B;  2PUK B;  3T9N A;  2QQS A;  3PIP A;  3QPH A;  5A0L A;  3H8Z A;  1QW1 A;  2QI2 A;  4KUL A;  4HT9 A;  2M1H A;  5FTK A;  2PUO B;  2Y90 A;  4FU6 A;  5GAM f;  4M7A D;  5GAN f;  3QO3 A;  3L2Q A;  1M90 U;  2Y4Y A;  4EMK B;  2LCC A;  2P4T A;  5GAN j;  3GNF B;  3ZJV A;  3ZGZ A;  3P8H A;  4NOY A;  5FU6 C;  1W2B A;  5FTN A;  2VGM A;  1XTD A;  4RCC A;  1UGR B;  5D6Y A;  3X25 B;  4QVC A;  2EWN A;  3CCQ A;  4PJO D;  4B9X A;  3HU1 A;  3MP1 A;  1YJ9 T;  3URG A;  3HKS A;  1NPP A;  4RV0 A;  4J83 A;  4BDY A;  3PT9 A;  4ATO A;  1QP2 A;  5GMK h;  3LH0 A;  4JS4 A;  4JLG A;  5KCO A;  3BQB A;  3SWN C;  1UEB A;  5DLQ E;  1LOJ A;  3L42 A;  3X20 B;  3CBM A;  4E7J A;  4N0A C;  1S72 A;  3CMA T;  4C0D C;  5DM7 R;  1K73 C;  2PWY A;  4N4H A;  4XU0 A;  3QSU A;  3QQ7 A;  3L2Z A;  4C5I A;  5CD1 A;  4M75 A;  2XG8 D;  4X9D A;  5KCH A;  2RH2 A;  3OYC A;  3G7Z A;  1KHC A;  3VYG A;  1G3T A;  2RJE A;  5LJ5 j;  3L2R A;  4MDX A;  2DEQ A;  2XDD A;  3VYH B;  3OYH A;  4M7D F;  4ELY C;  4LDX A;  3MEA A;  3CCV T;  1H3Z A;  1B34 B;  2DTH A;  3I56 T;  3UPU A;  2E10 A;  2E41 A;  2VGN A;  3GLX A;  1KD1 C;  3LLR A;  2E12 A;  2HBP A;  2L5Q A;  4QQD A;  1VQP A;  4XAX B;  1M5Q 1;  2DD5 A;  4JRI A;  2K4Y A;  1IZ6 A;  2JTM A;  1N9S A;  3MO8 A;  4MML A;  3CC7 A;  4J7F A;  3QWZ A;  4ZN3 A;  3L2U A;  3OS2 A;  5FTM A;  4P5N A;  1G3Y A;  2E70 A;  3A8M B;  5C0M A;  2WSC E;  3FRN A;  5CQX A;  4BE0 A;  2DVE A;  3V8L A;  1KHI A;  5IT9 E;  3HPW A;  2XU8 A;  3QBY A;  4J5Y A;  3ZFJ A;  2YLB A;  3JCM J;  4PJO G;  3OS1 A;  1P92 A;  3JB9 I;  3X28 B;  2O4X A;  2E6Z A;  3FEO A;  5D6W A;  3TIW A;  5CCB A;  3CXC A;  4OMF B;  2JV2 A;  4KT0 E;  5LJ3 d;  1QCS A;  1VQK A;  4Y28 E;  2K5F A;  3G6E A;  1VQ6 A;  4KDL A;  3LHD A;  3QXE B;  3HP9 A;  2K3Y A;  4M7D E;  5LJ5 d;  3QJ6 A;  4M77 D;  3ME9 A;  5IN1 A;  3WVE B;  4EPC A;  2LW6 A;  3CBP A;  3CCR A;  3OA6 A;  5A2Q E;  1Y07 A;  2ZPE B;  5GAN e;  1NPR A;  2HQE A;  2DXB A;  2RI5 A;  4L5G A;  3OYE A;  1VQ7 T;  4A4G A;  5A0D A;  2XDP A;  2ZPI B;  3FJP A;  4IUQ A;  4MMK A;  1VQO T;  2YLC A;  4AS1 A;  1E32 A;  3MCA B;  2PVD B;  3WXM B;  4ELZ C;  1VQ9 T;  1B34 A;  2L8D A;  4EMK A;  1OI1 A;  3JSC A;  1Q81 U;  2L89 A;  3RES A;  4C5H A;  5D6X A;  3QQ8 A;  2I2L A;  4QVZ A;  2M0O A;  5FTL A;  2EFI A;  