5D6XA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 23
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6xA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6xA02
1OZ3A 3MEVA 3BDLA 1G5VA 3OYAA 1XNIA 2HQEA 2CKKA 4RG2A 3ZEHA 3NTKA 4N4IA 2DIQA 4C5IA 2RJDA 3EAEA 3QJ6A 5J26A 1WJQA 2LRQA 3NTIA 3PFSA 4L59A 3OMGA 2EQUA 4QVZA 4B9WA 5IAYA 3OYJA 4E7KA 2X35A 2X4YA 3OYCA 2BUDA 2EQJA 1N27A 3L2UA 3M9QA 3MP1A 3ASKA 4E7LA 2L8DA 3OYGA 3LLRA 3C4SA 2IG0A 4HCZA 1SSFA 2L89A 4II1A 2K3XA 2GFUA 4IUQA 4QQDA 2RJEA 2M0OA 2E6NA 2RJCA 3MP6A 5KCOA 2BKDN 2O4XB 2RHYA 2O4XA 3OS0A 2R58A 4E7HA 5C6SA 3CEYA 2RI2A 3L42A 4PL6A 4Q5WA 3FDRA 3KUFA 5C0MA 2FHDA 5D6WA 3S3NA 3LH0A 2BIVA 3P8DA 2RHUA 3OYMA 2LDMA 3OYHA 2K3YA 2R5MA 3DLMA 3MEUA 3Q1JA 5CIUA 3MP8A 3QIIA 2M1HA 4N4HA 2DAQA 2F5KA 5FROA 4BE1A 1WJRA 3FEOA 2XK0A 2HQXA 5IN1A 4IUUA 2G3RA 4PLLA 2X4XA 4C5EA 3OYIA 3OYBA 2RI3A 3PMTA 4BDZA 2R57A 2MWPA 4IUVA 4NS5A 3MEAA 4QQ6A 4BDYA 2RJFA 1WJSA 2EFIA 5KE2A 3OB9A 5KH6A 4QQGA 4IUTA 2DIGA 4C5HA 4Z02A 4C5GA 4CRIA 2M16A 2JTFA 5FRNA 4A4HA 2RHXA 2GF7A 5D6YA 4A4GA 3GOXA 4BACA 3LYIA 2QQRA 3S3OA 4A4EA 1OYXA 3MEWA 3O8VA 3SD4A 2LTOA 1WGSA 2WACA 3F70A 3L2WA 2XDPA 4X34A 4BE2A 3OS2A 4IURA 3OYFA 3L2QA 4ZTJA 4BD3A 2NLUA 2RHIA 3S3MA 3OYKA 5J39A 3FC3A 2VYTA 4A4FA 4EDUA 3L2VA 2YRVA 4FL6A 3DB4A 3LGFA 3NTHA 5KE3A 2D9TA 4UC4A 5KCHA 2LCCA 2LVMA 5FRMA 3LGLA 2QQSA 3H8ZA 2E5QA 4FU6A 4PLIA 5D6XA 3E9FA 1H3ZA 1OI1A 2B8AA 2L3RA 3META 3MO8A 2R5AA 3PMIA 4QW2A 3ME9A 3H6ZA 4B9XA 5M9OA 3OS1A 2PQWA 4IUPA 3OY9A 4OVAA 2GFAA 3OYEA 1OZ2A 2P0KA 3QKJA 1KHCA 2RI5A 3PNWC 2X4WA 2JZ2A 3DB3A 3OQ5A 4N4GA 3S6WA 3QBYA 4GY5A 3OYDA 3FLGA 4IKFA 2RO0A 4E7JA 3LX7A 4BE0A 3OMCA 2EQKA 3UT1A 3UWNA 3OA6A 4E7IA 2EQMA 2EKOA 4ZTFA 3OYNA 2MWOA 3OYLA 2RHZA 3E9GA 3P8HA 4LD6A 1RI0A 3L2RA 1MHNA
chains in the Genus database with same CATH superfamily
2LJ3A 4XU3A 1TWBA 2J7IA 1ZBXA 2LQ8A 5DLOA 3A98A 3JCMd 2MM0A 1BIBA 2QDYB 3ZEHA 1OULA 2D8HA 2ZCFB 4E47A 2EYZA 5IAYA 3NFCA 2MYSA 3CCUA 2F69A 4AG1C 1KHIA 2X4YA 2HQHA 2AKKA 5LJ3e 2Q19X 1Z9ZA 3CCEA 1GFCA 1S72Q 4OB2B 1WIEA 2NUTA 1UTIA 2L89A 1I0CA 3UA6A 3MPUB 1QVGS 3CC7T 3CBMA 1K0SA 2PVOB 1G3SA 3CC4A 3RR6A 2M0OA 3TU4K 4QVDA 3VS2A 5C0MA 3FDRA 1M90C 4M7DD 2E41A 2XU8A 3HRTA 3Q1JA 2J05A 4F7UF 4AS1A 4KLNA 1KJWA 1PNJA 1GXIE 2F1LA 4BE1A 2ABLA 3FIFA 5GMKl 1M90U 2JW4A 4ZGJB 2KYMA 2VUBA 3QUIA 2CSIA 2DMOA 4F7UB 1VIFA 2MAMA 3G4SA 3PVQA 3H0FA 3G6EA 1X6BA 1TTHB 2ESWA 1RAGB 3F70A 4XU2A 3SFMA 3TREA 2SRCA 2RHIA 1M8VA 2SEMA 1M9SA 2JV2A 5GAOp 1WHJA 2LCLA 4M77F 1ZUYA 1WI7A 2QQSA 2RB6A 5D6XA 5GLFA 2L3RA 7AT1B 1T0JA 5L23A 4DOVA 2DFUA 3SHWA 3RDVA 3QBYA 5GAN5 2A28A 5EC7A 3I55T 1CKBA 1Q7YR 3CC7A 5KYUB 3QWZA 3CC4T 1G3WA 1S72T 3KXTA 1N8RU 2LJ0A 2QQAA 1WQWA 2KSSA 2NUPB 4OF1A 1IRXA 3I5RA 3JCMc 3HTRA 4L59A 5J26A 1K1ZA 4B9WA 1M2VB 1D0XA 2F2VA 1RAFB 4A4KA 1YJNA 4EIKA 1VQ6Q 2J06A 2GQVA 4XAXB 4OMQA 2C0TA 4C0GA 4B6MA 5DM7R 4KUDK 3G6ET 2EGAA 3HHTB 3H41A 4TVRA 2ECZA 5LJ3j 3OS0A 1AWJA 3KFVA 4LDWA 2A37A 5CIUA 4RCBA 3VS1A 1JXMA 2KT8A 1BI3A 3M57A 3HU3A 2V1RA 5D7UA 1IO6A 2YRCA 1M27C 1UGVA 2YDLA 4NS5A 5GANj 4E7ZA 3HRUA 2F5TX 4PJOB 5KE2A 2P0QA 3HKSA 3V7RA 3JCMQ 4KGZB 2YUOA 4PJOF 3QSUA 5A0DA 2Y4YA 4J9HA 2BE7D 4KGXB 2KBTA 3V8KA 1VQ8A 4EDUA 4XTUA 2MK5A 2H3EB 4ZN1A 2LP5A 2K79A 1ZUUA 2EGEA 3CXCP 4OP0A 3VUZA 2FPEA 4Y28E 2EPDA 2EYXA 1E6HA 5GJVB 4IUPA 3IQLA 5LJ5g 3QKJA 2X4WA 2JZ2A 1VQ7T 4AFUC 4KGVB 2DL7A 3M4YA 1SHFA 2EQKA 4M7DF 1PRMC 3P8BB 1PM3A 3CCQA 3M0RA 4RTWA 3JB9D 3QYHB 3TVTA 4R0KA 2DXUA 1ZSZC 2O9VA 2FB7A 3NPFA 1YCSB 2PZ1A 2VV5A 2AZVA 2DX1A 1YIJT 1NE8A 2EQIA 4EMKB 5GAN3 2K5IA 4PJMA 4ELYC 2P0PA 1YJ9A 1WLFA 1Y96A 1MNEA 1YHQA 1N27A 2COWA 3ZFJA 1KD1U 3ASKA 1XOVA 5LJ5d 5ECAA 2W10A 1KSWA 4J6WA 3A5ZB 1ZA1B 2LW6A 3A1PA 2VKNA 3CPFA 3JRZA 4IUQA 1WZOA 3SDZA 2ZPFB 3HU2A 4ME7A 2O4XA 2EJ9A 5C6SA 1X6OA 1VQPT 1I07A 3G4ST 1K9MC 3MP8A 2RQRA 3VS4A 5LJ3f 1M2VA 4Z89A 1TOVA 3UDCA 3GNGA 2EYYA 2E70A 3EG9A 3U23A 5HK3A 2MWPA 1W2BA 2CZ6B 3X28B 3URGA 2JTMA 1NJIC 2O9SA 2DIGA 2K5LA 4CI0C 3CCMA 4BACA 1H92A 4R56A 2WACA 3L2WA 4X34A 5DLQE 1UUEA 1PSFA 4LD9K 2X3WD 4RTTA 2VYTA 4OB0B 1SEMA 5IHIA 2LMJA 4JS5A 4RKUE 2PUOB 4J8OA 2VGNA 4KRTA 2G6FX 2E5KA 5M9OA 2CGHA 2P0KA 4IKFA 3FPUA 5FW9A 1PKSA 2EKOA 3L1AA 1QDNA 1FWZA 2BE9B 2MMPA 4A54A 3M56A 1IREB 2HMAA 5LL6S 4KO8A 5GAMj 1OX8A 1MV0B 2LZ6B 3QJ6A 1QVFA 2JMCA 2Q1CX 3CCJA 2AT1B 1ZQ1A 1D3BB 5LJ5h 5GAMe 2BZ8A 2E12A 3M0TA 5HK0A 3AHUA 3HPWA 1VQOT 4F7UA 3WVDB 2VGMA 2QASA 2AZSA 3C94A 3CC4Q 2IVWA 5D6WA 5EPPA 4BUGA 3JCMP 2KI7A 3JCMJ 2DAQA 1LCKA 1TS9A 2OAWA 3CCJT 5GAN4 2CZ7B 2BZXA 4O6JA 3OYBA 2V1QA 5CCBA 3HRSA 3FPRA 3EFOB 2ED0A 3OB9A 3SWNC 1AZEA 3EH1A 2OAUA 3LGAA 5FTNA 1UB4A 2QK0A 5KYUA 1U06A 2XDBA 3QDRB 1QVPA 3M4GA 3OYFA 2CT4A 2ED1A 5IXFA 1W2BP 3ER0A 3S3MA 2LX7A 2ZPHB 3VJPA 3JB9G 1BI1A 1G2BA 1RADB 4M77B 1I8FA 1K9MU 4ESRA 1QCSA 2PQWA 1WLPB 1T0HA 2QXFA 3CMAA 1KC8C 1M1GA 1ZUKA 2ZGWA 1JJ2S 4N4GA 1EFNA 2CH4A 4M7DA 1OU8A 3RKXA 2RPNA 5FLXE 5IHNA 2CP7A 2CUDA 1NYGA 1VQ7Q 4ARIA 2E6ZA 2E4HA 1QP3A 1WHKA 3BY7A 3I9QA 2GTOA 3JCMX 1VQLA 8AT1B 1G5VA 1UE9A 4JS4A 2XI9A 5CK9A 4OMPA 1K4US 3QZ5B 4C5IA 2K4YA 1NYFA 2HBPA 1D1AA 4CC2A 5GAOm 2JMAA 3ZJUA 3VKIA 1M1FA 3BE3A 2YVLA 1QW1A 1W1FA 1O9SA 3M55A 3OW2P 3BFMA 5KYYA 3UPUA 1T3LA 3MP6A 2MI6A 4Q5WA 4KBMB 4RUGA 2LDMA 5GANd 1Q7YC 1JRIA 3CQTA 1M1KR 2Q18X 2ROLA 2DD5A 3CCVT 1JJ2P 5L8RE 1BCMA 2F5KA 5CKDA 1X01A 4M78E 4M77E 4Z8AA 2HQXA 2MPXC 4KULA 4RG8A 5EG2A 3PMTA 1Q7YU 2ZAEA 3REAB 1Z9QA 2JUFA 1HJDA 2YLBA 3ZGZA 1OV3A 1M3CA 4IURA 4JZ3A 1N9RA 4FSXA 4OMNA 4AMCA 4ZTJA 3VV0A 4ANJA 3ULRB 3CCLQ 2X3XD 2LQNA 3CCVA 4J9CA 1R77A 1VQ8Q 5KE3A 2LCCA 4P5NA 5GMKh 3VRZA 2KK4A 3GLXA 2HSPA 2EVRA 3FB9A 2LQKA 4KDIA 2HKNA 5IH2A 1KC8R 4WCIA 1M8MA 1SRLA 2EIFA 2RO0A 1YIJA 1HSQA 4Y91A 2DEUA 1NEBA 4C8QB 4C8QF 5CR2A 2A3LA 3JCMf 5DYGA 2JTEA 3EGDA 2DLPA 2KXDA 5GMKe 2HCKA 3CD6Q 4MDXA 1YCYA 1RABB 4EMKC 4M7DC 2HQEA 3CXCS 2RJDA 2FZCB 4C92A 3L2UA 5GMKi 3KBGA 3CMEA 1MGQA 4RTYA 2EQJA 4J9EA 2QEXA 3MP1A 1ZSZB 5GAOr 2DVEA 2CZ0B 5DYIA 3EH2A 4JUVA 2RF0A 1Y7XA 5KYWB 2NUTB 1JBMA 2DL4A 2JNGA 4QQDA 3QXEB 5C1BA 3RKWA 3CCUT 3A8MB 5CQYA 5EQJB 2DYBA 1C0MA 2NYSA 4N4HA 1Y96B 3JCMV 2PWYA 2YLCA 1WHMA 4OMLA 4OGEA 2HL5C 2CUBA 1MMNA 4IIMA 2F2WA 4IUUA 1UDLA 2P4TA 1VQOQ 3OSVA 4FT2A 4QVCA 1TUDA 2ATCB 1VQPQ 1R0BG 4OMFB 5KH6A 2QA4T 4IUTA 5FRNA 2Q1AX 1WPYA 2E64A 2V26A 4PJOD 1X69A 2B86A 4JJDA 1UGSB 3X20B 3O8VA 1BYMA 3CBPA 3HL8A 4JLGA 4BD3A 2Y4XA 2HKQB 1JQQA 4M7AF 1YN8A 3OS5A 2DYIA 1VQ5Q 3THKA 3DLLA 5GAOl 3CC2Q 3MO8A 4QW2A 4OVAA 5GAN2 1VYTA 4OMOA 2PU9B 2K5FA 4KH1B 5GAMf 5IHKA 3A8HB 1QVFP 3CCQT 1K73R 1WXTA 4FT4A 2FZKB 4HT9A 4CC3A 1E32A 3OYNA 4PJOC 2I0NA 1D0YA 3I5SA 2D0NA 2EBPA 1AWXA 3CMET 3EG1A 1VQOA 5GAMg 4C8QC 5LJ3g 1ARKA 4C8QA 2DE0X 4AFZC 2JJ9A 3HP9A 4J9FA 1G8XA 4E7KA 5ERGB 3JB9F 1AOJA 5IT9E 2X35A 5FTJA 2L0AA 4AQ7A 4M75C 2JS2A 4VUBA 1IGQA 3QDFA 1NM7A 1VUBA 4J9DA 1VA7A 2DA9A 4JRPA 