5D6XA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
b'QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6xA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6xA02
2R5AA 2BUDA 5CIUA 5KCHA 2XK0A 4QQGA 3F70A 3QBYA 4LD6A 1WJSA 3DB4A 3LX7A 4UC4A 3UT1A 5FROA 2L3RA 4CRIA 1MHNA 1OZ3A 2EQMA 4FU6A 2X4YA 1OI1A 4EDUA 4Z02A 1G5VA 2RI5A 5IN1A 2M0OA 3OYAA 4B9XA 3L2WA 4IUVA 2EKOA 3NTIA 4PLIA 2LDMA 4BE1A 4BACA 4B9WA 5D6XA 2RJCA 3L2RA 2DIGA 3GOXA 5IAYA 1KHCA 3H6ZA 4BDYA 4E7LA 3OA6A 3C4SA 3NTHA 4NS5A 3OYJA 3S3NA 2RJFA 2LCCA 3OYEA 3L42A 1N27A 2LVMA 2M16A 5KCOA 4II1A 3OYIA 4C5HA 2JTFA 4ZTFA 3FDRA 3OYCA 3MEAA 4PL6A 3M9QA 2QQSA 2XDPA 3OMGA 3QJ6A 2BKDN 3OS1A 3PMTA 2K3XA 4E7JA 1RI0A 3MEWA 4A4HA 3OYDA 3L2VA 4PLLA 3S6WA 4RG2A 3OYFA 1WJRA 4N4HA 3FLGA 3L2UA 3LYIA 1H3ZA 2RHZA 3MO8A 3QKJA 4N4GA 3OYNA 3ASKA 4IUQA 2GFUA 2RJEA 2FHDA 2RHXA 3CEYA 5J26A 3KUFA 3OB9A 3S3MA 3S3OA 3MP1A 3EAEA 3MP8A 4QQ6A 5D6WA 4A4EA 4BD3A 2HQXA 4E7KA 2E5QA 4BE0A 3L2QA 4OVAA 5KH6A 2RHYA 2BIVA 4HCZA 4C5IA 4IUUA 4IKFA 2P0KA 4A4FA 4IUTA 2RI3A 4C5EA 2MWPA 2DAQA 4E7IA 2D9TA 4E7HA 3H8ZA 3DB3A 4A4GA 3MEUA 2G3RA 4IUPA 3PMIA 1WJQA 5J39A 5KE3A 2DIQA 3NTKA 2IG0A 3LGFA 2F5KA 5D6YA 3OS0A 2MWOA 3PNWC 2PQWA 1OYXA 2X4WA 2O4XB 2YRVA 2X35A 3FEOA 3OYBA 4N4IA 2VYTA 2R58A 2RJDA 1OZ2A 3OY9A 4BDZA 3OMCA 2X4XA 3OYMA 4ZTJA 3ME9A 3QIIA 2LRQA 3OYGA 3PFSA 3LLRA 4GY5A 4QVZA 4C5GA 5KE2A 3O8VA 3OYHA 2L8DA 4QW2A 1SSFA 2L89A 2O4XA 4BE2A 3DLMA 2RO0A 3LH0A 5FRNA 1WGSA 2EQUA 2M1HA 2E6NA 4IURA 3P8DA 3SD4A 2CKKA 5M9OA 4L59A 3E9FA 3LGLA 4QQDA 1XNIA 2R5MA 2WACA 3OQ5A 4FL6A 4Q5WA 2EQKA 2LTOA 3UWNA 3META 2B8AA 3OYLA 3BDLA 2K3YA 2R57A 2NLUA 2RHUA 3MP6A 2EQJA 4X34A 5C6SA 3ZEHA 2JZ2A 3Q1JA 3OYKA 3FC3A 3OS2A 2HQEA 2RHIA 2RI2A 3P8HA 5C0MA 3E9GA 5FRMA 3MEVA 2GF7A 2EFIA 2QQRA 2GFAA
chains in the Genus database with same CATH superfamily
5CIUA 2FYKA 5FROA 4ATOA 3JCMg 1OI1A 5GANj 1GBRA 2A0FB 3CD6A 1NLPC 3CCJQ 2XMFA 4JZ3A 2EKOA 2PU9B 3NTIA 1JJ2S 3C0CA 1SRMA 3EGUA 5D6XA 3UA7A 1KHCA 2A7YA 2EQIA 4DEYA 3OA6A 1BCOA 4LDXA 3OYJA 5IHNA 1TWBA 7AT1B 4II1A 5HK3A 1QP2A 1RAAB 1JJ2A 3PMTA 4F14A 1PRLC 2BE7D 2LQKA 1RI0A 3MEWA 1Y96B 3OYDA 3CPWS 2COZA 2VV5A 3FLGA 4M75E 2Z0WA 2B25A 4JUVA 2JJ9A 4O6JA 5I2MA 3J81E 2CP0A 2RH2A 1Y96A 2E5QA 1BYMA 3CCVQ 2D9TA 3OBYA 5CVIA 4RV0A 2MMPA 3EG2A 2CH4A 3CCEA 1RL2A 1VA7A 3N5BB 3AHUA 2R58A 4E2FB 1I5LA 4FYWB 2J6FA 3OYMA 4J6XA 3TQ7P 2NUZA 4FCYA 4BY6C 1VQ7A 3PIOA 1O75A 1KK7A 1NEBA 2JS2A 2L5QA 4XU0A 3G6EA 2HKNA 2RO0A 2LQWA 4M77A 3QDFA 3R6OA 1JQQA 4Q5WA 3UWNA 2Y4XA 4EMKC 1KHIA 1RAHB 2K3YA 5LL6S 5C6SA 2JZ2A 1MMAA 3CMAQ 1K8AC 3G4ST 2KDSA 4A63B 1EIFA 4M78C 2O2OA 3PIPA 4D8DA 4V2SA 1C6VX 3QBYA 4UC4A 3UT1A 2L3RA 1MHNA 1ZX6A 2I2LA 4FU6A 2X4YA 5LJ5j 2CT4A 4HA8A 2RQWA 1KQSP 4C8QD 4XTWA 3CC7T 3RUXA 4BACA 3X24B 5CQXA 2QEXQ 1PSFA 1VQ8A 1I5OB 2FRYA 5GJWB 4PNOA 2E3IA 1AWOA 5LJ3g 2QQAA 1KC8U 3OS5A 4C92G 4J7IA 4JRPA 2DXUA 5C1BA 2RQRA 2X4JA 5GMKe 6AT1B 2EJ9A 2E12A 2RHZA 2VXEA 3JCMd 2X3WD 1Y07A 1WHJA 4DBRA 5CKBA 3HU3A 3CBMA 3OYYA 3OB9A 1UGRB 3ULRB 3MP8A 1I8FA 4EPCA 5FTMA 2ROTA 2LX7A 4J9HA 2FZCB 3LGAA 1EZZB 2QAZA 1OU8A 2DYBA 3V8LA 3CXCS 1R0BG 3NTKA 3HL8A 4WF2A 1NPRA 4LDUA 3CCRQ 2KNBB 3HPWA 5GAMg 2DERA 2CP5A 3MKDA 2EGCA 5GAOq 3GP8A 4ZTJA 3BFMA 2K4YA 3CCQQ 1R77A 1MMGA 3CXCA 1AHJB 4OMLA 3EG0A 4AFUC 3CCUQ 4L59A 2KQWA 4PJOF 3L2ZA 2R5MA 