3OYA A;  4ARI A;  5GAN 5;  2P0Q A;  1VUB A;  2CZ7 B;  2RO0 A;  2QEX T;  3M54 A;  3OYY A;  4KBM B;  4XTZ A;  5DYI A;  3LGL A;  4JJN K;  1FWZ A;  2D0Q B;  2E5Q A;  4E7H A;  5GAO n;  4JS5 A;  2RK2 A;  1R7R A;  2JN0 A;  2O01 E;  3NTI A;  3HL8 A;  3OBY A;  1HK9 A;  5GMK m;  3M55 A;  4LDY A;  2IVW A;  3ZJU A;  2O4X B;  5GAO m;  2ZCF B;  1N8R U;  5CKD A;  3OMG A;  3DKM A;  1FX7 A;  1WNL A;  2EYQ A;  1VQM A;  3BFM A;  2RHX A;  3M56 A;  1S72 T;  2PU9 B;  4C8Q C;  1IRE B;  1VQ8 A;  2Q1C X;  4F7U F;  3OYI A;  2P0K A;  3J81 E;  1YHQ A;  4ARC A;  4IKF A;  1PSF A;  3KBG A;  3CF2 A;  4E7K A;  4F7U B;  4OB3 B;  5GAO r;  1H64 1;  3M9Q A;  4M78 G;  5GAM e;  4BE2 A;  4QW2 A;  1YI2 A;  3QC8 A;  2X35 A;  2QQ9 A;  4OF1 A;  4M7D B;  5ERG B;  2RK1 A;  3JCM V;  3FB9 A;  2RD1 A;  1WLF A;  3CPW A;  1X01 A;  4XTW A;  4BY6 C;  4A53 A;  4BUG A;  3I56 A;  4II1 A;  1DJ7 B;  2ZZD A;  4R55 A;  1VQP T;  3S3M A;  1UGP B;  2QA4 T;  3CC7 T;  3JCM c;  5CO7 A;  2DXU A;  2MF2 A;  2FB7 A;  4M75 B;  3CC4 T;  2PVO B;  4XU3 A;  3HFO A;  5GAM g;  2EQK A;  3S3N A;  1GXI E;  1KG1 A;  4IUU A;  4M75 D;  3I55 A;  3E19 A;  3HU2 A;  3V7C A;  4M75 C;  2BKD N;  5FTJ A;  2WSE E;  1UGQ B;  2P0P A;  3GIB A;  2A3L A;  3FLG A;  1BI2 A;  2CGH A;  1X75 C;  4EDU A;  5CQY A;  3OYL A;  3JRZ A;  2LX9 A;  4BDZ A;  1BI1 A;  1K9M C;  3VUB A;  1JBM A;  1K73 U;  3JCM e;  3JCM P;  2K57 A;  1VQK T;  3OYF A;  3ZBD A;  1VQN T;  2RJD A;  5LL6 S;  4A54 A;  5J26 A;  4FT4 A;  1YIJ A;  3HSB A;  4LDU A;  2QQR A;  4HA8 A;  1FXX A;  4A4K A;  5GAM d;  1N27 A;  2KAF A;  3RMS A;  3ER0 A;  4NL3 A;  3OW2 S;  3UT1 A;  3G4S T;  2OTL A;  1G3S A;  2EIF A;  4KO8 A;  4IUR A;  3E1S A;  1VQ7 A;  4XTU A;  3WVD B;  4M7D C;  3OY9 A;  3I55 T;  5LJ3 g;  2F5K A;  2HAX A;  1ZQ1 A;  1MHN A;  5C6S A;  3CPF A;  2VXF A;  2RB6 A;  3VU3 C;  2PVG B;  3MEU A;  4BI8 B;  5GAN 7;  3OB9 A;  1K8A U;  2DZC A;  5HK0 A;  3QHS A;  2DTI A;  3CME T;  1SSF A;  3EFR A;  3SWN A;  2RHZ A;  2XI9 A;  4XK8 E;  4OGC A;  5FU6 B;  3V8J A;  5GAN 4;  3CXC S;  3G71 T;  4E7L A;  3DLM A;  1WJQ A;  2D6F A;  4M77 E;  3LYI A;  4F7U A;  2WSF E;  2MI6 A;  3S3O A;  1BIA A;  1XQH A;  3Q1J A;  2LT4 A;  1VIF A;  4M75 E;  3RKX A;  3ZEH A;  4M7A A;  4PLI A;  2LNV A;  5L8R E;  2D9T A;  4PJO F;  4XU1 A;  3OW2 