5LJ5f 3G71A 1YWOA 1RLPC 4GLMA 1VIEA 1EIFA 2CYZB 2RJCA 2RHYA 2O01E 2R58A 1ZLMA 2AKLA 3JV3A 1VQ4T 5LJ3h 2FHDA 1UGQB 2R5MA 3M0UA 1YNZA 1IB8A 4J83A 5KYNA 3QQ8A 1SRMA 2LC4A 4M7DB 1AHJB 2DJQA 2O31A 1D3BA 3CCQQ 2I2LA 3CD6T 4C5EA 2MOXA 2RJFA 4C92E 1QMCA 2ZZDA 5GAMh 3ZJVA 5CQXA 3SEMA 3RKYA 3CBOA 5FTLA 1ZBJA 4Z88A 3R6OA 1I1JA 1KFZA 2DM1A 4M78G 2DPPB 1WYXA 2O88A 1QKWA 2YHTA 3DB4A 4KUIA 5J3BA 1R8OB 2GCXA 2EAYA 4LN2A 4OB3B 3VS6A 2GFAA 3VYHB 4HVUA 1QQJA 5CKFA 3SWNB 4BE0A 2RNAA 5CCXA 1WHLA 4PFPA 1VQNT 2DBKA 1N8RR 2KQWA 2RQWA 2Y90A 4YTLA 1O75A 1GL5A 3CCSQ 1XNIA 3TCJA 5GAMd 1YFNA 4M77G 2LRQA 5AYFA 1HXDA 1FX7A 2QI2A 2EGCA 2J6KA 1FYNA 1FMKA 2OI3A 4FSSA 1H641 1JU5C 1GRIA 2CH4W 2PNIA 1VQNA 4HVWA 4O5VA 1DJ7B 3M0SA 2BKDN 2X4JA 5FU7B 4FW1A 3G1JA 3M0PA 5GJWB 2ZPGB 1ZX6A 3CCLT 2K3YA 4DOWA 4M75A 3PIPA 2QGFB 4J9BA 5FROA 3MCAB 2DD4A 3QWYA 3JSCA 2DO3A 2X4XA 2GGRA 2LJ1A 3QPHA 2RQVA 4QQ6A 1RAIB 1YI2T 4C5HA 2O2OA 2JTFA 3LYIA 1V29B 2CSQA 2JN0A 3FJ5A 3EFSA 2CP3A 4JDSA 1TU0B 3BW1A 4JZ4A 3RMQA 3OYKA 1KK7A 3CPWP 2LVMA 1PKTA 2H3JA 1K8AC 2B8AA 2HDAA 3PE0A 1VQ5T 4LDUA 3JCMh 2CDTA 4QT7A 2RI5A 3PNWC 1KQSS 3SWNA 3LX7A 5DY9A 4DBQA 1JEGA 3UT1A 1HK9A 5GAN6 4PJOG 4FIBA 1QCFA 1I9GA 1LVKA 2RHZA 1NZ9A 4J7FA 3CD6A 1RI0A 1SHGA 3L2RA 1JJ2A 1X43A 1ABQA 2DTOA 4KH0B 5HCKA 5A2QE 1N5ZA 4M4ZA 1Y07A 3CMEQ 3PFSA 2KE9A 3OMGA 2EYWA 2NUZA 2BTTA 5A0GA 4V2SA 1AWWA 2DZ9A 2V8JA 4M75F 4HCCA 3C4SA 1M3AA 4RTXA 5FU7C 3EG0A 3RIRA 1U1TA 1MNDA 4E7HA 2FEIA 1ZC1A 3UA7A 1RLQC 3G71Q 1M90R 4M7AC 4EPCA 2NWMA 1M1KC 1V76A 1QWEA 4M78C 2ROTA 1MUZA 4ZGEB 1QVFS 1TXQA 2D0QB 3QC8A 1IGUA 1VQPA 3OYIA 3I55Q 1YITA 4RCCA 2MF2A 2D6FA 2D1XA 3LH5A 2EFIA 3VS5A 2FRWA 2HAXA 4ATOA 4CRIA 4A4HA 2RHXA 2GF7A 5D6YA 2JOYA 1PD1A 3JCMg 4RTZA 1AZGB 3J7AF 2K9GA 2IIMA 5J39A 2ZPEB 4A4FA 1KIKA 1B34B 3NTHA 3JCMe 3OYYA 2D9TA 2QG9B 1GFDA 2HD0A 1RUWA 2F2XA 3TQ7P 3H8ZA 1YI2A 2QAZA 4C92G 3META 3PMIA 2HNIA 2KAFA 3OYEA 3NMZC 4Y92A 1KHCA 1PHTA 1W2BS 2YUPA 4K11A 3OYDA 4MZMA 2M0YA 2CREA 2JM9A 4OGCA 2OTLA 1RACB 1AVZC 4LDYA 2JVVA 4ZTFA 1VQ9T 3P8HA 5GANf 1OX9A 1SPKA 2CP6A 2QYZA 1XTDA 1TSFA 1WHGA 5I2MA 2E3IA 3GP8A 3QYGB 4N4IA 3EAEA 3VU3C 3OYJA 2LNVA 4L6V5 1GBQA 5GAN7 2A08A 4LDXA 1GCQC 2DTIA 2XKOC 1S72A 4CC7A 1I5LA 5CKEA 9ATCB 5GMKm 2RN8A 3WXMB 1UG1A 3D7SB 3OYCA 1K73U 3I56A 3LH0A 2BIVA 4J6XA 3C95A 2OTJQ 2P84A 3DLMA 1OOTA 3QIIA 2E3HA 4HVVA 3A8OB 2OTLQ 1LPLA 1BK2A 4M75E 1U3OA 2K57A 1YITQ 2CZ1B 2FG0A 4HCKA 4J5YA 1B34A 2QTVA 1WQ7A 1E6GA 1P92A 1NLPC 1EZZB 2M02A 2M16A 4DEXA 3GOXA 1VQMQ 3JB9H 2JS0A 4M7AG 3JB9J 4A4EA 2KEAA 3PT9A 2KGTA 5A0LA 3G6EQ 2FPDA 2DJZA 4AFSC 4GLKA 1VQ5A 2KRSA 3TSWA 3O5ZA 4M7AB 1BB9A 4LE9A 2YRVA 4J9IA 1PD0A 1JXOA 3AT1B 1D1BA 3VRYA 2PTKA 4C8QG 2DXCA 3E9FA 3GBQA 4F16A 2DKGA 4R55A 3EGDB 2R5AA 3OY9A 1BIAA 3JB9I 1LNXA 5CCAA 3DB3A 4X1VA 4OMMA 2HL3A 2RH2A 4ARCA 3X24B 5CKBA 4JJBA 2OTJT 3UWNA 3OA6A 5IXBA 1OU9A 4E7IA 2X9HA 3QHSA 3HU1A 3V7CA 2E65A 3G4SQ 1NPPA 4C0DC 1OZ3A 4XU0A 4F7UG 1WFWA 1ZA2B 2A36A 2LT4A 2CKKA 2K7AA 2YRDA 2DIQA 2LQWA 1Q95G 1D09B 3NTIA 4EMGA 3S3NA 1A0NB 1YHQT 4XTXA 2BUDA 3M9QA 4J9GA 4PJOE 3A8GB 3LLRA 2YUJA 4JPBW 2PVDB 4M77C 3CF2A 5I2SA 4M77A 3HFOA 4BI8B 3CXCA 1HD3A 2GFUA 4HXJA 5CD1A 1YIJQ 1VQ9Q 1Y57A 2DXBA 2B25A 1I81A 2RHUA 3OYMA 3LWHA 1TUCA 3UATA 4XTVA 1K9MR 1BCOA 2COYA 3CMAQ 1Q81R 1Q82R 3FEOA 2X51A 1KD1R 5LJ5j 1EX4A 2RMOA 2PUKB 5IN1A 3J81E 4C0DB 1MMDA 1UJ0A 2JM8A 2R57A 5FWBA 4D8KA 6AT1B 4MMLA 1X75C 3TIWA 4RTUA 3QWXX 1OYXA 3V8JA 1TUGB 5CAIA 3TSZA 4M75G 2RK2A 2QEXQ 4BE2A 3CCRQ 3L2QA 3CCUQ 1YJNT 1I4K1 2M9UA 3L2VA 1ABOA 2EJFA 2A7YA 2L3QA 1K73C 5FU6B 5FRMA 8ATCB 1AT1B 1QCNA 4KDLA 4XU1A 2LT1A 3OW2S 1WA7A 2LCSA 3QQ7A 3FJPA 2ZPBB 1GBRA 1AD5A 4MMKA 3X26B 1SF9A 4PK4A 2XG8D 5HY6A 3DKMA 4FU6A 2V8KA 4NOYA 2CP0A 2QGGA 1IHVA 3OSSC 1YWPA 2KRNA 2C0OA 3CCJQ 2YT6A 4C92D 3NTKA 1QVGP 1PG5B 1QVGA 2HSEB 1H8KA 1MMGA 1U1SA 2E1HA 3LHDA 1UEBA 1VQMT 3M5AA 1GCPA 2OX7A 2JT4A 2KROA 4HCZA 1SSFA 3E1SA 4ORZA 3MKDA 5CKHA 4JRKA 2J6OA 2RJEA 2XMFA 3GNFB 3KUFA 2KRMA 4HA8A 4WF2A 1SG5A 1FXXA 2BZYA 2XDDA 1B3QA 4D8DA 2EYQA 3ZJTA 1NEGA 1R0CB 1S3SA 3PVLA 1MV3A 3RMSA 1BI0A 3CPWA 2VASA 2RI3A 4RMOA 4ZGDB 3MEAA 4WTOB 1ZSGA 1E7OA 2QDLA 2E10A 3CCSA 2DVJA 1QCOA 1YHQQ 3JCMW 3EGXA 3GIBA 2LTOA 2GQIA 1GCQA 1K8AU 1YJWQ 3BQBA 5I21A 4NL3A 1SSHA 3OBWA 3H9NA 4HCBA 2K2MA 1Q86C 1CZ4A 4M7DE 3LW5E 2Q1DX 3OS1A 1RI9A 1VYVA 3S6WA 3M53A 1M4ZA 5CVIA 1HYOA 1CR5A 1PWTA 2PJHB 1M30A 1M2OA 2AHJB 2FL7A 3M58A 3WVEB 1O54A 2RK1A 4DEYA 4HKEA 1TH7A 3MB5A 2ZPIB 3X25B 1K0XA 4X9DA 1MHNA 3CCMQ 3MEVA 1YP5A 4LDVA 1CSKA 4RG2A 3VS3A 2P4RA 3I35A 4C8QD 2KNBB 5GANh 4QVZA 2YWWA 2AK5A 5I22A 1J3TA 3EFRA 2DILA 1K8AR 4F04B 1M1KU 4II1A 4BY6C 3CCET 3CCRT 3REBB 3HFNA 3M59A 3VS7A 5KCOA 3EGXB 1M5Q1 2OTLT 1U5SA 2K3BA 1V1CA 2KMTA 2RI2A 3L42A 3M54A 2C0IA 3CC2T 4MZPA 4BI4A 1WXUA 2DERA 1QKXA 2L5QA 3E2UA 2J6FA 2OTJA 1FMWA 2XK0A 1ZSZA 4PLLA 2G3RA 3QO3A 1S1NA 2KXCA 5FWCA 2VC8A 5C18A 2QQ9A 4JRIA 1UJYA 1UGPB 3CCRA 1W4SA 3A8LB 1KQ1A 4BB7A 3SD4A 5GAOn 5FTKA 2WSFE 3RBBB 1VQ6A 4E2FB 2AIRB 4C92F 3INZA 4F7UE 3RNJA 3JAME 1YJ9Q 3SB2A 1X2QA 3OW2A 3CCMT 4UC4A 1NBEB 3ZL7C 4N0AC 1M3BA 3CCVQ 1H3ZA 4PLIA 4XQ3A 4N0AA 1OI1A 5GANe 3CCEQ 1YITT 2W0ZA 3C0CA 3PIOA 2VB6A 4J7IA 4M7AD 1XJWB 1RAEB 5GMKj 3CPWS 1LJOA 3N5BB 5FTMA 2VXFA 2L2PA 4LXCA 3T9NA 4DA4A 1MMAA 3HSBA 3VUBA 4BI3A 1OEBA 2XICA 1VQMA 1KQSA 4M78F 4A53A 4LUDA 3QG1A 1KQ2A 4J6YA 4EMKA 4LNPA 2RA2A 1X27A 1WJQA 4M7AE 2EQUA 4ELZC 1YJWA 4JJNK 4C92B 1R7RA 1WNLA 4IIOA 4PFOA 1CZ5A 3H0IA 3OYGA 2DTHA 5FU6C 4PFZA 2GTJA 4NL2A 2DF6A 2K3XA 4AT1B 4QKUA 1OPLA 2RM4A 2O4XB 3PTAA 1D0ZA 2FYKA 2DL3A 2KVQG 1VOMA 4PJLA 3P8DA 3MEUA 4MZTA 1VQ8T 4ZNXA 3ZBDA 1VQKQ 1IHWA 2PVGB 2FO0A 4DQ2A 1PCXA 1Q82U 2YXYA 1PSEA 2XD0A 1VQKT 2A0FB 2COZA 2DL5A 5CO7A 1N8RC 4RV0A 4IUVA 2DRMA 1WJSA 3GF5A 2DXTA 2QA4A 4C5GA 4EMHA 1C6VX 1C1AA 1Y0MA 4A4GA 2QQBA 2QQRA 1G83A 2EKHA 2XDPA 2CP5A 4F14A 1RAHB 2KY9A 4A63B 4MDWA 4JLIA 2NLUA 2YUQA 3FC3A 1W6XA 1G3TA 1YJWT 2FZGB 1QP2A 1XQHA 2KYBA 1X6GA 4JJCA 4X9CA 1AWOA 1W70A 1VQLT 4AFQC 2WSEE 3OQ5A 3CC2A 3I56Q 3FLGA 3QJYA 1TG0A 4XTZA 3FPTA 4FYWB 3CC7Q 5I11A 4M7AA 1Y71A 4GBQA 3UF4A 4DBRA 3G71T 1BBZA 1LOJA 3NHNA 1QLYA 4M78A 4PJOA 2CT3A 4OB1B 1WDXA 3BDLA 2V8IA 4F17A 3VYGA 3OYAA 2DL8A 1H3HA 2QA4Q 1ZHIA 1B7TA 4FYVB 3CCLA 4FW2A 4L5GA 2IPOB 4E7LA 2L8DA 1YI2Q 4D6WA 3BDUA 4PJJA 1VQ9A 5B6CA 3MJXA 1NLOC 3NGPA 2K2VA 2E6NA 4FCYA 4C92C 2LX9A 3L2ZA 4PL6A 1K9AA 2RQTA 2OJ2A 2H8HA 2NUPA 1BU1A 2HEQA 3CCST 2KDSA 1VQKA 4XTYA 2M1HA 2VWFA 2QEXT 1WHHA 2K6DA 1IXDA 4M78D 1VYUA 4KODA 4CQNA 2DK3A 3QZ9B 3PGGA 2QTXA 1VQ7A 1Q82C 1CKAA 2LNHB 4FM4B 4BDZA 3I56T 4BDYA 3V7SA 1VQLQ 4E6RA 4QQGA 4KT0E 4Z02A 4CC4B 5LJ3d 3JCMb 2VXEA 3G7ZA 3MEWA 3R6NA 1WGSA 2RD1A 3CMAT 2VVKA 2DRKA 1ACMB 3C12A 2D8JA 1KD1C 3FRNA 1NJIU 3EG3A 1Q81C 1AEYA 4FYXB 2CP2A 3EFOA 3LGFA 4BY6B 1UFFA 4M77D 5KCHA 2XHCA 3LGLA 2FRYA 1T3SA 2E5QA 5KYXA 3RERA 4C8QE 2C06A 3EHRA 2CS7A 2L3PA 1VQ6T 2MM2A 1OZ2A 1X2KA 4M75B 4C0ZA 1NJIR 4E7JA 3LWIA 1UHFA 4XK8E 5LJ5e 2HZYA 2HBWA 2MWOA 3EHQA 1VQ4A 1BI2A 2Z0WA 4LD6A 4PNOA 5KYXB 3E19A 1KQSP 2L3SA 3EGUA 4FYYB 3MHXA 3I55A 2DEQA 1K76A 1JB0E 2EWNA 2ENMA 1UGRB 3RESA 4PKCC 3GPLA 4PJNA 2M51A 1OQKA 2JXBA 2DETA 1PC0A 1WX6A 2MCNA 3TEEA 2RQUA 2DNUA 1YJNQ 2IG0A 1PRLC 1RL2A 4M78B 5KYYB 2GNCA 1D1CA 1Q86U 5KYWA 2FPFA 2DBMA 3CEYA 1QWFA 1VQNQ 4HT8A 1KG1A 3OYHA 3EG2A 1F1BB 4DBFA 1IZ6A 2MIOA 4C0FA 1WJRA 2YSQA 5HKCA 5AT1B 2DZCA 1SKUB 4M7DG 4E7SA 1NG2A 1G3YA 4DBHA 4RTVA 2EJGA 5GAOq 1I5OB 2GBQA 3S3OA 3RUXA 2XIDA 3OS2A 5GANg 1N9SA 2WSCE 3M0QA 2FVUA 2KR3A 1UHCA 1UECA 4JRQA 1NPRA 1RAAB 3OBYA 4FL6A 2KT1A 1Q81U 1OPKA 1U8RA 3EG9B 3VS0A 1WXBA 1N6AA 4AG2C 4B9XA 3ME9A 3H6ZA 5GAN8 4M75D 4LUEA 4GY5A 3OMCA 3J80E 3H0HA 3V8LA 2EQMA 2EW3A 1VQ4Q 2YUNA 1KC8U 1JO8A 1Q86R 1YJ9T 3OYLA 1YBYA 3E9GA 4ZN3A 1FMVA 4XTWA 1B07A 1BKBA