4FL6A 5GAOr 1VQNT 4J9GA 1WLFA 3KXTA 1EX4A 3VJPA 3MB5A 3SWNB 1VIFA 1XOVA 3Q1JA 3RR6A 2A36A 2RN8A 1YJWQ 1RUWA 2EFIA 5HKCA 1Q95G 5C18A 4AS1A 4R56A 1N8RC 4ELYC 5IHIA 2MIOA 3FPRA 3CMET 1OZ3A 1TOVA 2CP3A 4FSSA 4M7DB 3JCMh 1T3SA 2CGHA 4O5VA 3O5ZA 1N5ZA 1QVPA 2OTLA 1NEGA 3EG9A 4M75D 1VQLA 1JB0E 4M7DA 1M4ZA 3H0FA 2FPDA 2EGEA 3V7CA 2CZ1B 3FDRA 4PFZA 4KUDK 1K73R 2LZ6B 4JS5A 4XU2A 1K9MR 1ZSZC 2NUPA 4OB2B 1YWPA 5CKDA 4N4GA 4M78A 4GBQA 1Q86U 1UE9A 1Q82R 4RCBA 2EAYA 2LNHB 2YLCA 3E1SA 4JLIA 2DAQA 4E7IA 5LJ3d 3OW2P 4IUPA 2DX1A 3MCAB 2EYZA 3C95A 1W2BS 1T0HA 4A4KA 2G6FX 3A5ZB 4F7UE 3G1JA 1AZGB 4JZ4A 4ESRA 4C92D 1K9AA 1LNXA 1D09B 2D1XA 4MZMA 2DNUA 3EFOA 1GXIE 3QXEB 1W2BA 3LH0A 4GLMA 5IXBA 5DM7R 3CCJT 5GMKi 2VXFA 1XNIA 5CKHA 3KFVA 3CD6T 4E7ZA 4Z89A 3X26B 4X34A 2XKOC 2OTJA 4Y91A 4PKCC 3H9NA 2OTJQ 2GF7A 1IHWA 1VQPQ 5GAMd 1ZBXA 1WHMA 2BZXA 1RAIB 2A28A 1YHQQ 4PJOE 3C12A 5ECAA 3OYAA 3L2WA 3TU4K 4BE1A 3JCMf 1K4US 2RNAA 2PWYA 2DM1A 2KYBA 2DETA 2LW6A 2CZ7B 4J9BA 4FYYB 2JV2A 2DL3A 3OYIA 4IIOA 2QXFA 2ECZA 1M90R 3QSUA 1AZEA 1WNLA 1OULA 2AK5A 3JV3A 5CK9A 4C8QF 5DY9A 4EIKA 3GNGA 4PJMA 2MK5A 3L2VA 4J7FA 1Q7YU 1ARKA 4J9DA 3LYIA 3JCMb 1WIEA 3I56Q 3ASKA 1SPKA 3G4SA 1QQJA 1W70A 4FW2A 4VUBA 2CUDA 3RMSA 5GAN2 2NUTB 4OVAA 1TH7A 1WHKA 4IUUA 4A4FA 1D3BA 2DEUA 3KBGA 4FT2A 1VQ4Q 2NYSA 1VOMA 1JXMA 4KRTA 3JB9I 2DPPB 3BE3A 2KXCA 4BI3A 2K5FA 5KYNA 5GAOp 2RA2A 2NUTA 3CC7A 4NL2A 3CMAT 1S3SA 5FU6B 2VYTA 4IIMA 4PJNA 2O9SA 4A54A 3JCMV 3UF4A 2LCLA 3PT9A 3FJPA 4HVVA 4DA4A 1IGUA 4RG8A 1I9GA 2DXCA 2YRDA 4KULA 1IO6A 3E9FA 3A98A 3BW1A 4HCKA 2QEXT 3QYHB 1Q82C 2R57A 2EQJA 3ZEHA 5EC7A 4F17A 1QVGP 2HQEA 2ZAEA 2K3BA 3I55Q 2MCNA 3RNJA 4R55A 2L0AA 3VKIA 1M3BA 3DB4A 2EW3A 1M8VA 2PVDB 1UDLA 2K5LA 3LW5E 3ZL7C 1JEGA 1G5VA 5FTNA 5IN1A 1ZA1B 2M0OA 3G71Q 1H92A 3VYHB 1UECA 1JU5C 4MDXA 4C0GA 5LJ3j 1YCSB 2DJQA 4OMOA 4J9EA 2AT1B 3A8GB 4FYXB 2KVQG 1OX9A 3A1PA 1G3SA 4C0ZA 2HSEB 4DOWA 3CCSQ 1VQNA 3QO3A 2OX7A 1WJRA 2YRCA 3RIRA 3OYNA 2JW4A 3CCQT 2PVOB 4M75F 3CEYA 5GANh 4C0DB 3MP1A 3NMZC 4C0FA 4HXJA 3PVQA 2XICA 3CCUT 3CMEA 1M2VB 3M55A 3H8ZA 4DOVA 1KQ1A 5AYFA 2IG0A 5GAMj 4ME7A 3LGFA 4M7AE 3FRNA 2PUOB 5GAOl 2KR3A 3CQTA 4HT8A 4M77C 3HTRA 2X4WA 1M2VA 4RTUA 1YJWT 1QCSA 2HQHA 2HD0A 2X4XA 2DF6A 1OPLA 4KT0E 3SDZA 1M90C 1R7RA 3SFMA 1HXDA 2L8DA 3HRUA 1MMNA 2AZSA 2ED1A 1NZ9A 1WGSA 1IZ6A 1C1AA 4LD9K 5CQYA 4PJOD 4LUDA 3ER0A 3CBOA 4C8QB 4FYVB 2LJ3A 1WQWA 1FMVA 3QJYA 2RHIA 2RI2A 3E9GA 2OTLT 4C8QG 1TUGB 2DEQA 4AG2C 1IXDA 3CCLQ 1CSKA 1Q81U 1M9SA 4KH1B 1PRMC 1ZA2B 5CKFA 4HVUA 1T0JA 4LNPA 4JJDA 4ARCA 1X43A 4LDVA 4IUVA 4CI0C 2RJCA 1N9SA 3H6ZA 4AQ7A 4E7LA 1VQ6Q 4ZGDB 1DJ7B 4KGZB 2LCCA 1N27A 3VS4A 2JTFA 3OYCA 2QYZA 3CCJA 3OS1A 1UTIA 3EG3A 4FW1A 3VS6A 1BIAA 2FHDA 3RKWA 1YI2Q 2Y90A 4HT9A 2FZGB 3JCMc 5LJ5h 1X27A 2KE9A 2H3JA 2LJ1A 2V26A 5GANf 2DVEA 1LPLA 5KH6A 2OJ2A 4IKFA 2QDYB 1PHTA 2AIRB 3QQ8A 3DB3A 4A4GA 2G3RA 2XI9A 1X6OA 5GLFA 1MNDA 2QTVA 2DIQA 1N6AA 2E70A 2SEMA 1PSEA 1UJ0A 3PNWC 3M57A 3HSBA 2YRVA 1LJOA 2OTJT 2HSPA 3CCVA 1VQPT 5KYWB 3M59A 3I9QA 1ZBJA 4QVZA 2CP7A 2WSCE 5I2SA 3OYHA 3EGDB 2IVWA 4JJBA 3P8DA 3QZ9B 5KYWA 5M9OA 1YP5A 4DEXA 4M77E 1N8RR 2CDTA 4XU3A 1OPKA 1VUBA 3PTAA 2K2VA 4MMKA 2ZPIB 2JM8A 3EGDA 2M9UA 1CKAA 3NPFA 1WLPB 3ZGZA 5GMKj 2MOXA 1I07A 5FWCA 1ZUYA 3R6NA 4M75B 2BTTA 2IPOB 4D8KA 2CS7A 2P0PA 2NWMA 4ANJA 4M7DC 4CRIA 4XTXA 