A;  4AQ7 A;  1WQ7 A;  4RG8 A;  2G3R A;  3V7R A;  4C92 D;  3MEW A;  5CR2 A;  1ZHI A;  3G4S A;  1Q82 C;  2EAY A;  1I8F A;  2WAC A;  4BD3 A;  4LD9 K;  3QKJ A;  3MP8 A;  3QJY A;  1JRI A;  1CR5 A;  2AHJ B;  3C94 A;  4EMK C;  2HQX A;  4HKE A;  3LGF A;  2JVV A;  2RM4 A;  4O5V A;  4VUB A;  1M1F A;  3NTK A;  5EPP A;  1G3W A;  2GFA A;  4C5E A;  1Y71 A;  1VIE A;  2VXE A;  2KSS A;  4HT8 A;  3GPL A;  3CC2 A;  3OS0 A;  3RIR A;  3VKI A;  4D6W A;  2K3X A;  4F7U E;  1ZC1 A;  2RA2 A;  3HU3 A;  4J6W A;  2DIQ A;  1KD1 U;  1KQS S;  1UGS B;  3L2W A;  1W2B S;  4FT2 A;  3A8L B;  3JCM b;  2JOY A;  1JJ2 A;  4L6V 5;  3INZ A;  4M78 C;  4ZGE B;  3OSV A;  4JUV A;  1NZ9 A;  4NS5 A;  5EG2 A;  3FPR A;  3RKY A;  3CCR T;  1YJ9 A;  4E47 A;  3VJP A;  1WJS A;  4M75 G;  2RHU A;  4BB7 A;  2QQA A;  3SB2 A;  3QYG B;  2XD0 A;  3OYM A;  3CPW S;  2F5T X;  3CD6 A;  1RI0 A;  3NFC A;  3LWH A;  3CCS A;  2OTJ A;  2GF7 A;  3BW1 A;  2QTX A;  4MZM A;  4XTV A;  2FHD A;  4PJO C;  3M53 A;  3PNW C;  4EMH A;  5GAO l;  3OYB A;  2XHC A;  4X9C A;  5DY9 A;  1Q86 U;  2DXC A;  1YBY A;  3RUX A;  5I2S A;  2MWP A;  1QVP A;  3C4S A;  2MAM A;  4M77 B;  4TVR A;  3VV0 A;  4M77 G;  4BAC A;  1Q81 C;  4RKU E;  3DB4 A;  2HD0 A;  3EFS A;  4C92 E;  1Q7Y U;  1OZ2 A;  2MM2 A;  5LJ5 h;  5GAN g;  4M78 A;  1NE8 A;  4PJO E;  3H6Z A;  1M90 C;  2EQJ A;  2DZ9 A;  2ZPB B;  2CZ0 B;  4QVD A;  2KMT A;  2YHT A;  2V8I A;  4Z02 A;  5GAO p;  2L3R A;  2RJC A;  1VQ8 T;  1O75 A;  2FVU A;  2GCX A;  3CCM A;  4N4I A;  1NJI C;  3CBO A;  3CEY A;  3M57 A;  3GNG A;  4NL2 A;  1MGQ A;  2LQ8 A;  3L1A A;  1YJW T;  2DXT A;  2K5I A;  3MHX A;  4OB0 B;  2Y4X A;  2B8A A;  3F70 A;  5HKC A;  5LJ5 f;  2VV5 A;  4OB1 B;  1U1S A;  5CIU A;  3QUI A;  4C8Q A;  5LJ5 g;  5GAN h;  3G71 A;  3JB9 G;  1D3B A;  4ZTJ A;  3BDL A;  5HK3 A;  3MEV A;  5GAO q;  2LT1 A;  2MM0 A;  1BI3 A;  3G6E T;  1QVF A;  5J39 A;  2DPP B;  2DD4 A;  2LRQ A;  4OVA A;  1OYX A;  3HHT B;  4C8Q D;  5KE2 A;  2Q19 X;  4C0F A;  3C12 A;  5GMK e;  2ZGW A;  3J80 E;  5GAN d;  1Y96 B;  2DO3 A;  1U1T A;  2KK4 A;  3JB9 F;  5GMK i;  5GAN 2;  4XQ3 A;  1M1K U;  2GFU A;  5GLF A;  2ZPH B;  3C95 A;  4M7D D;  2KDS A;  3CMA A;  2EKO A;  4DQ2 A;  1I4K 1;  1N6A A;  2R5A A;  2FL7 A;  1XNI A;  2FYK A;  4C0Z A;  3CCE T;  1QVF S;  3PMT A;  