chains in the Genus database with same CATH topology
4XU3A 5DLOA 3JCMX 1JJ2A 1ZBXA 2LQ8A 3MEVA 2DTOA 1VQLA 1G5VA 3JCMd 4LDVA 4JS4A 2MM0A 2XI9A 1BIBA 5A2QE 4RG2A 5CK9A 2QDYB 4C8QD 3ZEHA 3QZ5B 2ZCFB 4C5IA 1Y07A 4E47A 2K4YA 2HBPA 3PFSA 4QVZA 5IAYA 3OMGA 5GANh 3NFCA 5GAOm 3CCUA 2F69A 1KHIA 2X4YA 3ZJUA 3VKIA 5A0GA 1M1FA 5LJ3e 4V2SA 2Q19X 2DZ9A 2V8JA 3CCEA 3EFRA 2YVLA 1QW1A 4M75F 4OB2B 3C4SA 4HCCA 1M1KU 2L89A 4II1A 4BY6C 1O9SA 3M55A 1QVGS 3CCET 3BFMA 3CCRT 3CBMA 3CC7T 5FU7C 3UPUA 2PVOB 1G3SA 3HFNA 3M59A 3RIRA 3CC4A 2M0OA 5KCOA 1M5Q1 1U1TA 3MP6A 4E7HA 3TU4K 2OTLT 2MI6A 2KMTA 4QVDA 2RI2A 3L42A 4Q5WA 5C0MA 3FDRA 1M90C 3M54A 4M7DD 3CC2T 1ZC1A 2E41A 4KBMB 2XU8A 4M7AC 3HRTA 2LDMA 4MZPA 4BI4A 4EPCA 5GANd 3Q1JA 1JRIA 2L5QA 4F7UF 1Q7YC 1M1KC 2Q18X 4AS1A 2DD5A 2OTJA 3CCVT 5L8RE 4KLNA 2F5KA 1GXIE 5CKDA 4M78C 1X01A 4M78E 4M77E 4BE1A 4ZGEB 2XK0A 1QVFS 2D0QB 2HQXA 3FIFA 3QC8A 5GMKl 1M90U 4KULA 4PLLA 2G3RA 1VQPA 4ZGJB 4RG8A 3QO3A 3OYIA 2VUBA 5EG2A 3PMTA 3QUIA 2MF2A 4RCCA 1YITA 1Q7YU 2D6FA 2VC8A 4F7UB 5C18A 2QQ9A 2EFIA 1VIFA 4JRIA 2MAMA 2HAXA 4ATOA 4CRIA 3G4SA 1UGPB 4A4HA 3CCRA 2RHXA 2GF7A 1W4SA 5D6YA 3A8LB 2JUFA 2JOYA 3G6EA 1KQ1A 2YLBA 3JCMg 4BB7A 3ZGZA 3SD4A 3F70A 4XU2A 5GAOn 5FTKA 3SFMA 4IURA 2WSFE 1N9RA 4FSXA 1VQ6A 3J7AF 3TREA 3VV0A 4ZTJA 4C92F 2RHIA 3INZA 1M8VA 4F7UE 3JAME 5J39A 3CCVA 2ZPEB 4A4FA 3SB2A 1M9SA 2JV2A 1B34B 3NTHA 3JCMe 3OYYA 5KE3A 5GAOp 2D9TA 4UC4A 3CCMT 3OW2A 2LCCA 2HD0A 4P5NA 5GMKh 2LCLA 4N0AC 2KK4A 2RB6A 4M77F 2QQSA 3H8ZA 5D6XA 4PLIA 4XQ3A 3GLXA 4N0AA 4C92G 1YI2A 1OI1A 5GANe 1H3ZA 2L3RA 3META 3FB9A 3PMIA 2HNIA 5GLFA 2LQKA 1YITT 4KDIA 2KAFA 3OYEA 4DOVA 3PIOA 1KHCA 4J7IA 1W2BS 4M7AD 3QBYA 5GAN5 3OYDA 2EIFA 2RO0A 3I55T 1YIJA 5GMKj 4Y91A 3CPWS 4MZMA 4C8QB 1LJOA 4OGCA 4C8QF 3CC7A 2OTLA 3N5BB 2A3LA 2VXFA 3JCMf 5CR2A 3CC4T 3QWZA 1G3WA 5FTMA 1S72T 3T9NA 5DYGA 4LDYA 2JVVA 3KXTA 4DA4A 3HSBA 4ZTFA 3VUBA 4BI3A 1VQ9T 3P8HA 5GANf 1N8RU 2QQAA 5GMKe 2XICA 1VQMA 1KQSA 4M78F 4A53A 4MDXA 1XTDA 1WQWA 2KSSA 1YCYA 3QG1A 4EMKC 4M7DC 2HQEA 4OF1A 1KQ2A 5I2MA 4J6YA 4EMKA 3GP8A 3QYGB 4N4IA 3CXCS 2RJDA 3EAEA 3JCMc 2RA2A 3VU3C 5J26A 1WJQA 4L59A 4C92A 3KBGA 5GMKi 3OYJA 2EQUA 4ELZC 4B9WA 3L2UA 3CMEA 1YJWA 1MGQA 2LNVA 4L6V5 4JJNK 4C92B 4A4KA 1R7RA 1WNLA 2EQJA 2QEXA 5GAN7 1YJNA 4LDXA 3MP1A 1CZ5A 5GAOr 2DVEA 2CZ0B 5DYIA 2GQVA 4XAXB 3OYGA 2DTHA 4C0GA 4JUVA 5FU6C 2DTIA 2XKOC 1Y7XA 5DM7R 4NL2A 4KUDK 1S72A 3G6ET 2K3XA 1JBMA 3HHTB 1I5LA 5CKEA 5GMKm 2JNGA 3WXMB 4QQDA 4TVRA 3QXEB 2RM4A 3OS0A 5LJ3j 2O4XB 3PTAA 2FYKA 3OYCA 5C1BA 1K73U 2KVQG 4LDWA 3RKWA 3I56A 3CCUT 3A8MB 5CQYA 3LH0A 2BIVA 3P8DA 4J6XA 5EQJB 3C95A 3DLMA 3MEUA 5CIUA 4RCBA 4MZTA 3QIIA 1VQ8T 4N4HA 1Y96B 3JCMV 3ZBDA 2PWYA 2YLCA 2PVGB 4DQ2A 1BI3A 3M57A 3HU3A 4OGEA 1Q82U 3A8OB 1PSEA 2XD0A 4M75E 2K57A 1VQKT 4IUUA 2CZ1B 2P4TA 5CO7A 3OSVA 4FT2A 4QVCA 1N8RC 4RV0A 4IUVA 4NS5A 5GANj 4PJOB 3HRUA 2F5TX 4J5YA 5KE2A 1WJSA 1B34A 3GF5A 2DXTA 4OMFB 5KH6A 2P0QA 2QA4T 3HKSA 2QA4A 1WQ7A 4IUTA 1P92A 4C5GA 3V7RA 4EMHA 1WPYA 2M16A 3JCMQ 5FRNA 2Q1AX 2E64A 3GOXA 4PJOD 4A4GA 2QQBA 2QQRA 3JB9H 4M7AG 3JB9J 4A4EA 1UGSB 3PT9A 3X20B 4PJOF 3O8VA 5A0LA 3QSUA 5A0DA 2Y4YA 2DJZA 1BYMA 2XDPA 2KY9A 3CBPA 3HL8A 4JLGA 4MDWA 4GLKA 4BD3A 2Y4XA 2NLUA 4JLIA 1VQ5A 4M7AB 3V8KA 3FC3A 4M7AF 1VQ8A 4EDUA 4XTUA 1G3TA 3OS5A 1YJWT 2YRVA 5CD1A 4ZN1A 1QP2A 3DLLA 4C8QG 2DXCA 4OP0A 1XQHA 3E9FA 3VUZA 5GAOl 2DKGA 3MO8A 4QW2A 4R55A 4Y28E 2R5AA 4X9CA 3OY9A 1BIAA 4IUPA 3JB9I 4OVAA 5LJ5g 1VQLT 5GAN2 2WSEE 3QKJA 1LNXA 2X4WA 2JZ2A 3DB3A 3OQ5A 2PU9B 5CCAA 1VQ7T 3CC2A 3FLGA 3QJYA 4XTZA 3FPTA 2RH2A 2K5FA 5GAMf 3A8HB 3M4YA 3CCQT 4ARCA 3X24B 5CKBA 4M7AA 2EQKA 1Y71A 4FT4A 3P8BB 3UWNA 3OA6A 4M7DF 3CCQA 2OTJT 4E7IA 3QHSA 3G71T 4HT9A 1LOJA 3JB9D 3OYNA 3QYHB 1E32A 3HU1A 4PJOC 3V7CA 2E65A 4M78A 1NPPA 4PJOA 2DXUA 4C0DC 1OZ3A 4XU0A 4F7UG 3BDLA 4OB1B 2FB7A 2V8IA 3VYGA 3OYAA 2VV5A 3CMET 2LT4A 2CKKA 1VQOA 5GAMg 1YIJT 4C8QC 5LJ3g 1NE8A 4EMKB 5GAN3 1ZHIA 2K5IA 4ELYC 2DIQA 4C8QA 2P0PA 3HP9A 4EMGA 3NTIA 3S3NA 3CCLA 1YJ9A 4E7KA 1WLFA 1Y96A 5IT9E 3JB9F 5ERGB 4L5GA 2X35A 1YHQT 5FTJA 4XTXA 2BUDA 1YHQA 1N27A 1KD1U 3ZFJA 3M9QA 4E7LA 3ASKA 1XOVA 4AQ7A 2L8DA 4M75C 4VUBA 5LJ5d 4PJOE 1VUBA 3A8GB 4D6WA 3LLRA 2YUJA 2PVDB 4M77C 3BDUA 4J6WA 4JRPA 3A5ZB 1VQ9A 5I2SA 5LJ5f 2LW6A 3CF2A 4M77A 3HFOA 5B6CA 4BI8B 3CPFA 3CXCA 3G71A 2GFUA 3JRZA 4IUQA 2ZPFB 3SDZA 1VIEA 1EIFA 2CYZB 2K2VA 2RJCA 2E6NA 4ME7A 2Q1DX 3HU2A 4C92C 2LX9A 2RHYA 2O4XA 2O01E 2EJ9A 2R58A 3L2ZA 4PL6A 5C6SA 2DXBA 1VQ4T 5LJ3h 1X6OA 2FHDA 2B25A 1UGQB 1I81A 2RHUA 3OYMA 1VQPT 2R5MA 3LWHA 3G4ST 1K9MC 4XTVA 3MP8A 3CCST 4J83A 2KDSA 1VQKA 3QQ8A 4XTYA 2M1HA 5LJ3f 2LC4A 2QEXT 4M7DB 4M78D 1AHJB 4KODA 4CQNA 2DK3A 3FEOA 3QZ9B 3PGGA 3UDCA 1D3BA 2QTXA 5LJ5j 2PUKB 3GNGA 5IN1A 1VQ7A 1Q82C 2I2LA 3J81E 3CD6T 4C0DB 2E70A 4C5EA 4FM4B 5HK3A 4BDZA 2MWPA 2R57A 3I56T 2CZ6B 1W2BA 4BDYA 2RJFA 3V7SA 3X28B 3URGA 4C92E 2JTMA 1NJIC 4QQGA 4KT0E 2DIGA 2K5LA 2ZZDA 4Z02A 5GAMh 4MMLA 5LJ3d 3JCMb 1X75C 4CI0C 3CCMA 3TIWA 4BACA 2VXEA 5CQXA 3ZJVA 3G7ZA 1OYXA 3RKYA 3MEWA 3CBOA 3V8JA 5CAIA 4R56A 5FTLA 2WACA 1WGSA 4M75G 2RK2A 3L2WA 2RD1A 4X34A 4BE2A 3CMAT 5DLQE 3R6OA 3L2QA 4M78G 3C12A 2DPPB 1KD1C 1YJNT 1PSFA 3FRNA 1NJIU 1I4K1 4LD9K 1Q81C 2M9UA 2VYTA 3L2VA 4OB0B 2YHTA 4JS5A 3DB4A 3LGFA 4KUIA 2PUOB 4M77D 4RKUE 4BY6B 2EJFA 2A7YA 4J8OA 5KCHA 1K73C 2XHCA 5FU6B 5FRMA 2VGNA 3LGLA 2E5QA 3RERA 1R8OB 2GCXA 5J3BA 2EAYA 4C8QE 4OB3B 2C06A 4KDLA 4XU1A 5M9OA 2CS7A 2LT1A 1VQ6T 2MM2A 2GFAA 3OW2S 2CGHA 1OZ2A 2P0KA 3QQ7A 3VYHB 4M75B 4C0ZA 3FJPA 2ZPBB 4IKFA 5CKFA 3FPUA 3SWNB 4E7JA 4MMKA 4BE0A 3X26B 3LWIA 4XK8E 5CCXA 5LJ5e 2EKOA 1VQNT 3L1AA 1QDNA 1FWZA 2MWOA 1VQ4A 2XG8D 1BI2A 2MMPA 4LD6A 3DKMA 4FU6A 5HY6A 4A54A 2KQWA 2V8KA 4NOYA 4PNOA 3E19A 2Y90A 3OSSC 4YTLA 1O75A 3M56A 1IREB 1XNIA 5LL6S 4KO8A 3MHXA 3TCJA 5GAMj 3I55A 5GAMd 2DEQA 3NTKA 4C92D 1QVGA 3QJ6A 1QVFA 1JB0E 4M77G 2EWNA 2LRQA 5AYFA 3RESA 1UGRB 2Q1CX 1U1SA 4PKCC 3GPLA 2E1HA 3CCJA 3LHDA 1HXDA 1FX7A 1UEBA 