4M75G 3LHDA 2EPDA 4MZTA 3I56T 1X75C 3CMAA 4B9WA 4OB3B 4BDYA 2D8JA 2DFUA 2MAMA 1G3YA 2LQ8A 2V8JA 1VQ4T 3TVTA 4ARIA 2QQ9A 4XAXB 2EIFA 1PWTA 2VC8A 3PE0A 3LWIA 1RAFB 2QEXA 3EH2A 3GLXA 3QPHA 4KODA 2DA9A 1H3ZA 1TXQA 1NE8A 1GFCA 2RJEA 4QVCA 4M7AD 1R8OB 4BUGA 5CCXA 4BD3A 4JDSA 2Q19X 1D1CA 5LJ5f 1I0CA 5DLQE 4C92B 2ABLA 2XG8D 2F5TX 2YVLA 1M2OA 1RLQC 2B86A 2P4RA 3M5AA 2HCKA 5EQJB 1H8KA 1U3OA 1KFZA 1WJQA 4FM4B 1QLYA 4B6MA 4C92A 2YUPA 1YCYA 3SHWA 5GMKl 4MMLA 1QCOA 1OYXA 2J05A 3I55T 5CR2A 1QKXA 4F7UF 1KG1A 1MUZA 3M58A 4XTVA 1ZC1A 1GCQA 1MGQA 4DBQA 2VGMA 1KQSS 3VS3A 4E47A 2F2VA 5DLOA 1BK2A 2DE0X 3H0HA 3M53A 3G71T 2ZPHB 2WACA 3OQ5A 3CCRA 3RERA 4R0KA 1E32A 2CREA 1KQSA 3MP6A 2KGTA 4DBFA 3QWZA 3CCQA 4FIBA 1E7OA 2E5KA 2YDLA 2GCXA 4X9CA 2J6OA 3CCUA 4LD6A 4FSXA 1QKWA 4XU1A 3CCST 1M1KU 4AFZC 4DBHA 2DD5A 3FB9A 4LXCA 1Q86R 4HVWA 2DL5A 2J7IA 3AT1B 1YJWA 3HHTB 2VASA 5IAYA 2QDLA 1E6GA 2WSEE 2C06A 4M7DE 1VQKQ 1MNEA 2VB6A 2O9VA 4HCBA 4MDWA 1FX7A 1KD1U 3SWNA 3FIFA 4PFPA 4ZNXA 1KC8C 1YN8A 3CC2Q 2V8KA 2V1RA 1ZQ1A 4M78E 4OMFB 2E41A 2E10A 4OB0B 3MHXA 3S3MA 1NYGA 5D6WA 2CP2A 2H8HA 2E3HA 1KJWA 4RTYA 2CUBA 2P0KA 1NBEB 2XD0A 3VS5A 3PMIA 4XTUA 5FU6C 1SRLA 2MI6A 3FPTA 2FO0A 1VQ5Q 1UHCA 4M77D 1R0CB 2E1HA 2KRMA 3OMCA 5HCKA 2XDDA 3CCLT 3ME9A 1YJNQ 3LLRA 5J3BA 4J8OA 2CSQA 2C0TA 2L89A 3JSCA 1CKBA 1IGQA 5I11A 2JNGA 5FRNA 1K76A 2DTOA 2DMOA 2RQUA 3EH1A 3HFNA 1M1GA 1VQ6T 3OS2A 3M4YA 4OF1A 1BI1A 2K9GA 2F2WA 1FYNA 4A53A 2L3QA 2X3XD 1AWWA 3J80E 3QUIA 1BI3A 2HBWA 3ZJTA 3LWHA 2D8HA 3CPFA 2PNIA 4QKUA 1Z9QA 2LDMA 1YI2T 2HL5C 5GAOm 1VQ9Q 3I5RA 5IXFA 4DQ2A 3JCMP 3RDVA 4E7SA 3OW2S 1VQPA 2F69A 3C4SA 2MPXC 1IHVA 1BCMA 2O88A 4F7UB 1YHQA 4RTVA 1VYVA 4KLNA 2XDPA 4F7UG 4PFOA 2EWNA 2DZ9A 3OW2A 5KYXB 4F7UA 1K73U 2DLPA 3L2UA 3GIBA 2KT8A 1ZUUA 1K9MU 1O9SA 2J06A 1QCFA 3CCVT 4JJCA 4KDIA 4ZN1A 2LT1A 4CC3A 4C5IA 2RI3A 1Q82U 1Q86C 5LJ3h 4E6RA 2MYSA 2KEAA 1ABOA 3REAB 1OX8A 2KK4A 4AT1B 2AHJB 2QQBA 3EHRA 1M27C 2K7AA 1YIJA 2Y4YA 3I56A 1SF9A 3M0RA 4P5NA 1IREB 4M7AF 2BE9B 3IQLA 4N4IA 1YIJQ 4PJOB 3V7SA 3OY9A 4BB7A 2C0IA 2QGFB 4C5GA 1VQ4A 3JCMQ 4PJOG 1E6HA 1TS9A 4RKUE 1SSHA 4X1VA 2YLBA 4JRKA 4PJOA 1U5SA 2OAUA 3DKMA 2DXBA 1WXUA 2DXTA 5A0GA 2EQKA 1D1AA 2KY9A 4C8QC 1QVFP 2B8AA 2E6ZA 4LDWA 2M0YA 2EGAA 1X69A 1YITQ 3QG1A 1O54A 1VYTA 4L6V5 2V1QA 1HYOA 5GAMh 2JM9A 2R5AA 2A3LA 3X28B 2XK0A 1AT1B 4PK4A 4M7DD 3D7SB 2EQMA 2YUNA 4EDUA 2PJHB 2AKLA 5ERGB 1VQOA 3MJXA 2ZPBB 2M02A 2F1LA 4JLGA 1VQOQ 3I55A 1Y7XA 2GNCA 3FPUA 4J9CA 4LUEA 1AEYA 4M78D 1NJIU 2FEIA 5KCOA 4XTYA 2QA4Q 3G71A 2PTKA 3VRZA 4A4HA 4PLLA 5CO7A 3SEMA 3CCMQ 1UEBA 1CZ4A 1U1TA 4CC4B 1I81A 4LN2A 4QQ6A 3EAEA 1Q7YC 1HK9A 2RF0A 4RCCA 1X2KA 1QVGS 3CCSA 5LJ3f 1N9RA 4QT7A 4EMGA 5A0LA 2KRNA 2GTJA 5D6YA 3CCRT 1M8MA 2HDAA 2HAXA 1WFWA 2X51A 2RJDA 1OZ2A 2RQTA 1QVGA 1PNJA 1Q81R 2EYWA 2L3SA 3THKA 2DJZA 3JB9H 4QW2A 3VYGA 3BY7A 3VS7A 4OMMA 1W4SA 3VV0A 5FU7B 2Q1AX 2CP6A 4M77F 5IHKA 1FMWA 1WXTA 5HY6A 2RHUA 2JTEA 3HP9A 1K0XA 2KAFA 4M75C 1VIEA 1XQHA 1P92A 3CC4Q 1YJ9Q 1RI9A 2O31A 2ZGWA 4XQ3A 5GAMf 2HMAA 3NGPA 4RMOA 3TREA 5CD1A 1WXBA 2W10A 5GMKm 3RMQA 1GL5A 1KIKA 5I22A 3QDRB 1S72Q 3CCLA 1QCNA 4ZGEB 3S3NA 1S1NA 2A08A 4M7AB 3QQ7A 2RJFA 4CC2A 4C5HA 2FRWA 2DO3A 4GLKA 2KXDA 4ZTFA 1AVZC 4M7AG 4C8QA 2DL4A 5FTJA 3QWYA 2KI7A 5GMKh 2EJFA 1MMDA 2D0QB 1VQ5T 2JMCA 2RB6A 3A8LB 1YBYA 1AD5A 2XU8A 2KMTA 