4FL6 A;  2QDY B;  1YJN T;  2E64 A;  3OYN A;  2C06 A;  3A8O B;  1YIT A;  4Y91 A;  3DB3 A;  4ZGD B;  1Q86 C;  3FPU A;  3SFM A;  1JB0 E;  4PJO A;  2CKK A;  5KH6 A;  1I81 A;  2A7Y A;  1YCY A;  4PKC C;  4A4H A;  4EMG A;  1N9R A;  2R57 A;  2VUB A;  3VUZ A;  4C92 F;  3CCV A;  4E7I A;  5M9O A;  3OYD A;  4PL6 A;  3TEE A;  4CRI A;  1OZ3 A;  4HCZ A;  4C92 C;  1YIJ T;  1K9M U;  2QQB A;  2JUF A;  4DOV A;  1VQ5 T;  1VQL T;  2V8J A;  4JRQ A;  3P8B B;  4M7A F;  4M7D G;  3R6O A;  2OTL T;  1M9S A;  2R58 A;  3OYG A;  4M75 F;  1VQM T;  4J6Y A;  2X4Y A;  2KVQ G;  2EJ9 A;  3PFS A;  3A8H B;  1KQ1 A;  3JCM X;  4JLI A;  3N5B B;  4X34 A;  3TRE A;  4ZGJ B;  4M77 F;  5GAN 3;  4KUI A;  4FM4 B;  3CME A;  1KC8 C;  1UB4 A;  2XK0 A;  4FIB A;  3CCL T;  4LD6 A;  4RCB A;  2E1H A;  5GAM j;  1WPY A;  4FSX A;  5CCA A;  2MMP A;  3CCJ T;  2Q1A X;  3JCM Q;  1M1G A;  2HNI A;  4CQN A;  1R8O B;  2M9U A;  1LJO A;  1X6O A;  5LJ3 e;  4LDW A;  4C92 B;  3NTH A;  1N8R C;  1VQ6 T;  1S3S A;  3V7S A;  3DLL A;  1XOV A;  5LJ5 e;  2VYT A;  4PJO B;  4A4F A;  3O8V A;  4PNO A;  2PJH B;  1VQ5 A;  2LC4 A;  3HRU A;  3PGG A;  5GAN 8;  1ZBX A;  4M7A C;  2M16 A;  3OSS C;  1VQO A;  5DLO A;  4M78 F;  1KC8 U;  4HCC A;  3CCM T;  1JJ2 S;  4XTX A;  3E9G A;  5CKB A;  5DYG A;  3LW5 E;  4M78 B;  4C92 G;  2E65 A;  2VC8 A;  3TU4 K;  4M7A E;  4YTL A;  4IUP A;  1WJR A;  3BDU A;  3MP6 A;  5IAY A;  5C18 A;  5GAM h;  2QXF A;  3HRS A;  3CCU T;  1HXD A;  2RI3 A;  3FIF A;  4C8Q G;  3CCL A;  1Y96 A;  2QEX A;  2ZPF B;  4M7A G;  4A4E A;  3FC3 A;  1G5V A;  3KUF A;  1V29 B;  3M4Y A;  5CKH A;  3HFN A;  2Q1D X;  3JB9 D;  3FPT A;  4DOW A;  1VQN A;  4CI0 C;  4C0G A;  4RMO A;  1Q82 U;  4QQ6 A;  3A8G B;  2H3J A;  2GQV A;  1RL2 A;  3ASK A;  4XU2 A;  5FU7 C;  3GOX A;  3GP8 A;  2PQW A;  3QZ9 B;  3RER A;  1D3B B;  3J7A F;  1CZ5 A;  5HY6 A;  4C8Q B;  5GAN 6;  5CKF A;  3KXT A;  2X4W A;  2LTO A;  4GLK A;  4MDW A;  2F69 A;  4PLL A;  1KQS A;  4ME7 A;  2YVL A;  3CCS T;  2OTJ T;  1TH7 A;  3JCM h;  4C92 A;  3MET A;  1BKB A;  1O54 A;  3MB5 A;  2KQW A;  3SD4 A;  1YHQ T;  4L59 A;  2LDM A;  5CVI A;  5J3B A;  4KDI A;  1YJN A;  2DAQ A;  5FU7 B;  3EAE A;  1YI2 T;  1NJI U;  1QVG A;  4BI3 A;  1K8A C;  3E9F A;  2B25 A;  4J7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...