2QI2A 1ZQ1A 1D3BB 5LJ5h 5GAMe 2E12A 1VQMT 5HK0A 1H641 3TEEA 3AHUA 3M5AA 2IG0A 4HCZA 1SSFA 3HPWA 1VQOT 4F7UA 3E1SA 1RL2A 4M78B 1VQNA 3WVDB 5CKHA 1Q86U 2VGMA 4JRKA 4O5VA 1DJ7B 2RJEA 3C94A 2BKDN 2IVWA 2X4JA 5FU7B 3CEYA 3GNFB 3KUFA 4HT8A 5D6WA 1KG1A 5EPPA 4HA8A 4WF2A 2ZPGB 4BUGA 1FXXA 2XDDA 2K3YA 3OYHA 3CCLT 3JCMP 4DOWA 4M75A 3JCMJ 2EYQA 3PIPA 2DAQA 3ZJTA 1S3SA 1IZ6A 4C0FA 5FROA 3CCJT 5GAN4 3MCAB 1WJRA 2CZ7B 1BI0A 2DD4A 3RMSA 3JSCA 3CPWA 4O6JA 5HKCA 2DO3A 2X4XA 3OYBA 2RI3A 4RMOA 3QPHA 3HRSA 2DZCA 4QQ6A 4ZGDB 3MEAA 3FPRA 5CCBA 4M7DG 1YI2T 3OB9A 3SWNC 1G3YA 4C5HA 5GAOq 2E10A 2EJGA 3CCSA 2JTFA 2OAUA 3LGAA 5FTNA 1I9GA 3LYIA 3S3OA 1UB4A 3RUXA 2XIDA 3JCMW 1V29B 2JN0A 3GIBA 2LTOA 3EFSA 2XDBA 3QDRB 4JDSA 1QVPA 1K8AU 3BW1A 3OS2A 3M4GA 3OYFA 5GANg 3BQBA 1N9SA 2WSCE 2FVUA 3RMQA 3ER0A 5I21A 4NL3A 3S3MA 3MB5A 3OYKA 4JRQA 2ZPHB 3VJPA 3OBWA 1NPRA 3OBYA 4FL6A 3JB9G 1Q81U 4HCBA 1BI1A 2LVMA 4M77B 1I8FA 1U8RA 2H3JA 1K8AC 1N6AA 1K9MU 1Q86C 2B8AA 1CZ4A 4M7DE 3LW5E 4B9XA 4LDUA 3JCMh 3ME9A 3H6ZA 5GAN8 3OS1A 1VQ5T 2PQWA 1QCSA 2QXFA 4M75D 3CMAA 1KC8C 1M1GA 2RI5A 3PNWC 2ZGWA 3S6WA 1JJ2S 4N4GA 1KQSS 3M53A 1M4ZA 4GY5A 4M7DA 3RKXA 5FLXE 4X9DA 5CVIA 1CR5A 3SWNA 2PJHB 3LX7A 5DY9A 2FL7A 2AHJB 3OMCA 3J80E 3M58A 4ARIA 3WVEB 4M7AE 3UT1A 3V8LA 1O54A 1HK9A 2E6ZA 2EQMA 5GAN6 2RK1A 4HKEA 4PJOG 1KC8U 1QP3A 1TH7A 4FIBA 3OYLA 1YJ9T 1YBYA 2RHZA 2ZPIB 1NZ9A 3BY7A 3E9GA 4J7FA 4XTWA 1RI0A 3X25B 4ZN3A 3CD6A 1BKBA 3L2RA 1MHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZ3 A;  3MEV A;  3BDL A;  1G5V A;  3OYA A;  1XNI A;  2HQE A;  2CKK A;  4RG2 A;  3ZEH A;  3NTK A;  4N4I A;  2DIQ A;  4C5I A;  2RJD A;  3EAE A;  3QJ6 A;  5J26 A;  1WJQ A;  2LRQ A;  3NTI A;  3PFS A;  4L59 A;  3OMG A;  2EQU A;  4QVZ A;  4B9W A;  5IAY A;  3OYJ A;  4E7K A;  2X35 A;  2X4Y A;  3OYC A;  2BUD A;  2EQJ A;  1N27 A;  3L2U A;  3M9Q A;  3MP1 A;  3ASK A;  4E7L A;  2L8D A;  3OYG A;  3LLR A;  3C4S A;  2IG0 A;  4HCZ A;  1SSF A;  2L89 A;  4II1 A;  2K3X A;  2GFU A;  4IUQ A;  4QQD A;  2RJE A;  2M0O A;  2E6N A;  2RJC A;  3MP6 A;  5KCO A;  2BKD N;  2O4X B;  2RHY A;  2O4X A;  3OS0 A;  2R58 A;  4E7H A;  5C6S A;  3CEY A;  2RI2 A;  3L42 A;  4PL6 A;  4Q5W A;  3FDR A;  3KUF A;  5C0M A;  2FHD A;  5D6W A;  3S3N A;  3LH0 A;  2BIV A;  3P8D A;  2RHU A;  3OYM A;  2LDM A;  3OYH A;  2K3Y A;  2R5M A;  3DLM A;  3MEU A;  3Q1J A;  5CIU A;  3MP8 A;  3QII A;  2M1H A;  4N4H A;  2DAQ A;  2F5K A;  5FRO A;  4BE1 A;  1WJR A;  3FEO A;  2XK0 A;  2HQX A;  5IN1 A;  4IUU A;  2G3R A;  4PLL A;  2X4X A;  4C5E A;  3OYI A;  3OYB A;  2RI3 A;  3PMT A;  4BDZ A;  2R57 A;  2MWP A;  4IUV A;  4NS5 A;  3MEA A;  4QQ6 A;  4BDY A;  2RJF A;  1WJS A;  2EFI A;  5KE2 A;  3OB9 A;  5KH6 A;  4QQG A;  4IUT A;  2DIG A;  4C5H A;  4Z02 A;  4C5G A;  4CRI A;  2M16 A;  2JTF A;  5FRN A;  4A4H A;  2RHX A;  2GF7 A;  5D6Y A;  4A4G A;  3GOX A;  4BAC A;  3LYI A;  2QQR A;  3S3O A;  4A4E A;  1OYX A;  3MEW A;  3O8V A;  3SD4 A;  2LTO A;  1WGS A;  2WAC A;  3F70 A;  3L2W A;  2XDP A;  4X34 A;  4BE2 A;  3OS2 A;  4IUR A;  3OYF A;  3L2Q A;  4ZTJ A;  4BD3 A;  2NLU A;  2RHI A;  3S3M A;  3OYK A;  5J39 A;  3FC3 A;  2VYT A;  4A4F A;  4EDU A;  3L2V A;  2YRV A;  4FL6 A;  3DB4 A;  3LGF A;  3NTH A;  5KE3 A;  2D9T A;  4UC4 A;  5KCH A;  2LCC A;  2LVM A;  5FRM A;  3LGL A;  2QQS A;  3H8Z A;  2E5Q A;  4FU6 A;  4PLI A;  5D6X A;  3E9F A;  1H3Z A;  1OI1 A;  2B8A A;  2L3R A;  3MET A;  3MO8 A;  2R5A A;  3PMI A;  4QW2 A;  3ME9 A;  3H6Z A;  4B9X A;  5M9O A;  3OS1 A;  2PQW A;  4IUP A;  3OY9 A;  4OVA A;  2GFA A;  3OYE A;  1OZ2 A;  2P0K A;  3QKJ A;  1KHC A;  2RI5 A;  3PNW C;  2X4W A;  2JZ2 A;  3DB3 A;  3OQ5 A;  4N4G A;  3S6W A;  3QBY A;  4GY5 A;  3OYD A;  3FLG A;  4IKF A;  2RO0 A;  4E7J A;  3LX7 A;  4BE0 A;  3OMC A;  2EQK A;  3UT1 A;  3UWN A;  3OA6 A;  4E7I A;  2EQM A;  2EKO A;  4ZTF A;  3OYN A;  2MWO A;  3OYL A;  2RHZ A;  3E9G A;  3P8H A;  4LD6 A;  1RI0 A;  3L2R A;  1MHN A; 
#chains in the Genus database with same CATH topology
 2LJ3 A;  4XU3 A;  1TWB A;  2J7I A;  1ZBX A;  2LQ8 A;  5DLO A;  3A98 A;  3JCM d;  2MM0 A;  1BIB A;  2QDY B;  3ZEH A;  1OUL A;  2D8H A;  2ZCF B;  4E47 A;  2EYZ A;  5IAY A;  3NFC A;  2MYS A;  3CCU A;  2F69 A;  4AG1 C;  1KHI A;  2X4Y A;  2HQH A;  2AKK A;  5LJ3 e;  2Q19 X;  1Z9Z A;  3CCE A;  1GFC A;  1S72 Q;  4OB2 B;  1WIE A;  2NUT A;  1UTI A;  2L89 A;  1I0C A;  3UA6 A;  3MPU B;  1QVG S;  3CC7 T;  3CBM A;  1K0S A;  2PVO B;  1G3S A;  3CC4 A;  3RR6 A;  2M0O A;  3TU4 K;  4QVD A;  3VS2 A;  5C0M A;  3FDR A;  1M90 C;  4M7D D;  2E41 A;  2XU8 A;  3HRT A;  3Q1J A;  2J05 A;  4F7U F;  4AS1 A;  4KLN A;  1KJW A;  1PNJ A;  1GXI E;  2F1L A;  4BE1 A;  2ABL A;  3FIF A;  5GMK l;  1M90 U;  2JW4 A;  4ZGJ B;  2KYM A;  2VUB A;  3QUI A;  2CSI A;  2DMO A;  4F7U B;  1VIF A;  2MAM A;  3G4S A;  3PVQ A;  3H0F A;  3G6E A;  1X6B A;  1TTH B;  2ESW A;  1RAG B;  3F70 A;  4XU2 A;  3SFM A;  3TRE A;  2SRC A;  2RHI A;  1M8V A;  2SEM A;  1M9S A;  2JV2 A;  5GAO p;  1WHJ A;  2LCL A;  4M77 F;  1ZUY A;  1WI7 A;  2QQS A;  2RB6 A;  5D6X A;  5GLF A;  2L3R A;  7AT1 B;  1T0J A;  5L23 A;  4DOV A;  2DFU A;  3SHW A;  3RDV A;  3QBY A;  5GAN 5;  2A28 A;  5EC7 A;  3I55 T;  1CKB A;  1Q7Y R;  3CC7 A;  5KYU B;  3QWZ A;  3CC4 T;  1G3W A;  1S72 T;  3KXT A;  1N8R U;  2LJ0 A;  2QQA A;  1WQW A;  2KSS A;  2NUP B;  4OF1 A;  1IRX A;  3I5R A;  3JCM c;  3HTR A;  4L59 A;  5J26 A;  1K1Z A;  4B9W A;  1M2V B;  1D0X A;  2F2V A;  1RAF B;  4A4K A;  1YJN A;  4EIK A;  1VQ6 Q;  2J06 A;  2GQV A;  4XAX B;  4OMQ A;  2C0T A;  4C0G A;  4B6M A;  5DM7 R;  4KUD K;  3G6E T;  2EGA A;  3HHT B;  3H41 A;  4TVR A;  2ECZ A;  5LJ3 j;  3OS0 A;  1AWJ A;  3KFV A;  4LDW A;  2A37 A;  5CIU A;  4RCB A;  3VS1 A;  1JXM A;  2KT8 A;  1BI3 A;  3M57 A;  3HU3 A;  2V1R A;  5D7U A;  1IO6 A;  2YRC A;  1M27 C;  1UGV A;  2YDL A;  4NS5 A;  5GAN j;  4E7Z A;  3HRU A;  2F5T X;  4PJO B;  5KE2 A;  2P0Q A;  3HKS A;  3V7R A;  3JCM Q;  4KGZ B;  2YUO A;  4PJO F;  3QSU A;  5A0D A;  2Y4Y A;  4J9H A;  2BE7 D;  4KGX B;  2KBT A;  3V8K A;  1VQ8 A;  4EDU A;  4XTU A;  2MK5 A;  2H3E B;  4ZN1 A;  2LP5 A;  2K79 A;  1ZUU A;  2EGE A;  3CXC P;  4OP0 A;  3VUZ A;  2FPE A;  4Y28 E;  2EPD A;  2EYX A;  1E6H A;  5GJV B;  4IUP A;  3IQL A;  5LJ5 g;  3QKJ A;  2X4W A;  2JZ2 A;  1VQ7 T;  4AFU C;  4KGV B;  2DL7 A;  3M4Y A;  1SHF A;  2EQK A;  4M7D F;  1PRM C;  3P8B B;  1PM3 A;  3CCQ A;  3M0R A;  4RTW A;  3JB9 D;  3QYH B;  3TVT A;  4R0K A;  2DXU A;  1ZSZ C;  2O9V A;  2FB7 A;  3NPF A;  1YCS B;  2PZ1 A;  2VV5 A;  2AZV A;  2DX1 A;  1YIJ T;  1NE8 A;  2EQI A;  4EMK B;  5GAN 3;  2K5I A;  4PJM A;  4ELY C;  2P0P A;  1YJ9 A;  1WLF A;  1Y96 A;  1MNE A;  1YHQ A;  1N27 A;  2COW A;  3ZFJ A;  1KD1 U;  3ASK A;  1XOV A;  5LJ5 d;  5ECA A;  2W10 A;  1KSW A;  4J6W A;  3A5Z B;  1ZA1 B;  2LW6 A;  3A1P A;  2VKN A;  3CPF A;  3JRZ A;  4IUQ A;  1WZO A;  