1Y0MA 2LNVA 1VQ6A 1YJNT 4C92C 2JTMA 2XIDA 3M4GA 4RTTA 4A4EA 1VYUA 1OEBA 2DTHA 2JXBA 1SKUB 2RD1A 1GCQC 2ENMA 1QW1A 3MEUA 3UDCA 3A8MB 2LP5A 2LT4A 1YI2A 3X25B 1QP3A 3ZJUA 2ZPFB 1RAEB 2H3EB 1NG2A 1XTDA 2LRQA 4GY5A 3CPWP 3WVDB 1MV0B 1RABB 1QDNA 5CCBA 1SSFA 2YUQA 1WHGA 2EVRA 2Q1CX 1TUDA 2M1HA 5GAN4 2RMOA 2BZ8A 2CKKA 1WHHA 1X01A 1K8AU 1H641 1VQ9T 1D1BA 1PKTA 3H0IA 3CD6Q 2AKKA 1JXOA 2DVJA 4KDLA 3EFRA 2EYYA 2P84A 5KYUB 4J6WA 5C0MA 2KYMA 2JT4A 2V8IA 1RAGB 2IIMA 1ABQA 2DL7A 4PL6A 3F70A 1YHQT 2OAWA 4F16A 5KYUA 4N0AC 4Z02A 1GCPA 1SEMA 2RPNA 5IH2A 2DL8A 3SWNC 3G7ZA 1Q81C 3A8HB 2FG0A 1Z9ZA 3TCJA 1F1BB 2CT3A 4WTOB 1KC8R 1UJYA 3ZBDA 4NS5A 3CPWA 2FPEA 4M7DF 2ZZDA 3EGXB 2ZCFB 2QTXA 3QJ6A 4OMNA 2P4TA 3M0PA 4OB1B 1UGPB 1G3TA 2FB7A 1WHLA 3JB9D 1V76A 1KQ2A 2JUFA 1D0ZA 1YIJT 4N4HA 3QHSA 4M75A 3EGXA 2KBTA 3CCEQ 2GFUA 3NHNA 3JCMW 4M77B 4M78F 5GANe 1BI2A 4ZGJB 1M1FA 4M77G 2D0NA 1B3QA 1M30A 4ORZA 1VQ7Q 1IRXA 3M0SA 1M3AA 3GNFB 4E7HA 1HSQA 3QWXX 1UGVA 3G6EQ 1SHGA 2AZVA 3HU2A 3REBB 3WVEB 2E65A 4C92E 2VGNA 2I0NA 1YITT 1BBZA 3V8KA 3LH5A 3JCMJ 2K2MA 2ROLA 2O4XB 1PG5B 1X6GA 4BDZA 1C0MA 2EJGA 9ATCB 5GAOn 2XDBA 1TUCA 5EPPA 1TG0A 2YWWA 2PVGB 4FT4A 1M1KR 3CF2A 1SHFA 2RQVA 2O4XA 1B34B 2BZYA 3I5SA 3URGA 2F2XA 2D6FA 1ZUKA 5EG2A 3SB2A 1XJWB 4XTZA 1SG5A 1D0YA 1VQOT 5B6CA 3NFCA 2GBQA 5A0DA 2SRCA 2LCSA 3RKXA 1N8RU 1B34A 2LJ0A 1MV3A 1V1CA 1WQ7A 1WI7A 5FRMA 1VQ8Q 2QA4T 2DRKA 1KD1R 3CXCP 4PJLA 2LX9A 4J9FA 4ELZC 4RTXA 5D7UA 2DYIA 1J3TA 1ZLMA 2EYXA 2COWA 1RLPC 3CCMT 3HU1A 2ED0A 2JMAA 3JRZA 3L2RA 1A0NB 4NOYA 2VWFA 4AFSC 2JS0A 1WYXA 2YSQA 2LVMA 4OMPA 2JVVA 1HJDA 8AT1B 2YXYA 1G3WA 3MEAA 3ZFJA 2QQSA 2YUOA 1M3CA 1PKSA 3JAME 2ZPGB 3UATA 1NPPA 3OYFA 3OSVA 1BI0A 2A37A 3EG1A 2LMJA 5J26A 1QMCA 1VQKA 5LJ5e 4LDYA 3VS0A 2Q1DX 2DKGA 1G8XA 3EHQA 5GAN7 4N0AA 3MPUB 2HNIA 2MM2A 4AFQC 1ACMB 4MZPA 3CC2A 3UPUA 3EFSA 4PJOC 2FPFA 5HK0A 3M0TA 4JRQA 4L5GA 3RESA 3CC4T 2EYQA 1YJ9T 1UUEA 1UFFA 1FWZA 2FL7A 2RM4A 1KSWA 1U06A 5CAIA 3C94A 4QVDA 1RADB 5KE2A 1PCXA 3JCMX 1HD3A 3HRSA 3V8JA 3H41A 4BY6B 3V7RA 4HKEA 1JBMA 1T3LA 1GFDA 3EG9B 2VKNA 2KT1A 1VQ5A 4RUGA 4J83A 4EMHA 3OYLA 3ZJVA 4M7DG 1S72T 1YJNA 4CQNA 3FC3A 3OYKA 4EMKB 5A2QE 4TVRA 4OGEA 3JB9J 3BDLA 1ZSGA 2GQIA 4J9IA 5KCHA 2OTLQ 4QQGA 1W2BP 2NUPB 2DBKA 1VQLQ 1VQMA 3L1AA 3LX7A 4M78B 4EMKA 4M4ZA 1PM3A 1VQMQ 4M78G 1UGQB 3RBBB 1WPYA 1QWFA 1U1SA 5CKEA 1H3HA 5DYGA 5GANg 1AWJA 1CZ5A 1M1KC 1WX6A 1UGSB 5GAN3 2C0OA 3HFOA 3NTHA 3E2UA 5DYIA 3FJ5A 3OMGA 1Q7YR 5FW9A 5CCAA 1VQ9A 1YFNA 3EFOB 3HRTA 1LVKA 2VUBA 1KD1C 1JO8A 3INZA 4IUQA 3VU3C 2RHXA 1UHFA 1FXXA 3M54A 4BE0A 3DLLA 2BIVA 4HCZA 1G83A 3PVLA 4C5EA 2ZPEB 2VVKA 2OI3A 3M56A 3QYGB 2GGRA 4K11A 1BKBA 3JB9F 1BU1A 5J39A 2Q18X 1JRIA 2F5KA 2PQWA 1X6BA 3FEOA 4C0DC 4CC7A 3TIWA 3P8BB 1RACB 5L8RE 5GAN5 3QIIA 1IB8A 5KYXA 1FMKA 5FU7C 1U8RA 4RTZA 1NM7A 2DILA 3DLMA 4XK8E 2HEQA 3SD4A 1ZHIA 1QWEA 2DTIA 3BDUA 2YT6A 4BI4A 4BI8B 1NJIR 1D0XA 2M51A 4JS4A 2GFAA 2BUDA 1B7TA 1WDXA 2LQNA 1W6XA 1WJSA 2DZCA 2CH4W 2JN0A 2O01E 4JJNK 2RK1A 3U23A 3CCET 1BIBA 4PLIA 1YITA 4PJJA 2HKQB 1D3BB 2PUKB 5LJ5g 2DK3A 1WZOA 4M7AC 3GOXA 2KROA 3PGGA 3X20B 1NYFA 3G4SQ 1VQ7T 1G2BA 2E64A 1Y71A 4KBMB 1UB4A 3G6ET 3M9QA 5I21A 2MM0A 2K3XA 3VUZA 4E7JA 1UG1A 2RK2A 3S6WA 2KRSA 3JCMe 2LC4A 3T9NA 1OU9A 1GRIA 3MO8A 3CC7Q 4KUIA 1ZSZB 3TSWA 3KUFA 4F04B 2DBMA 2QA4A 2HQXA 2K79A 3HKSA 5GANd 