3SDZ A;  2ZPF B;  3HU2 A;  4ME7 A;  2O4X A;  2EJ9 A;  5C6S A;  1X6O A;  1VQP T;  1I07 A;  3G4S T;  1K9M C;  3MP8 A;  2RQR A;  3VS4 A;  5LJ3 f;  1M2V A;  4Z89 A;  1TOV A;  3UDC A;  3GNG A;  2EYY A;  2E70 A;  3EG9 A;  3U23 A;  5HK3 A;  2MWP A;  1W2B A;  2CZ6 B;  3X28 B;  3URG A;  2JTM A;  1NJI C;  2O9S A;  2DIG A;  2K5L A;  4CI0 C;  3CCM A;  4BAC A;  1H92 A;  4R56 A;  2WAC A;  3L2W A;  4X34 A;  5DLQ E;  1UUE A;  1PSF A;  4LD9 K;  2X3W D;  4RTT A;  2VYT A;  4OB0 B;  1SEM A;  5IHI A;  2LMJ A;  4JS5 A;  4RKU E;  2PUO B;  4J8O A;  2VGN A;  4KRT A;  2G6F X;  2E5K A;  5M9O A;  2CGH A;  2P0K A;  4IKF A;  3FPU A;  5FW9 A;  1PKS A;  2EKO A;  3L1A A;  1QDN A;  1FWZ A;  2BE9 B;  2MMP A;  4A54 A;  3M56 A;  1IRE B;  2HMA A;  5LL6 S;  4KO8 A;  5GAM j;  1OX8 A;  1MV0 B;  2LZ6 B;  3QJ6 A;  1QVF A;  2JMC A;  2Q1C X;  3CCJ A;  2AT1 B;  1ZQ1 A;  1D3B B;  5LJ5 h;  5GAM e;  2BZ8 A;  2E12 A;  3M0T A;  5HK0 A;  3AHU A;  3HPW A;  1VQO T;  4F7U A;  3WVD B;  2VGM A;  2QAS A;  2AZS A;  3C94 A;  3CC4 Q;  2IVW A;  5D6W A;  5EPP A;  4BUG A;  3JCM P;  2KI7 A;  3JCM J;  2DAQ A;  1LCK A;  1TS9 A;  2OAW A;  3CCJ T;  5GAN 4;  2CZ7 B;  2BZX A;  4O6J A;  3OYB A;  2V1Q A;  5CCB A;  3HRS A;  3FPR A;  3EFO B;  2ED0 A;  3OB9 A;  3SWN C;  1AZE A;  3EH1 A;  2OAU A;  3LGA A;  5FTN A;  1UB4 A;  2QK0 A;  5KYU A;  1U06 A;  2XDB A;  3QDR B;  1QVP A;  3M4G A;  3OYF A;  2CT4 A;  2ED1 A;  5IXF A;  1W2B P;  3ER0 A;  3S3M A;  2LX7 A;  2ZPH B;  3VJP A;  3JB9 G;  1BI1 A;  1G2B A;  1RAD B;  4M77 B;  1I8F A;  1K9M U;  4ESR A;  1QCS A;  2PQW A;  1WLP B;  1T0H A;  2QXF A;  3CMA A;  1KC8 C;  1M1G A;  1ZUK A;  2ZGW A;  1JJ2 S;  4N4G A;  1EFN A;  2CH4 A;  4M7D A;  1OU8 A;  3RKX A;  2RPN A;  5FLX E;  5IHN A;  2CP7 A;  2CUD A;  1NYG A;  1VQ7 Q;  4ARI A;  2E6Z A;  2E4H A;  1QP3 A;  1WHK A;  3BY7 A;  3I9Q A;  2GTO A;  3JCM X;  1VQL A;  8AT1 B;  1G5V A;  1UE9 A;  4JS4 A;  2XI9 A;  5CK9 A;  4OMP A;  1K4U S;  3QZ5 B;  4C5I A;  2K4Y A;  1NYF A;  2HBP A;  1D1A A;  4CC2 A;  5GAO m;  2JMA A;  3ZJU A;  3VKI A;  1M1F A;  3BE3 A;  2YVL A;  1QW1 A;  1W1F A;  1O9S A;  3M55 A;  3OW2 P;  3BFM A;  5KYY A;  3UPU A;  1T3L A;  3MP6 A;  2MI6 A;  4Q5W A;  4KBM B;  4RUG A;  2LDM A;  5GAN d;  1Q7Y C;  1JRI A;  3CQT A;  1M1K R;  2Q18 X;  2ROL A;  2DD5 A;  3CCV T;  1JJ2 P;  5L8R E;  1BCM A;  2F5K A;  5CKD A;  1X01 A;  4M78 E;  4M77 E;  4Z8A A;  2HQX A;  2MPX C;  4KUL A;  4RG8 A;  5EG2 A;  3PMT A;  1Q7Y U;  2ZAE A;  3REA B;  1Z9Q A;  2JUF A;  1HJD A;  2YLB A;  3ZGZ A;  1OV3 A;  1M3C A;  4IUR A;  4JZ3 A;  1N9R A;  4FSX A;  4OMN A;  4AMC A;  4ZTJ A;  3VV0 A;  4ANJ A;  3ULR B;  3CCL Q;  2X3X D;  2LQN A;  3CCV A;  4J9C A;  1R77 A;  1VQ8 Q;  5KE3 A;  2LCC A;  4P5N A;  5GMK h;  3VRZ A;  2KK4 A;  3GLX A;  2HSP A;  2EVR A;  3FB9 A;  2LQK A;  4KDI A;  2HKN A;  5IH2 A;  1KC8 R;  4WCI A;  1M8M A;  1SRL A;  2EIF A;  2RO0 A;  1YIJ A;  1HSQ A;  4Y91 A;  2DEU A;  1NEB A;  4C8Q B;  4C8Q F;  5CR2 A;  2A3L A;  3JCM f;  5DYG A;  2JTE A;  3EGD A;  2DLP A;  2KXD A;  5GMK e;  2HCK A;  3CD6 Q;  4MDX A;  1YCY A;  1RAB B;  4EMK C;  4M7D C;  2HQE A;  3CXC S;  2RJD A;  2FZC B;  4C92 A;  3L2U A;  5GMK i;  3KBG A;  3CME A;  1MGQ A;  4RTY A;  2EQJ A;  4J9E A;  2QEX A;  3MP1 A;  1ZSZ B;  5GAO r;  2DVE A;  2CZ0 B;  5DYI A;  3EH2 A;  4JUV A;  2RF0 A;  1Y7X A;  5KYW B;  2NUT B;  1JBM A;  2DL4 A;  2JNG A;  4QQD A;  3QXE B;  5C1B A;  3RKW A;  3CCU T;  3A8M B;  5CQY A;  5EQJ B;  2DYB A;  1C0M A;  2NYS A;  4N4H A;  1Y96 B;  3JCM V;  2PWY A;  2YLC A;  1WHM A;  4OML A;  4OGE A;  2HL5 C;  2CUB A;  1MMN A;  4IIM A;  2F2W A;  4IUU A;  1UDL A;  2P4T A;  1VQO Q;  3OSV A;  4FT2 A;  4QVC A;  1TUD A;  2ATC B;  1VQP Q;  1R0B G;  4OMF B;  5KH6 A;  2QA4 T;  4IUT A;  5FRN A;  2Q1A X;  1WPY A;  2E64 A;  2V26 A;  4PJO D;  1X69 A;  2B86 A;  4JJD A;  1UGS B;  3X20 B;  3O8V A;  1BYM A;  3CBP A;  3HL8 A;  4JLG A;  4BD3 A;  2Y4X A;  2HKQ B;  1JQQ A;  4M7A F;  1YN8 A;  3OS5 A;  2DYI A;  1VQ5 Q;  3THK A;  3DLL A;  5GAO l;  3CC2 Q;  3MO8 A;  4QW2 A;  4OVA A;  5GAN 2;  1VYT A;  4OMO A;  2PU9 B;  2K5F A;  4KH1 B;  5GAM f;  5IHK A;  3A8H B;  1QVF P;  3CCQ T;  1K73 R;  1WXT A;  4FT4 A;  2FZK B;  4HT9 A;  4CC3 A;  1E32 A;  3OYN A;  4PJO C;  2I0N A;  1D0Y A;  3I5S A;  2D0N A;  2EBP A;  1AWX A;  3CME T;  3EG1 A;  1VQO A;  5GAM g;  4C8Q C;  5LJ3 g;  1ARK A;  4C8Q A;  2DE0 X;  4AFZ C;  2JJ9 A;  3HP9 A;  4J9F A;  1G8X A;  4E7K A;  5ERG B;  3JB9 F;  1AOJ A;  5IT9 E;  2X35 A;  5FTJ A;  2L0A A;  4AQ7 A;  4M75 C;  2JS2 A;  4VUB A;  1IGQ A;  3QDF A;  1NM7 A;  1VUB A;  4J9D A;  1VA7 A;  2DA9 A;  4JRP A;  5LJ5 f;  3G71 A;  1YWO A;  1RLP C;  4GLM A;  1VIE A;  1EIF A;  2CYZ B;  2RJC A;  2RHY A;  2O01 E;  2R58 A;  1ZLM A;  2AKL A;  3JV3 A;  1VQ4 T;  5LJ3 h;  2FHD A;  1UGQ B;  2R5M A;  3M0U A;  1YNZ A;  1IB8 A;  4J83 A;  5KYN A;  3QQ8 A;  1SRM A;  2LC4 A;  4M7D B;  1AHJ B;  2DJQ A;  2O31 A;  1D3B A;  3CCQ Q;  2I2L A;  3CD6 T;  4C5E A;  2MOX A;  2RJF A;  4C92 E;  1QMC A;  2ZZD A;  5GAM h;  3ZJV A;  5CQX A;  3SEM A;  3RKY A;  3CBO A;  5FTL A;  1ZBJ A;  4Z88 A;  3R6O A;  1I1J A;  1KFZ A;  2DM1 A;  4M78 G;  2DPP B;  1WYX A;  2O88 A;  1QKW A;  2YHT A;  3DB4 A;  4KUI A;  5J3B A;  1R8O B;  2GCX A;  2EAY A;  4LN2 A;  4OB3 B;  3VS6 A;  2GFA A;  3VYH B;  4HVU A;  1QQJ A;  5CKF A;  3SWN B;  4BE0 A;  2RNA A;  5CCX A;  1WHL A;  4PFP A;  1VQN T;  2DBK A;  1N8R R;  2KQW A;  2RQW A;  2Y90 A;  4YTL A;  1O75 A;  1GL5 A;  3CCS Q;  1XNI A;  3TCJ A;  5GAM d;  1YFN A;  4M77 G;  2LRQ A;  5AYF A;  1HXD A;  1FX7 A;  2QI2 A;  2EGC A;  2J6K A;  1FYN A;  1FMK A;  2OI3 A;  4FSS A;  1H64 1;  1JU5 C;  1GRI A;  2CH4 W;  2PNI A;  1VQN A;  4HVW A;  4O5V A;  1DJ7 B;  3M0S A;  2BKD N;  2X4J A;  5FU7 B;  4FW1 A;  3G1J A;  3M0P A;  5GJW B;  2ZPG B;  1ZX6 A;  3CCL T;  2K3Y A;  4DOW A;  4M75 A;  3PIP A;  2QGF B;  4J9B A;  5FRO A;  3MCA B;  2DD4 A;  3QWY A;  3JSC A;  2DO3 A;  2X4X A;  2GGR A;  2LJ1 A;  3QPH A;  2RQV A;  4QQ6 A;  1RAI B;  1YI2 T;  4C5H A;  2O2O A;  2JTF A;  3LYI A;  1V29 B;  2CSQ A;  2JN0 A;  3FJ5 A;  3EFS A;  2CP3 A;  4JDS A;  1TU0 B;  3BW1 A;  4JZ4 A;  3RMQ A;  3OYK A;  1KK7 A;  3CPW P;  2LVM A;  1PKT A;  2H3J A;  1K8A C;  2B8A A;  2HDA A;  3PE0 A;  1VQ5 T;  4LDU A;  3JCM h;  2CDT A;  4QT7 A;  2RI5 A;  3PNW C;  1KQS S;  3SWN A;  3LX7 A;  5DY9 A;  4DBQ A;  1JEG A;  3UT1 A;  1HK9 A;  5GAN 6;  4PJO G;  4FIB A;  1QCF A;  1I9G A;  1LVK A;  2RHZ A;  1NZ9 A;  4J7F A;  3CD6 A;  1RI0 A;  1SHG A;  3L2R A;  1JJ2 A;  1X43 A;  1ABQ A;  2DTO A;  4KH0 B;  5HCK A;  5A2Q E;  1N5Z A;  4M4Z A;  1Y07 A;  3CME Q;  3PFS A;  2KE9 A;  3OMG A;  2EYW A;  2NUZ A;  2BTT A;  5A0G A;  4V2S A;  1AWW A;  2DZ9 A;  2V8J A;  4M75 F;  4HCC A;  3C4S A;  1M3A A;  4RTX A;  5FU7 C;  3EG0 A;  3RIR A;  1U1T A;  1MND A;  4E7H A;  2FEI A;  1ZC1 A;  3UA7 A;  1RLQ C;  3G71 Q;  1M90 R;  4M7A C;  4EPC A;  2NWM A;  1M1K C;  1V76 A;  1QWE A;  4M78 C;  2ROT A;  1MUZ A;  4ZGE B;  1QVF S;  1TXQ A;  2D0Q B;  3QC8 A;  1IGU A;  1VQP A;  3OYI A;  3I55 Q;  1YIT A;  4RCC A;  2MF2 A;  2D6F A;  2D1X A;  3LH5 A;  2EFI A;  3VS5 A;  2FRW A;  2HAX A;  4ATO A;  4CRI A;  4A4H A;  2RHX A;  2GF7 A;  5D6Y A;  2JOY A;  1PD1 A;  3JCM g;  4RTZ A;  1AZG B;  3J7A F;  2K9G A;  2IIM A;  5J39 A;  2ZPE B;  4A4F A;  1KIK A;  1B34 B;  3NTH A;  3JCM e;  3OYY A;  2D9T A;  2QG9 B;  1GFD A;  2HD0 A;  1RUW A;  2F2X A;  3TQ7 P;  3H8Z A;  1YI2 A;  2QAZ A;  4C92 G;  3MET A;  3PMI A;  2HNI A;  2KAF A;  3OYE A;  3NMZ C;  4Y92 A;  1KHC A;  1PHT A;  1W2B S;  2YUP A;  4K11 A;  3OYD A;  4MZM A;  2M0Y A;  2CRE A;  2JM9 A;  4OGC A;  2OTL A;  1RAC B;  1AVZ C;  4LDY A;  2JVV A;  4ZTF A;  1VQ9 T;  3P8H A;  5GAN f;  1OX9 A;  1SPK A;  2CP6 A;  2QYZ A;  1XTD A;  1TSF A;  1WHG A;  5I2M A;  2E3I A;  3GP8 A;  3QYG B;  4N4I A;  3EAE A;  3VU3 C;  3OYJ A;  2LNV A;  4L6V 5;  1GBQ A;  5GAN 7;  2A08 A;  4LDX A;  1GCQ C;  2DTI A;  2XKO C;  1S72 A;  4CC7 A;  1I5L A;  5CKE A;  9ATC B;  5GMK m;  2RN8 A;  3WXM B;  1UG1 A;  3D7S B;  3OYC A;  1K73 U;  3I56 A;  3LH0 A;  2BIV A;  4J6X A;  3C95 A;  2OTJ Q;  2P84 A;  3DLM A;  1OOT A;  3QII A;  2E3H A;  4HVV A;  3A8O B;  2OTL Q;  1LPL A;  1BK2 A;  4M75 E;  1U3O A;  2K57 A;  1YIT Q;  2CZ1 B;  2FG0 A;  4HCK A;  4J5Y A;  1B34 A;  2QTV A;  1WQ7 A;  1E6G A;  1P92 A;  1NLP C;  1EZZ B;  2M02 A;  2M16 A;  4DEX A;  3GOX A;  1VQM Q;  3JB9 H;  2JS0 A;  4M7A G;  3JB9 J;  4A4E A;  2KEA A;  3PT9 A;  2KGT A;  5A0L A;  3G6E Q;  2FPD A;  2DJZ A;  4AFS C;  4GLK A;  1VQ5 A;  2KRS A;  3TSW A;  3O5Z A;  4M7A B;  1BB9 A;  4LE9 A;  2YRV A;  4J9I A;  1PD0 A;  1JXO A;  3AT1 B;  1D1B A;  3VRY A;  2PTK A;  4C8Q G;  2DXC A;  3E9F A;  3GBQ A;  4F16 A;  2DKG A;  4R55 A;  3EGD B;  2R5A A;  3OY9 A;  1BIA A;  3JB9 I;  1LNX A;  5CCA A;  3DB3 A;  4X1V A;  4OMM A;  2HL3 A;  2RH2 A;  4ARC A;  3X24 B;  5CKB A;  4JJB A;  2OTJ T;  3UWN A;  3OA6 A;  5IXB A;  1OU9 A;  4E7I A;  2X9H A;  3QHS A;  3HU1 A;  3V7C A;  2E65 A;  3G4S Q;  1NPP A;  4C0D C;  1OZ3 A;  4XU0 A;  4F7U G;  1WFW A;  1ZA2 B;  2A36 A;  2LT4 A;  2CKK A;  2K7A A;  2YRD A;  2DIQ A;  2LQW A;  1Q95 G;  1D09 B;  3NTI A;  4EMG A;  3S3N A;  1A0N B;  1YHQ T;  4XTX A;  2BUD A;  3M9Q A;  4J9G A;  4PJO E;  3A8G B;  3LLR A;  2YUJ A;  4JPB W;  2PVD B;  4M77 C;  3CF2 A;  5I2S A;  4M77 A;  3HFO A;  4BI8 B;  3CXC A;  1HD3 A;  2GFU A;  4HXJ A;  5CD1 A;  1YIJ Q;  1VQ9 Q;  1Y57 A;  2DXB A;  2B25 A;  1I81 A;  2RHU A;  3OYM A;  3LWH A;  1TUC A;  3UAT A;  4XTV A;  1K9M R;  1BCO A;  2COY A;  3CMA Q;  1Q81 R;  1Q82 R;  3FEO A;  2X51 A;  1KD1 R;  5LJ5 j;  1EX4 A;  2RMO A;  2PUK B;  5IN1 A;  3J81 E;  4C0D B;  1MMD A;  1UJ0 A;  2JM8 A;  2R57 A;  5FWB A;  4D8K A;  6AT1 B;  4MML A;  1X75 C;  3TIW A;  4RTU A;  3QWX X;  1OYX A;  3V8J A;  1TUG B;  5CAI A;  3TSZ A;  4M75 G;  2RK2 A;  2QEX Q;  4BE2 A;  3CCR Q;  3L2Q A;  3CCU Q;  1YJN T;  1I4K 1;  2M9U A;  3L2V A;  1ABO A;  2EJF A;  2A7Y A;  2L3Q A;  1K73 C;  5FU6 B;  5FRM A;  8ATC B;  1AT1 B;  1QCN A;  4KDL A;  4XU1 A;  2LT1 A;  3OW2 S;  1WA7 A;  2LCS A;  3QQ7 A;  3FJP A;  2ZPB B;  1GBR A;  1AD5 A;  4MMK A;  3X26 B;  1SF9 A;  4PK4 A;  2XG8 D;  5HY6 A;  3DKM A;  4FU6 A;  2V8K A;  4NOY A;  2CP0 A;  2QGG A;  1IHV A;  3OSS C;  1YWP A;  2KRN A;  2C0O A;  3CCJ Q;  2YT6 A;  4C92 D;  3NTK A;  1QVG P;  1PG5 B;  1QVG A;  2HSE B;  1H8K A;  1MMG A;  1U1S A;  2E1H A;  3LHD A;  1UEB A;  1VQM T;  3M5A A;  1GCP A;  2OX7 A;  2JT4 A;  2KRO A;  4HCZ A;  1SSF A;  3E1S A;  4ORZ A;  3MKD A;  5CKH A;  4JRK A;  2J6O A;  2RJE A;  2XMF A;  3GNF B;  3KUF A;  2KRM A;  4HA8 A;  4WF2 A;  1SG5 A;  1FXX A;  2BZY A;  2XDD A;  1B3Q A;  4D8D A;  2EYQ A;  3ZJT A;  1NEG A;  1R0C B;  1S3S A;  3PVL A;  1MV3 A;  3RMS A;  1BI0 A;  3CPW A;  2VAS A;  2RI3 A;  4RMO A;  4ZGD B;  3MEA A;  4WTO B;  1ZSG A;  1E7O A;  2QDL A;  2E10 A;  3CCS A;  2DVJ A;  1QCO A;  1YHQ Q;  3JCM W;  3EGX A;  3GIB A;  2LTO A;  2GQI A;  1GCQ A;  1K8A U;  1YJW Q;  3BQB A;  5I21 A;  4NL3 A;  1SSH A;  3OBW A;  3H9N A;  4HCB A;  2K2M A;  1Q86 C;  1CZ4 A;  4M7D E;  3LW5 E;  2Q1D X;  3OS1 A;  1RI9 A;  1VYV A;  3S6W A;  3M53 A;  1M4Z A;  5CVI A;  1HYO A;  1CR5 A;  1PWT A;  2PJH B;  1M30 A;  1M2O A;  2AHJ B;  2FL7 A;  3M58 A;  3WVE B;  1O54 A;  2RK1 A;  4DEY A;  4HKE A;  1TH7 A;  3MB5 A;  2ZPI B;  3X25 B;  1K0X A;  4X9D A;  1MHN A;  3CCM Q;  3MEV A;  1YP5 A;  4LDV A;  1CSK A;  4RG2 A;  3VS3 A;  2P4R A;  3I35 A;  4C8Q D;  2KNB B;  5GAN h;  4QVZ A;  2YWW A;  2AK5 A;  5I22 A;  1J3T A;  3EFR A;  2DIL A;  1K8A R;  4F04 B;  1M1K U;  4II1 A;  4BY6 C;  3CCE T;  3CCR T;  3REB B;  3HFN A;  3M59 A;  3VS7 A;  5KCO A;  3EGX B;  1M5Q 1;  2OTL T;  1U5S A;  2K3B A;  1V1C A;  2KMT A;  2RI2 A;  3L42 A;  3M54 A;  2C0I A;  3CC2 T;  4MZP A;  4BI4 A;  1WXU A;  2DER A;  1QKX A;  2L5Q A;  3E2U A;  2J6F A;  2OTJ A;  1FMW A;  2XK0 A;  1ZSZ A;  4PLL A;  2G3R A;  3QO3 A;  1S1N A;  2KXC A;  5FWC A;  2VC8 A;  5C18 A;  2QQ9 A;  4JRI A;  1UJY A;  1UGP B;  3CCR A;  1W4S A;  3A8L B;  1KQ1 A;  4BB7 A;  3SD4 A;  5GAO n;  5FTK A;  2WSF E;  3RBB B;  1VQ6 A;  4E2F B;  2AIR B;  4C92 F;  3INZ A;  4F7U E;  3RNJ A;  3JAM E;  1YJ9 Q;  3SB2 A;  1X2Q A;  3OW2 A;  3CCM T;  4UC4 A;  1NBE B;  3ZL7 C;  4N0A C;  1M3B A;  3CCV Q;  1H3Z A;  4PLI A;  4XQ3 A;  4N0A A;  1OI1 A;  5GAN e;  3CCE Q;  1YIT T;  2W0Z A;  3C0C A;  3PIO A;  2VB6 A;  4J7I A;  4M7A D;  1XJW B;  1RAE B;  5GMK j;  3CPW S;  1LJO A;  3N5B B;  5FTM A;  2VXF A;  2L2P A;  4LXC A;  3T9N A;  4DA4 A;  1MMA A;  3HSB A;  3VUB A;  4BI3 A;  1OEB A;  2XIC A;  1VQM A;  1KQS A;  4M78 F;  4A53 A;  4LUD A;  3QG1 A;  1KQ2 A;  4J6Y A;  4EMK A;  4LNP A;  2RA2 A;  1X27 A;  1WJQ A;  4M7A E;  2EQU A;  4ELZ C;  1YJW A;  4JJN K;  4C92 B;  1R7R A;  1WNL A;  4IIO A;  4PFO A;  1CZ5 A;  3H0I A;  3OYG A;  2DTH A;  5FU6 C;  4PFZ A;  2GTJ A;  4NL2 A;  2DF6 A;  2K3X A;  4AT1 B;  4QKU A;  1OPL A;  2RM4 A;  2O4X B;  3PTA A;  1D0Z A;  2FYK A;  2DL3 A;  2KVQ G;  1VOM A;  4PJL A;  3P8D A;  3MEU A;  4MZT A;  1VQ8 T;  4ZNX A;  3ZBD A;  1VQK Q;  1IHW A;  2PVG B;  2FO0 A;  4DQ2 A;  1PCX A;  1Q82 U;  2YXY A;  1PSE A;  2XD0 A;  1VQK T;  2A0F B;  2COZ A;  2DL5 A;  5CO7 A;  1N8R C;  4RV0 A;  4IUV A;  2DRM A;  1WJS A;  3GF5 A;  2DXT A;  2QA4 A;  4C5G A;  4EMH A;  1C6V X;  1C1A A;  1Y0M A;  4A4G A;  2QQB A;  2QQR A;  1G83 A;  2EKH A;  2XDP A;  2CP5 A;  4F14 A;  1RAH B;  2KY9 A;  4A63 B;  4MDW A;  4JLI A;  2NLU A;  2YUQ A;  3FC3 A;  1W6X A;  1G3T A;  1YJW T;  2FZG B;  1QP2 A;  1XQH A;  2KYB A;  1X6G A;  4JJC A;  4X9C A;  1AWO A;  1W70 A;  1VQL T;  4AFQ C;  2WSE E;  3OQ5 A;  3CC2 A;  3I56 Q;  3FLG A;  3QJY A;  1TG0 A;  4XTZ A;  3FPT A;  4FYW B;  3CC7 Q;  5I11 