1QVFS 1K73C 2RHYA 1GBQA 2HZYA 2MWPA 1K9MC 1PC0A 2FVUA 5FLXE 1ZSZA 2GTOA 3CCMA 5KE3A 3CBPA 1M90U 4HCCA 1QVFA 2COYA 4AMCA 1W1FA 1VQ8T 2KSSA 2XHCA 1PD0A 4OMQA 4AG1C 4J6YA 3OYGA 1OQKA 2E4HA 3PFSA 1TU0B 2CZ6B 1K1ZA 4BE2A 2EQUA 2J6KA 1YWOA 2E6NA 4IURA 2L2PA 3BQBA 3LGLA 4QQDA 1YNZA 2CSIA 2WSFE 3GPLA 2NLUA 2QASA 3QZ5B 5AT1B 4YTLA 3P8HA 3OBWA 3GBQA 4Z88A 3MEVA 3I35A 4D6WA 2QG9B 1OV3A 2ATCB 1Y57A 4RTWA 2QK0A 5IT9E 3UA6A 4ZN3A 4JRIA 2EKHA 2RI5A 1OOTA 2P0QA 4B9XA 1CR5A 3GF5A 4KH0B 1PD1A 1YJ9A 3CC4A 3J7AF 1VQNQ 2HL3A 2DIGA 5FTKA 5GAN6 1BB9A 3JB9G 1VQKT 8ATCB 2JOYA 3RKYA 4Z8AA 3OYEA 3L42A 2M16A 2MF2A 5GAN8 3VS2A 2BKDN 4C8QE 1LOJA 4Y28E 3CMEQ 1TTHB 3CC2T 2HBPA 2QI2A 1X2QA 1NJIC 1LCKA 1V29B 4RG2A 2CYZB 4KGVB 4LE9A 1S72A 3OSSC 3QKJA 3WXMB 3M0QA 2EBPA 3S3OA 2ESWA 3A8OB 4E7KA 1NLOC 5LJ5d 2K5IA 3L2QA 4Y92A 1TSFA 2QGGA 4OGCA 3VUBA 1K8AR 4IUTA 1B07A 1I4K1 3M0UA 5LJ3e 3VRYA 3TSZA 2X9HA 2DD4A 5FTLA 2DRMA 4M7AA 2K57A 3TEEA 4OP0A 4C92F 2MWOA 3OS0A 3OYBA 2X35A 3VS1A 4KGXB 2L3PA 1I1JA 1AWXA 1VQLT 4J5YA 1EFNA 5GJVB 3O8VA 4WCIA 1K0SA 2K6DA 4KO8A 1JJ2P 5KYYB 1VQMT 2GQVA 2W0ZA 1AOJA 2FZKB 5FWBA 4JPBW 5L23A 2LTOA 4X9DA 3META 2PZ1A 3QC8A 5KYYA 2YHTA 4NL3A 1WA7A 2CZ0B 1M5Q1 2YUJA 3E19A 5GAMe 2QQRA
chains in the Genus database with same CATH topology
5CIUA 4R55A 3VKIA 2LX9A 4ELZC 3DB4A 2FYKA 3J80E 5FROA 3QUIA 1BI3A 3ZJTA 1M8VA 2PVDB 2K5LA 3LWHA 3LW5E 4ATOA 3JCMg 1OI1A 5GANj 1G5VA 5FTNA 5IN1A 3CCMT 2M0OA 3CD6A 3CPFA 2EKOA 2PU9B 3NTIA 3HU1A 1JJ2S 3VYHB 2LDMA 1YI2T 5GAOm 3JRZA 4MDXA 4C0GA 4DQ2A 5D6XA 5LJ3j 3JCMP 3L2RA 4NOYA 3OW2S 1KHCA 2A7YA 1VQPA 2F69A 3OA6A 3C4SA 4LDXA 3OYJA 2LVMA 3A8GB 2JVVA 4F7UB 4II1A 5HK3A 1YHQA 1QP2A 2KVQG 1JJ2A 1G3WA 3MEAA 1G3SA 3ZFJA 2QQSA 2XDPA 4KLNA 3PMTA 4F7UG 2ZPGB 4C0ZA 3JAME 4DOWA 2EWNA 2DZ9A 3OW2A 2LQKA 1RI0A 3MEWA 1Y96B 3OYDA 3CPWS 1NPPA 3OYFA 1VQNA 3QO3A 2VV5A 4F7UA 3OSVA 1K73U 1WJRA 3RIRA 1BI0A 3FLGA 3L2UA 4M75E 3GIBA 3OYNA 2B25A 3CCQT 4JUVA 2PVOB 1K9MU 4M75F 3CEYA 4O6JA 5I2MA 5J26A 3J81E 1VQKA 1O9SA 5LJ5e 5GANh 4C0DB 3MP1A 4LDYA 2RH2A 1Y96A 3CCVT 2E5QA 4KDIA 1BYMA 2Q1DX 4ZN1A 2LT1A 2DKGA 4C0FA 4C5IA 5GAN7 4N0AA 2RI3A 1Q82U 2XICA 2HNIA 3CCUT 1Q86C 3CMEA 5LJ3h 2MM2A 2D9TA 3M55A 3H8ZA 4MZPA 3UPUA 3CC2A 3EFSA 2KK4A 3OBYA 5CVIA 2AHJB 2QQBA 4RV0A 4DOVA 2MMPA 1KQ1A 5AYFA 2IG0A 5GAMj 2Y4YA 4ME7A 3LGFA 3I56A 3CCEA 1YIJA 4PJOC 1RL2A 5HK0A 4M7AE 3FRNA 4P5NA 2PUOB 5GAOl 4HT8A 4JRQA 1IREB 4L5GA 2X4WA 4M77C 3RESA 3CC4T 2EYQA 3N5BB 1YJ9T 1YJWT 4M7AF 1QCSA 4N4IA 1FWZA 2FL7A 2R58A 2RM4A 3AHUA 3V7SA 3OY9A 4BB7A 1I5LA 4PJOB 2HD0A 2X4XA 5CAIA 4J6XA 3OYMA 3C94A 4KT0E 4QVDA 3CC2T 3SDZA 4C5GA 5KE2A 1M90C 1VQ4A 4BY6C 3JCMQ 1VQ7A 4PJOG 3JCMX 3PIOA 3HU3A 1O75A 1R7RA 3SFMA 1HXDA 2L8DA 4RKUE 2L5QA 3HRUA 4XU0A 3HRSA 2YLBA 4JRKA 3V8JA 1NZ9A 3G6EA 2RO0A 4BY6B 3V7RA 1WGSA 4PJOA 4HKEA 1JBMA 2OAUA 4M77A 3DKMA 3R6OA 1IZ6A 2DXBA 3CMAT 1VQ5A 2DXTA 5A0GA 4Q5WA 2EQKA 2KY9A 4C8QC 4LD9K 5CQYA 4J83A 3UWNA 2Y4XA 4EMHA 2B8AA 3OYLA 4EMKC 4PJOD 3ZJVA 2E6ZA 4LDWA 1KHIA 2K3YA 5LL6S 3ER0A 3CBOA 5C6SA 1S72T 4M7DG 1YJNA 4C8QB 4CQNA 2JZ2A 3FC3A 3OYKA 1WQWA 4EMKB 3QJYA 2RHIA 2RI2A 2KDSA 5A2QE 3E9GA 3G4ST 4TVRA 1K8AC 3QG1A 4OGEA 2OTLT 1O54A 4L6V5 1EIFA 4M78C 5GAMh 3JB9J 4C8QG 3BDLA 2R5AA 2A3LA 2DEQA 3X28B 5KCHA 3PIPA 4V2SA 2XK0A 4QQGA 1VQMA 3L1AA 3QBYA 3LX7A 4M78B 4UC4A 3UT1A 1M9SA 