A;  4M7A A;  1Y71 A;  4GBQ A;  3UF4 A;  4DBR A;  3G71 T;  1BBZ A;  1LOJ A;  3NHN A;  1QLY A;  4M78 A;  4PJO A;  2CT3 A;  4OB1 B;  1WDX A;  3BDL A;  2V8I A;  4F17 A;  3VYG A;  3OYA A;  2DL8 A;  1H3H A;  2QA4 Q;  1ZHI A;  1B7T A;  4FYV B;  3CCL A;  4FW2 A;  4L5G A;  2IPO B;  4E7L A;  2L8D A;  1YI2 Q;  4D6W A;  3BDU A;  4PJJ A;  1VQ9 A;  5B6C A;  3MJX A;  1NLO C;  3NGP A;  2K2V A;  2E6N A;  4FCY A;  4C92 C;  2LX9 A;  3L2Z A;  4PL6 A;  1K9A A;  2RQT A;  2OJ2 A;  2H8H A;  2NUP A;  1BU1 A;  2HEQ A;  3CCS T;  2KDS A;  1VQK A;  4XTY A;  2M1H A;  2VWF A;  2QEX T;  1WHH A;  2K6D A;  1IXD A;  4M78 D;  1VYU A;  4KOD A;  4CQN A;  2DK3 A;  3QZ9 B;  3PGG A;  2QTX A;  1VQ7 A;  1Q82 C;  1CKA A;  2LNH B;  4FM4 B;  4BDZ A;  3I56 T;  4BDY A;  3V7S A;  1VQL Q;  4E6R A;  4QQG A;  4KT0 E;  4Z02 A;  4CC4 B;  5LJ3 d;  3JCM b;  2VXE A;  3G7Z A;  3MEW A;  3R6N A;  1WGS A;  2RD1 A;  3CMA T;  2VVK A;  2DRK A;  1ACM B;  3C12 A;  2D8J A;  1KD1 C;  3FRN A;  1NJI U;  3EG3 A;  1Q81 C;  1AEY A;  4FYX B;  2CP2 A;  3EFO A;  3LGF A;  4BY6 B;  1UFF A;  4M77 D;  5KCH A;  2XHC A;  3LGL A;  2FRY A;  1T3S A;  2E5Q A;  5KYX A;  3RER A;  4C8Q E;  2C06 A;  3EHR A;  2CS7 A;  2L3P A;  1VQ6 T;  2MM2 A;  1OZ2 A;  1X2K A;  4M75 B;  4C0Z A;  1NJI R;  4E7J A;  3LWI A;  1UHF A;  4XK8 E;  5LJ5 e;  2HZY A;  2HBW A;  2MWO A;  3EHQ A;  1VQ4 A;  1BI2 A;  2Z0W A;  4LD6 A;  4PNO A;  5KYX B;  3E19 A;  1KQS P;  2L3S A;  3EGU A;  4FYY B;  3MHX A;  3I55 A;  2DEQ A;  1K76 A;  1JB0 E;  2EWN A;  2ENM A;  1UGR B;  3RES A;  4PKC C;  3GPL A;  4PJN A;  2M51 A;  1OQK A;  2JXB A;  2DET A;  1PC0 A;  1WX6 A;  2MCN A;  3TEE A;  2RQU A;  2DNU A;  1YJN Q;  2IG0 A;  1PRL C;  1RL2 A;  4M78 B;  5KYY B;  2GNC A;  1D1C A;  1Q86 U;  5KYW A;  2FPF A;  2DBM A;  3CEY A;  1QWF A;  1VQN Q;  4HT8 A;  1KG1 A;  3OYH A;  3EG2 A;  1F1B B;  4DBF A;  1IZ6 A;  2MIO A;  4C0F A;  1WJR A;  2YSQ A;  5HKC A;  5AT1 B;  2DZC A;  1SKU B;  4M7D G;  4E7S A;  1NG2 A;  1G3Y A;  4DBH A;  4RTV A;  2EJG A;  5GAO q;  1I5O B;  2GBQ A;  3S3O A;  3RUX A;  2XID A;  3OS2 A;  5GAN g;  1N9S A;  2WSC E;  3M0Q A;  2FVU A;  2KR3 A;  1UHC A;  1UEC A;  4JRQ A;  1NPR A;  1RAA B;  3OBY A;  4FL6 A;  2KT1 A;  1Q81 U;  1OPK A;  1U8R A;  3EG9 B;  3VS0 A;  1WXB A;  1N6A A;  4AG2 C;  4B9X A;  3ME9 A;  3H6Z A;  5GAN 8;  4M75 D;  4LUE A;  4GY5 A;  3OMC A;  3J80 E;  3H0H A;  3V8L A;  2EQM A;  2EW3 A;  1VQ4 Q;  2YUN A;  1KC8 U;  1JO8 A;  1Q86 R;  1YJ9 T;  3OYL A;  1YBY A;  3E9G A;  4ZN3 A;  1FMV A;  4XTW A;  1B07 A;  1BKB A; 
#chains in the Genus database with same CATH homology
 4XU3 A;  5DLO A;  3JCM X;  1JJ2 A;  1ZBX A;  2LQ8 A;  3MEV A;  2DTO A;  1VQL A;  1G5V A;  3JCM d;  4LDV A;  4JS4 A;  2MM0 A;  2XI9 A;  1BIB A;  5A2Q E;  4RG2 A;  5CK9 A;  2QDY B;  4C8Q D;  3ZEH A;  3QZ5 B;  2ZCF B;  4C5I A;  1Y07 A;  4E47 A;  2K4Y A;  2HBP A;  3PFS A;  4QVZ A;  5IAY A;  3OMG A;  5GAN h;  3NFC A;  5GAO m;  3CCU A;  2F69 A;  1KHI A;  2X4Y A;  3ZJU A;  3VKI A;  5A0G A;  1M1F A;  5LJ3 e;  4V2S A;  2Q19 X;  2DZ9 A;  2V8J A;  3CCE A;  3EFR A;  2YVL A;  1QW1 A;  4M75 F;  4OB2 B;  3C4S A;  4HCC A;  1M1K U;  2L89 A;  4II1 A;  4BY6 C;  1O9S A;  3M55 A;  1QVG S;  3CCE T;  3BFM A;  3CCR T;  3CBM A;  3CC7 T;  5FU7 C;  3UPU A;  2PVO B;  1G3S A;  3HFN A;  3M59 A;  3RIR A;  3CC4 A;  2M0O A;  5KCO A;  1M5Q 1;  1U1T A;  3MP6 A;  4E7H A;  3TU4 K;  2OTL T;  2MI6 A;  2KMT A;  4QVD A;  2RI2 A;  3L42 A;  4Q5W A;  5C0M A;  3FDR A;  1M90 C;  3M54 A;  4M7D D;  3CC2 T;  1ZC1 A;  2E41 A;  4KBM B;  2XU8 A;  4M7A C;  3HRT A;  2LDM A;  4MZP A;  4BI4 A;  4EPC A;  5GAN d;  3Q1J A;  1JRI A;  2L5Q A;  4F7U F;  1Q7Y C;  1M1K C;  2Q18 X;  4AS1 A;  2DD5 A;  2OTJ A;  3CCV T;  5L8R E;  4KLN A;  2F5K A;  1GXI E;  5CKD A;  4M78 C;  1X01 A;  4M78 E;  4M77 E;  4BE1 A;  4ZGE B;  2XK0 A;  1QVF S;  2D0Q B;  2HQX A;  3FIF A;  3QC8 A;  5GMK l;  1M90 U;  4KUL A;  4PLL A;  2G3R A;  1VQP A;  4ZGJ B;  4RG8 A;  3QO3 A;  3OYI A;  2VUB A;  5EG2 A;  3PMT A;  3QUI A;  2MF2 A;  4RCC A;  1YIT A;  1Q7Y U;  2D6F A;  2VC8 A;  4F7U B;  5C18 A;  2QQ9 A;  2EFI A;  1VIF A;  4JRI A;  2MAM A;  2HAX A;  4ATO A;  4CRI A;  3G4S A;  1UGP B;  4A4H A;  3CCR A;  2RHX A;  2GF7 A;  1W4S A;  5D6Y A;  3A8L B;  2JUF A;  2JOY A;  3G6E A;  1KQ1 A;  2YLB A;  3JCM g;  4BB7 A;  3ZGZ A;  3SD4 A;  3F70 A;  4XU2 A;  5GAO n;  5FTK A;  3SFM A;  4IUR A;  2WSF E;  1N9R A;  4FSX A;  1VQ6 A;  3J7A F;  3TRE A;  3VV0 A;  4ZTJ A;  4C92 F;  2RHI A;  3INZ A;  1M8V A;  4F7U E;  3JAM E;  5J39 A;  3CCV A;  2ZPE B;  4A4F A;  3SB2 A;  1M9S A;  2JV2 A;  1B34 B;  3NTH A;  3JCM e;  3OYY A;  5KE3 A;  5GAO p;  2D9T A;  4UC4 A;  3CCM T;  3OW2 A;  2LCC A;  2HD0 A;  4P5N A;  5GMK h;  2LCL A;  4N0A C;  2KK4 A;  2RB6 A;  4M77 F;  2QQS A;  3H8Z A;  5D6X A;  4PLI A;  4XQ3 A;  3GLX A;  4N0A A;  4C92 G;  1YI2 A;  1OI1 A;  5GAN e;  1H3Z A;  2L3R A;  3MET A;  3FB9 A;  3PMI A;  2HNI A;  5GLF A;  2LQK A;  1YIT T;  4KDI A;  2KAF A;  3OYE A;  4DOV A;  3PIO A;  1KHC A;  4J7I A;  1W2B S;  4M7A D;  3QBY A;  5GAN 5;  3OYD A;  2EIF A;  2RO0 A;  3I55 T;  1YIJ A;  5GMK j;  4Y91 A;  3CPW S;  4MZM A;  4C8Q B;  1LJO A;  4OGC A;  4C8Q F;  3CC7 A;  2OTL A;  3N5B B;  2A3L A;  2VXF A;  3JCM f;  5CR2 A;  3CC4 T;  3QWZ A;  1G3W A;  5FTM A;  1S72 T;  3T9N A;  5DYG A;  4LDY A;  2JVV A;  3KXT A;  4DA4 A;  3HSB A;  4ZTF A;  3VUB A;  4BI3 A;  1VQ9 T;  3P8H A;  5GAN f;  1N8R U;  2QQA A;  5GMK e;  2XIC A;  1VQM A;  1KQS A;  4M78 F;  4A53 A;  4MDX A;  1XTD A;  1WQW A;  2KSS A;  1YCY A;  3QG1 A;  4EMK C;  4M7D C;  2HQE A;  4OF1 A;  1KQ2 A;  5I2M A;  4J6Y A;  4EMK A;  3GP8 A;  3QYG B;  4N4I A;  3CXC S;  2RJD A;  3EAE A;  3JCM c;  2RA2 A;  3VU3 C;  5J26 A;  1WJQ A;  4L59 A;  4C92 A;  3KBG A;  5GMK i;  3OYJ A;  2EQU A;  4ELZ C;  4B9W A;  3L2U A;  3CME A;  1YJW A;  1MGQ A;  2LNV A;  4L6V 5;  4JJN K;  4C92 B;  4A4K A;  1R7R A;  1WNL A;  2EQJ A;  2QEX A;  5GAN 7;  1YJN A;  4LDX A;  3MP1 A;  1CZ5 A;  5GAO r;  2DVE A;  2CZ0 B;  5DYI A;  2GQV A;  4XAX B;  3OYG A;  2DTH A;  4C0G A;  4JUV A;  5FU6 C;  2DTI A;  2XKO C;  1Y7X A;  5DM7 R;  4NL2 A;  4KUD K;  1S72 A;  3G6E T;  2K3X A;  1JBM A;  3HHT B;  1I5L A;  5CKE A;  5GMK m;  2JNG A;  3WXM B;  4QQD A;  4TVR A;  3QXE B;  2RM4 A;  3OS0 A;  5LJ3 j;  2O4X B;  3PTA A;  2FYK A;  3OYC A;  5C1B A;  1K73 U;  2KVQ G;  4LDW A;  3RKW A;  3I56 A;  3CCU T;  3A8M B;  5CQY A;  3LH0 A;  2BIV A;  3P8D A;  4J6X A;  5EQJ B;  3C95 A;  3DLM A;  3MEU A;  5CIU A;  4RCB A;  4MZT A;  3QII A;  1VQ8 T;  4N4H A;  1Y96 B;  3JCM V;  3ZBD A;  2PWY A;  2YLC A;  2PVG B;  4DQ2 A;  1BI3 A;  3M57 A;  3HU3 A;  4OGE A;  1Q82 U;  3A8O B;  1PSE A;  2XD0 A;  4M75 E;  2K57 A;  1VQK T;  4IUU A;  2CZ1 B;  2P4T A;  5CO7 A;  3OSV A;  4FT2 A;  4QVC A;  1N8R C;  4RV0 A;  4IUV A;  4NS5 A;  5GAN j;  4PJO B;  3HRU A;  