1Q81U 4M7DD 2L3RA 1MHNA 4EMKA 2EQMA 2I2LA 4FU6A 2X4YA 5CKFA 4EDUA 5LJ5j 2PJHB 5ERGB 1VQOA 4M78G 4ARCA 1UGQB 4LDVA 4HA8A 4IUVA 1WPYA 2ZPBB 4C8QD 4CI0C 4XTWA 1U1SA 5CKEA 3RUXA 3CC7T 5DYGA 5GANg 4BACA 4JLGA 3I55A 3X24B 5CQXA 1VQ8A 1PSFA 2RJCA 1M1KC 1Y7XA 1CZ5A 1N9SA 1UGSB 3H6ZA 5GAN3 4AQ7A 3FPUA 4E7LA 3HFOA 4PNOA 3NTHA 4ZGDB 5LJ3g 5DYIA 1DJ7B 2QQAA 4M78D 2LCCA 1KC8U 1N27A 1NJIU 3OS5A 5KCOA 4XTYA 2JTFA 3OYCA 4C92G 4J7IA 3OMGA 3G71A 3CCJA 3OS1A 4JRPA 2DXUA 5C1BA 5CCAA 2X4JA 5GMKe 4A4HA 1S3SA 1VQ9A 4PLLA 4HT9A 2EJ9A 5CO7A 1BIAA 1UEBA 3HRTA 1CZ4A 2VUBA 2E12A 2RHZA 2VXEA 3JCMd 1KD1C 3INZA 1U1TA 1Y07A 4IUQA 3VU3C 2FHDA 1I81A 2RHXA 2Y90A 5CKBA 3CBMA 3OYYA 3OB9A 1UGRB 3RKWA 3JCMc 5LJ5h 4QQ6A 3EAEA 3MP8A 1FXXA 1I8FA 2H3JA 3M54A 4EPCA 4BE0A 1Q7YC 5GANf 5FTMA 2DVEA 3DLLA 5KH6A 1HK9A 2BIVA 4HCZA 2QDYB 4IKFA 3QQ7A 4RCCA 4C5EA 3QQ8A 1QVGS 2ZPEB 3CCSA 3M56A 3QYGB 3LGAA 3JB9F 1BKBA 5LJ3f 3DB3A 1N9RA 4A4GA 2G3RA 2XI9A 1X6OA 5J39A 3V8LA 4EMGA 5GLFA 5A0LA 3CXCS 2DIQA 3NTKA 3HL8A 2Q18X 1N6AA 1JRIA 2F5KA 4WF2A 1NPRA 2E70A 5D6YA 1PSEA 3CCRT 3PNWC 3M57A 2PQWA 4LDUA 3FEOA 2YRVA 4C0DC 2HAXA 3HSBA 3TIWA 1LJOA 3HPWA 5GAMg 3P8BB 2RJDA 1OZ2A 5L8RE 2OTJT 5GAN5 5GAOq 3GP8A 3CCVA 4ZTJA 1VQPT 3M59A 3QIIA 3BFMA 2K4YA 1QVGA 4QVZA 5I2SA 2DJZA 2WSCE 3JB9H 3CXCA 3OYHA 5FU7C 4QW2A 3VYGA 1AHJB 1U8RA 3DLMA 4XK8E 3BY7A 2IVWA 1W4SA 3VV0A 5FU7B 3P8DA 3QZ9B 3SD4A 5M9OA 4L59A 2KQWA 2Q1AX 4PJOF 3L2ZA 2R5MA 4FL6A 4M77E 5GAOr 4XU3A 4M77F 1ZHIA 1VQNT 1VUBA 5HY6A 3PTAA 1WLFA 2K2VA 2DTIA 4MMKA 3BDUA 2ZPIB 2RHUA 3KXTA 3HP9A 4BI4A 3VJPA 3MB5A 3SWNB 1VIFA 1XOVA 2KAFA 2M9UA 3Q1JA 4BI8B 4M75C 1VIEA 1XQHA 1P92A 3ZGZA 5GMKj 2EFIA 5HKCA 4JS4A 2GFAA 2ZGWA 2BUDA 4XQ3A 5C18A 4R56A 4AS1A 1N8RC 4M75B 4ELYC 5GAMf 1WJSA 3FPRA 2CS7A 2P0PA 3CMET 4M7DC 4CRIA 2DZCA 4XTXA 1OZ3A 4M75G 4RMOA 3TREA 4M7DB 2JN0A 3LHDA 2O01E 4JJNK 2RK1A 3JCMh 3CCET 1BIBA 4MZTA 3I56T 4PLIA 1X75C 3CMAA 1YITA 5CD1A 2CGHA 1D3BB 5GMKm 2PUKB 3RMQA 5LJ5g 4O5VA 4B9WA 4OB3B 2DK3A 4M7AC 3GOXA 1QVPA 2OTLA 4BDYA 3CCLA 3QDRB 4ZGEB 4M75D 1VQLA 1JB0E 4M7DA 2MAMA 3PGGA 1M4ZA 1G3YA 4M7AB 3X20B 2RJFA 2LQ8A 2V8JA 3S3NA 1VQ4T 1VQ7T 4ARIA 2E64A 1Y71A 2QQ9A 4KBMB 4XAXB 4C5HA 1UB4A 2DO3A 2EIFA 4GLKA 2CZ1B 3V7CA 4ZTFA 3FDRA 3G6ET 3M9QA 4M7AG 4C8QA 5I21A 5FTJA 4KUDK 2MM0A 2VC8A 3LWIA 2K3XA 3VUZA 5GMKh 2EJFA 4E7JA 2D0QB 4JS5A 4XU2A 1VQ5T 2RB6A 2RK2A 3S6WA 3A8LB 2QEXA 3JCMe 3GLXA 2LC4A 3QPHA 1YBYA 3T9NA 2XU8A 4KODA 1H3ZA 2KMTA 2LNVA 3MO8A 4OB2B 5CKDA 1NE8A 4N4GA 4M78A 1VQ6A 1Q86U 1YJNT 2RJEA 4C92C 4KUIA 4QVCA 3FPTA 4M7AD 1R8OB 3KUFA 2JTMA 2XIDA 3M4GA 4BUGA 4BD3A 5CCXA 4JDSA 4A4EA 2Q19X 2QA4A 2HQXA 3HKSA 5GANd 1QVFS 5LJ5f 5DLQE 1K73C 4C92B 2DTHA 4RCBA 2EAYA 2RHYA 2XG8D 3E1SA 2F5TX 2YLCA 2YVLA 4JLIA 2MWPA 1K9MC 2FVUA 2DAQA 4E7IA 2RD1A 5FLXE 3M5AA 5LJ3d 5EQJB 1QW1A 3MEUA 4IUPA 1WJQA 4FM4B 3UDCA 5KE3A 3MCAB 3CCMA 3CBPA 3A8MB 4C92A 1YCYA 1M90U 3C95A 1W2BS 4HCCA 2LT4A 5GMKl 3X25B 4A4KA 1YI2A 1QVFA 3A5ZB 4MMLA 1QP3A 1OYXA 4F7UE 3I55T 3ZJUA 1VQ8T 5CR2A 4F7UF 2KSSA 2XHCA 1KG1A 4C92D 2ZPFB 3M58A 1XTDA 2LRQA 4J6YA 3OYGA 4XTVA 3PFSA 1LNXA 4GY5A 1ZC1A 1MGQA 2VGMA 4MZMA 3WVDB 1KQSS 1QDNA 4E47A 5CCBA 5DLOA 1GXIE 1SSFA 3QXEB 1W2BA 2CZ6B 4BE2A 2Q1CX 3LH0A 3M53A 2EQUA 2M1HA 5GAN4 5DM7R 3G71T 2E6NA 4IURA 5GMKi 3CCJT 2CKKA 2VXFA 3BQBA 1X01A 3LGLA 1K8AU 4QQDA 1XNIA 2ZPHB 2WACA 3OQ5A 5CKHA 1H641 1VQ9T 3CCRA 3RERA 3CD6T 2WSFE 1E32A 3GPLA 1KQSA 2NLUA 3MP6A 3X26B 4X34A 3QWZA 2XKOC 3CCQA 2OTJA 3EFRA 4FIBA 4KDLA 3QZ5B 4J6WA 3P8HA 3OBWA 4YTLA 5C0MA 2V8IA 4PKCC 3MEVA 4Y91A 2GF7A 4PL6A 4D6WA 2GCXA 4X9CA 5GAMd 3F70A 1ZBXA 3CCUA 4LD6A 4FSXA 5IT9E 1YHQT 4XU1A 3CCST 1M1KU 4ZN3A 4JRIA 4PJOE 4N0AC 3C12A 4Z02A 2RI5A 2DD5A 3FB9A 2P0QA 3OYAA 4B9XA 3L2WA 1CR5A 3SWNC 3GF5A 3G7ZA 3TU4K 1Q81C 4BE1A 1YJWA 3JCMf 3A8HB 1YJ9A 3CC4A 3J7AF 3HHTB 2PWYA 3TCJA 2DIGA 5FTKA 5GAN6 5IAYA 3ZBDA 3JB9G 1VQKT 4NS5A 2LW6A 2CZ7B 2JOYA 2WSEE 3RKYA 3CPWA 2C06A 4M7DE 3OYEA 3L42A 2JV2A 4M7DF 2M16A 3OYIA 2ZZDA 2ZCFB 2MF2A 4HCBA 2QXFA 4MDWA 1FX7A 2QTXA 3QJ6A 3SWNA 5GAN8 1KD1U 3QSUA 1WNLA 3FIFA 2BKDN 4C8QE 2P4TA 1LOJA 4OB1B 5CK9A 1UGPB 1G3TA 4Y28E 2FB7A 2HBPA 2QI2A 3GNGA 5DY9A 4C8QF 3JB9D 3L2VA 4J7FA 1KC8C 1NJIC 1KQ2A 1V29B 2JUFA 4RG2A 1Q7YU 1YIJT 2V8KA 2CYZB 3QHSA 4M75A 4N4HA 1S72A 3LYIA 3OSSC 3QKJA 3WXMB 1ZQ1A 3JCMb 3ASKA 2GFUA 4M78E 3JCMW 3G4SA 2E41A 4OB0B 2E10A 4M77B 3MHXA 4OMFB 3S3MA 4M78F 4VUBA 5GANe 3S3OA 1BI2A 5D6WA 3A8OB 4ZGJB 4E7KA 3RMSA 5LJ5d 5GAN2 2K5IA 3L2QA 1M1FA 4OVAA 1TH7A 4OGCA 3VUBA 4M77G 4IUUA 2P0KA 4A4FA 4IUTA 2XD0A 1D3BA 3KBGA 4FT2A 5LJ3e 1I4K1 3GNFB 2DPPB 3JB9I 4E7HA 2DD4A 4BI3A 2K5FA 3PMIA 4XTUA 5FU6C 5FTLA 5GAOp 2RA2A 4M7AA 3HU2A 3WVEB 2K57A 2E65A 4C92E 3CC7A 2MI6A 2VGNA 4NL2A 4OP0A 3TEEA 3V8KA 1YITT 4C92F 2MWOA 3OS0A 4M77D 3JCMJ 5FU6B 3OYBA 2O4XB 2X35A 2VYTA 2EJGA 5GAOn 4BDZA 2E1HA 2XDBA 3OMCA 2XDDA 3CCLT 3ME9A 4A54A 5EPPA 3JCMV 1VQLT 3LLRA 4J5YA 2LCLA 3PT9A 2PVGB 4FT4A 3FJPA 3CF2A 3O8VA 5J3BA 4J8OA 4DA4A 4KO8A 2L89A 2O4XA 3JSCA 1B34B 1VQMT 2JNGA 2GQVA 4RG8A 2DXCA 3URGA 5FRNA 1I9GA 2D6FA 4KULA 5EG2A 3SB2A 3E9FA 4XTZA 2DTOA 3BW1A 1VQOT 2LTOA 4X9DA 2QEXT 3NFCA 5B6CA 3META 3QYHB 5A0DA 1Q82C 3QC8A 2R57A 3RKXA 1N8RU 1B34A 2EQJA 2YHTA 3HFNA 3ZEHA 1M1GA 1VQ6T 4NL3A 1WQ7A 5GAMe 2CZ0B 1M5Q1 3M4YA 2HQEA 4OF1A 1BI1A 3OS2A 2YUJA 5FRMA 3E19A 2QA4T 4A53A 2QQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5A A;  2BUD A;  5CIU A;  5KCH A;  2XK0 A;  4QQG A;  3F70 A;  3QBY A;  4LD6 A;  1WJS A;  3DB4 A;  3LX7 A;  4UC4 A;  3UT1 A;  5FRO A;  2L3R A;  4CRI A;  1MHN A;  1OZ3 A;  2EQM A;  4FU6 A;  2X4Y A;  1OI1 A;  4EDU A;  4Z02 A;  1G5V A;  2RI5 A;  5IN1 A;  2M0O A;  3OYA A;  4B9X A;  3L2W A;  4IUV A;  2EKO A;  3NTI A;  4PLI A;  2LDM A;  4BE1 A;  4BAC A;  4B9W A;  5D6X A;  2RJC A;  3L2R A;  2DIG A;  3GOX A;  5IAY A;  1KHC A;  3H6Z A;  4BDY A;  4E7L A;  3OA6 A;  3C4S A;  3NTH A;  4NS5 A;  3OYJ A;  3S3N A;  2RJF A;  2LCC A;  3OYE A;  3L42 A;  1N27 A;  2LVM A;  2M16 A;  5KCO A;  4II1 A;  3OYI A;  4C5H A;  2JTF A;  4ZTF A;  3FDR A;  3OYC A;  3MEA A;  4PL6 A;  3M9Q A;  2QQS A;  2XDP A;  3OMG A;  3QJ6 A;  2BKD N;  3OS1 A;  3PMT A;  2K3X A;  4E7J A;  1RI0 A;  3MEW A;  4A4H A;  3OYD A;  3L2V A;  4PLL A;  3S6W A;  4RG2 A;  3OYF A;  1WJR A;  4N4H A;  3FLG A;  3L2U A;  3LYI A;  1H3Z A;  2RHZ A;  3MO8 A;  3QKJ A;  4N4G A;  3OYN A;  3ASK A;  4IUQ A;  2GFU A;  2RJE A;  2FHD A;  2RHX A;  3CEY A;  5J26 A;  3KUF A;  3OB9 A;  3S3M A;  3S3O A;  3MP1 A;  3EAE A;  3MP8 A;  4QQ6 A;  5D6W A;  4A4E A;  4BD3 A;  2HQX A;  4E7K A;  2E5Q A;  4BE0 A;  3L2Q A;  4OVA A;  5KH6 A;  2RHY A;  2BIV A;  4HCZ A;  4C5I A;  4IUU A;  4IKF A;  2P0K A;  4A4F A;  4IUT A;  2RI3 