2F5T X;  4J5Y A;  5KE2 A;  1WJS A;  1B34 A;  3GF5 A;  2DXT A;  4OMF B;  5KH6 A;  2P0Q A;  2QA4 T;  3HKS A;  2QA4 A;  1WQ7 A;  4IUT A;  1P92 A;  4C5G A;  3V7R A;  4EMH A;  1WPY A;  2M16 A;  3JCM Q;  5FRN A;  2Q1A X;  2E64 A;  3GOX A;  4PJO D;  4A4G A;  2QQB A;  2QQR A;  3JB9 H;  4M7A G;  3JB9 J;  4A4E A;  1UGS B;  3PT9 A;  3X20 B;  4PJO F;  3O8V A;  5A0L A;  3QSU A;  5A0D A;  2Y4Y A;  2DJZ A;  1BYM A;  2XDP A;  2KY9 A;  3CBP A;  3HL8 A;  4JLG A;  4MDW A;  4GLK A;  4BD3 A;  2Y4X A;  2NLU A;  4JLI A;  1VQ5 A;  4M7A B;  3V8K A;  3FC3 A;  4M7A F;  1VQ8 A;  4EDU A;  4XTU A;  1G3T A;  3OS5 A;  1YJW T;  2YRV A;  5CD1 A;  4ZN1 A;  1QP2 A;  3DLL A;  4C8Q G;  2DXC A;  4OP0 A;  1XQH A;  3E9F A;  3VUZ A;  5GAO l;  2DKG A;  3MO8 A;  4QW2 A;  4R55 A;  4Y28 E;  2R5A A;  4X9C A;  3OY9 A;  1BIA A;  4IUP A;  3JB9 I;  4OVA A;  5LJ5 g;  1VQL T;  5GAN 2;  2WSE E;  3QKJ A;  1LNX A;  2X4W A;  2JZ2 A;  3DB3 A;  3OQ5 A;  2PU9 B;  5CCA A;  1VQ7 T;  3CC2 A;  3FLG A;  3QJY A;  4XTZ A;  3FPT A;  2RH2 A;  2K5F A;  5GAM f;  3A8H B;  3M4Y A;  3CCQ T;  4ARC A;  3X24 B;  5CKB A;  4M7A A;  2EQK A;  1Y71 A;  4FT4 A;  3P8B B;  3UWN A;  3OA6 A;  4M7D F;  3CCQ A;  2OTJ T;  4E7I A;  3QHS A;  3G71 T;  4HT9 A;  1LOJ A;  3JB9 D;  3OYN A;  3QYH B;  1E32 A;  3HU1 A;  4PJO C;  3V7C A;  2E65 A;  4M78 A;  1NPP A;  4PJO A;  2DXU A;  4C0D C;  1OZ3 A;  4XU0 A;  4F7U G;  3BDL A;  4OB1 B;  2FB7 A;  2V8I A;  3VYG A;  3OYA A;  2VV5 A;  3CME T;  2LT4 A;  2CKK A;  1VQO A;  5GAM g;  1YIJ T;  4C8Q C;  5LJ3 g;  1NE8 A;  4EMK B;  5GAN 3;  1ZHI A;  2K5I A;  4ELY C;  2DIQ A;  4C8Q A;  2P0P A;  3HP9 A;  4EMG A;  3NTI A;  3S3N A;  3CCL A;  1YJ9 A;  4E7K A;  1WLF A;  1Y96 A;  5IT9 E;  3JB9 F;  5ERG B;  4L5G A;  2X35 A;  1YHQ T;  5FTJ A;  4XTX A;  2BUD A;  1YHQ A;  1N27 A;  1KD1 U;  3ZFJ A;  3M9Q A;  4E7L A;  3ASK A;  1XOV A;  4AQ7 A;  2L8D A;  4M75 C;  4VUB A;  5LJ5 d;  4PJO E;  1VUB A;  3A8G B;  4D6W A;  3LLR A;  2YUJ A;  2PVD B;  4M77 C;  3BDU A;  4J6W A;  4JRP A;  3A5Z B;  1VQ9 A;  5I2S A;  5LJ5 f;  2LW6 A;  3CF2 A;  4M77 A;  3HFO A;  5B6C A;  4BI8 B;  3CPF A;  3CXC A;  3G71 A;  2GFU A;  3JRZ A;  4IUQ A;  2ZPF B;  3SDZ A;  1VIE A;  1EIF A;  2CYZ B;  2K2V A;  2RJC A;  2E6N A;  4ME7 A;  2Q1D X;  3HU2 A;  4C92 C;  2LX9 A;  2RHY A;  2O4X A;  2O01 E;  2EJ9 A;  2R58 A;  3L2Z A;  4PL6 A;  5C6S A;  2DXB A;  1VQ4 T;  5LJ3 h;  1X6O A;  2FHD A;  2B25 A;  1UGQ B;  1I81 A;  2RHU A;  3OYM A;  1VQP T;  2R5M A;  3LWH A;  3G4S T;  1K9M C;  4XTV A;  3MP8 A;  3CCS T;  4J83 A;  2KDS A;  1VQK A;  3QQ8 A;  4XTY A;  2M1H A;  5LJ3 f;  2LC4 A;  2QEX T;  4M7D B;  4M78 D;  1AHJ B;  4KOD A;  4CQN A;  2DK3 A;  3FEO A;  3QZ9 B;  3PGG A;  3UDC A;  1D3B A;  2QTX A;  5LJ5 j;  2PUK B;  3GNG A;  5IN1 A;  1VQ7 A;  1Q82 C;  2I2L A;  3J81 E;  3CD6 T;  4C0D B;  2E70 A;  4C5E A;  4FM4 B;  5HK3 A;  4BDZ A;  2MWP A;  2R57 A;  3I56 T;  2CZ6 B;  1W2B A;  4BDY A;  2RJF A;  3V7S A;  3X28 B;  3URG A;  4C92 E;  2JTM A;  1NJI C;  4QQG A;  4KT0 E;  2DIG A;  2K5L A;  2ZZD A;  4Z02 A;  5GAM h;  4MML A;  5LJ3 d;  3JCM b;  1X75 C;  4CI0 C;  3CCM A;  3TIW A;  4BAC A;  2VXE A;  5CQX A;  3ZJV A;  3G7Z A;  1OYX A;  3RKY A;  3MEW A;  3CBO A;  3V8J A;  5CAI A;  4R56 A;  5FTL A;  2WAC A;  1WGS A;  4M75 G;  2RK2 A;  3L2W A;  2RD1 A;  4X34 A;  4BE2 A;  3CMA T;  5DLQ E;  3R6O A;  3L2Q A;  4M78 G;  3C12 A;  2DPP B;  1KD1 C;  1YJN T;  1PSF A;  3FRN A;  1NJI U;  1I4K 1;  4LD9 K;  1Q81 C;  2M9U A;  2VYT A;  3L2V A;  4OB0 B;  2YHT A;  4JS5 A;  3DB4 A;  3LGF A;  4KUI A;  2PUO B;  4M77 D;  4RKU E;  4BY6 B;  2EJF A;  2A7Y A;  4J8O A;  5KCH A;  1K73 C;  2XHC A;  5FU6 B;  5FRM A;  2VGN A;  3LGL A;  2E5Q A;  3RER A;  1R8O B;  2GCX A;  5J3B A;  2EAY A;  4C8Q E;  4OB3 B;  2C06 A;  4KDL A;  4XU1 A;  5M9O A;  2CS7 A;  2LT1 A;  1VQ6 T;  2MM2 A;  2GFA A;  3OW2 S;  2CGH A;  1OZ2 A;  2P0K A;  3QQ7 A;  3VYH B;  4M75 B;  4C0Z A;  3FJP A;  2ZPB B;  4IKF A;  5CKF A;  3FPU A;  3SWN B;  4E7J A;  4MMK A;  4BE0 A;  3X26 B;  3LWI A;  4XK8 E;  5CCX A;  5LJ5 e;  2EKO A;  1VQN T;  3L1A A;  1QDN A;  1FWZ A;  2MWO A;  1VQ4 A;  2XG8 D;  1BI2 A;  2MMP A;  4LD6 A;  3DKM A;  4FU6 A;  5HY6 A;  4A54 A;  2KQW A;  2V8K A;  4NOY A;  4PNO A;  3E19 A;  2Y90 A;  3OSS C;  4YTL A;  1O75 A;  3M56 A;  1IRE B;  1XNI A;  5LL6 S;  4KO8 A;  3MHX A;  3TCJ A;  5GAM j;  3I55 A;  5GAM d;  2DEQ A;  3NTK A;  4C92 D;  1QVG A;  3QJ6 A;  1QVF A;  1JB0 E;  4M77 G;  2EWN A;  2LRQ A;  5AYF A;  3RES A;  1UGR B;  2Q1C X;  1U1S A;  4PKC C;  3GPL A;  2E1H A;  3CCJ A;  3LHD A;  1HXD A;  1FX7 A;  1UEB A;  2QI2 A;  1ZQ1 A;  1D3B B;  5LJ5 h;  5GAM e;  2E12 A;  1VQM T;  5HK0 A;  1H64 1;  3TEE A;  3AHU A;  3M5A A;  2IG0 A;  4HCZ A;  1SSF A;  3HPW A;  1VQO T;  4F7U A;  3E1S A;  1RL2 A;  4M78 B;  1VQN A;  3WVD B;  5CKH A;  1Q86 U;  2VGM A;  4JRK A;  4O5V A;  1DJ7 B;  2RJE A;  3C94 A;  2BKD N;  2IVW A;  2X4J A;  5FU7 B;  3CEY A;  3GNF B;  3KUF A;  4HT8 A;  5D6W A;  1KG1 A;  5EPP A;  4HA8 A;  4WF2 A;  2ZPG B;  4BUG A;  1FXX A;  2XDD A;  2K3Y A;  3OYH A;  3CCL T;  3JCM P;  4DOW A;  4M75 A;  3JCM J;  2EYQ A;  3PIP A;  2DAQ A;  3ZJT A;  1S3S A;  1IZ6 A;  4C0F A;  5FRO A;  3CCJ T;  5GAN 4;  3MCA B;  1WJR A;  2CZ7 B;  1BI0 A;  2DD4 A;  3RMS A;  3JSC A;  3CPW A;  4O6J A;  5HKC A;  2DO3 A;  2X4X A;  3OYB A;  2RI3 A;  4RMO A;  3QPH A;  3HRS A;  2DZC A;  4QQ6 A;  4ZGD B;  3MEA A;  3FPR A;  5CCB A;  4M7D G;  1YI2 T;  3OB9 A;  3SWN C;  1G3Y A;  4C5H A;  5GAO q;  2E10 A;  2EJG A;  3CCS A;  2JTF A;  2OAU A;  3LGA A;  5FTN A;  1I9G A;  3LYI A;  3S3O A;  1UB4 A;  3RUX A;  2XID A;  3JCM W;  1V29 B;  2JN0 A;  3GIB A;  2LTO A;  3EFS A;  2XDB A;  3QDR B;  4JDS A;  1QVP A;  1K8A U;  3BW1 A;  3OS2 A;  3M4G A;  3OYF A;  5GAN g;  3BQB A;  1N9S A;  2WSC E;  2FVU A;  3RMQ A;  3ER0 A;  5I21 A;  4NL3 A;  3S3M A;  3MB5 A;  3OYK A;  4JRQ A;  2ZPH B;  3VJP A;  3OBW A;  1NPR A;  3OBY A;  4FL6 A;  3JB9 G;  1Q81 U;  4HCB A;  1BI1 A;  2LVM A;  4M77 B;  1I8F A;  1U8R A;  2H3J A;  1K8A C;  1N6A A;  1K9M U;  1Q86 C;  2B8A A;  1CZ4 A;  4M7D E;  3LW5 E;  4B9X A;  4LDU A;  3JCM h;  3ME9 A;  3H6Z A;  5GAN 8;  3OS1 A;  1VQ5 T;  2PQW A;  1QCS A;  2QXF A;  4M75 D;  3CMA A;  1KC8 C;  1M1G A;  2RI5 A;  3PNW C;  2ZGW A;  3S6W A;  1JJ2 S;  4N4G A;  1KQS S;  3M53 A;  1M4Z A;  4GY5 A;  4M7D A;  3RKX A;  5FLX E;  4X9D A;  5CVI A;  1CR5 A;  3SWN A;  2PJH B;  3LX7 A;  5DY9 A;  2FL7 A;  2AHJ B;  3OMC A;  3J80 E;  3M58 A;  4ARI A;  3WVE B;  4M7A E;  3UT1 A;  3V8L A;  1O54 A;  1HK9 A;  2E6Z A;  2EQM A;  5GAN 6;  2RK1 A;  4HKE A;  4PJO G;  1KC8 U;  1QP3 A;  1TH7 A;  4FIB A;  3OYL A;  1YJ9 T;  1YBY A;  2RHZ A;  2ZPI B;  1NZ9 A;  3BY7 A;  3E9G A;  4J7F A;  4XTW A;  1RI0 A;  3X25 B;  4ZN3 A;  3CD6 A;  1BKB A;  3L2R A;  1MHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...