A;  4C5E A;  2MWP A;  2DAQ A;  4E7I A;  2D9T A;  4E7H A;  3H8Z A;  3DB3 A;  4A4G A;  3MEU A;  2G3R A;  4IUP A;  3PMI A;  1WJQ A;  5J39 A;  5KE3 A;  2DIQ A;  3NTK A;  2IG0 A;  3LGF A;  2F5K A;  5D6Y A;  3OS0 A;  2MWO A;  3PNW C;  2PQW A;  1OYX A;  2X4W A;  2O4X B;  2YRV A;  2X35 A;  3FEO A;  3OYB A;  4N4I A;  2VYT A;  2R58 A;  2RJD A;  1OZ2 A;  3OY9 A;  4BDZ A;  3OMC A;  2X4X A;  3OYM A;  4ZTJ A;  3ME9 A;  3QII A;  2LRQ A;  3OYG A;  3PFS A;  3LLR A;  4GY5 A;  4QVZ A;  4C5G A;  5KE2 A;  3O8V A;  3OYH A;  2L8D A;  4QW2 A;  1SSF A;  2L89 A;  2O4X A;  4BE2 A;  3DLM A;  2RO0 A;  3LH0 A;  5FRN A;  1WGS A;  2EQU A;  2M1H A;  2E6N A;  4IUR A;  3P8D A;  3SD4 A;  2CKK A;  5M9O A;  4L59 A;  3E9F A;  3LGL A;  4QQD A;  1XNI A;  2R5M A;  2WAC A;  3OQ5 A;  4FL6 A;  4Q5W A;  2EQK A;  2LTO A;  3UWN A;  3MET A;  2B8A A;  3OYL A;  3BDL A;  2K3Y A;  2R57 A;  2NLU A;  2RHU A;  3MP6 A;  2EQJ A;  4X34 A;  5C6S A;  3ZEH A;  2JZ2 A;  3Q1J A;  3OYK A;  3FC3 A;  3OS2 A;  2HQE A;  2RHI A;  2RI2 A;  3P8H A;  5C0M A;  3E9G A;  5FRM A;  3MEV A;  2GF7 A;  2EFI A;  2QQR A;  2GFA A; 
#chains in the Genus database with same CATH topology
 5CIU A;  2FYK A;  5FRO A;  4ATO A;  3JCM g;  1OI1 A;  5GAN j;  1GBR A;  2A0F B;  3CD6 A;  1NLP C;  3CCJ Q;  2XMF A;  4JZ3 A;  2EKO A;  2PU9 B;  3NTI A;  1JJ2 S;  3C0C A;  1SRM A;  3EGU A;  5D6X A;  3UA7 A;  1KHC A;  2A7Y A;  2EQI A;  4DEY A;  3OA6 A;  1BCO A;  4LDX A;  3OYJ A;  5IHN A;  1TWB A;  7AT1 B;  4II1 A;  5HK3 A;  1QP2 A;  1RAA B;  1JJ2 A;  3PMT A;  4F14 A;  1PRL C;  2BE7 D;  2LQK A;  1RI0 A;  3MEW A;  1Y96 B;  3OYD A;  3CPW S;  2COZ A;  2VV5 A;  3FLG A;  4M75 E;  2Z0W A;  2B25 A;  4JUV A;  2JJ9 A;  4O6J A;  5I2M A;  3J81 E;  2CP0 A;  2RH2 A;  1Y96 A;  2E5Q A;  1BYM A;  3CCV Q;  2D9T A;  3OBY A;  5CVI A;  4RV0 A;  2MMP A;  3EG2 A;  2CH4 A;  3CCE A;  1RL2 A;  1VA7 A;  3N5B B;  3AHU A;  2R58 A;  4E2F B;  1I5L A;  4FYW B;  2J6F A;  3OYM A;  4J6X A;  3TQ7 P;  2NUZ A;  4FCY A;  4BY6 C;  1VQ7 A;  3PIO A;  1O75 A;  1KK7 A;  1NEB A;  2JS2 A;  2L5Q A;  4XU0 A;  3G6E A;  2HKN A;  2RO0 A;  2LQW A;  4M77 A;  3QDF A;  3R6O A;  1JQQ A;  4Q5W A;  3UWN A;  2Y4X A;  4EMK C;  1KHI A;  1RAH B;  2K3Y A;  5LL6 S;  5C6S A;  2JZ2 A;  1MMA A;  3CMA Q;  1K8A C;  3G4S T;  2KDS A;  4A63 B;  1EIF A;  4M78 C;  2O2O A;  3PIP A;  4D8D A;  4V2S A;  1C6V X;  3QBY A;  4UC4 A;  3UT1 A;  2L3R A;  1MHN A;  1ZX6 A;  2I2L A;  4FU6 A;  2X4Y A;  5LJ5 j;  2CT4 A;  4HA8 A;  2RQW A;  1KQS P;  4C8Q D;  4XTW A;  3CC7 T;  3RUX A;  4BAC A;  3X24 B;  5CQX A;  2QEX Q;  1PSF A;  1VQ8 A;  1I5O B;  2FRY A;  5GJW B;  4PNO A;  2E3I A;  1AWO A;  5LJ3 g;  2QQA A;  1KC8 U;  3OS5 A;  4C92 G;  4J7I A;  4JRP A;  2DXU A;  5C1B A;  2RQR A;  2X4J A;  5GMK e;  6AT1 B;  2EJ9 A;  2E12 A;  2RHZ A;  2VXE A;  3JCM d;  2X3W D;  1Y07 A;  1WHJ A;  4DBR A;  5CKB A;  3HU3 A;  3CBM A;  3OYY A;  3OB9 A;  1UGR B;  3ULR B;  3MP8 A;  1I8F A;  4EPC A;  5FTM A;  2ROT A;  2LX7 A;  4J9H A;  2FZC B;  3LGA A;  1EZZ B;  2QAZ A;  1OU8 A;  2DYB A;  3V8L A;  3CXC S;  1R0B G;  3NTK A;  3HL8 A;  4WF2 A;  1NPR A;  4LDU A;  3CCR Q;  2KNB B;  3HPW A;  5GAM g;  2DER A;  2CP5 A;  3MKD A;  2EGC A;  5GAO q;  3GP8 A;  4ZTJ A;  3BFM A;  2K4Y A;  3CCQ Q;  1R77 A;  1MMG A;  3CXC A;  1AHJ B;  4OML A;  3EG0 A;  4AFU C;  3CCU Q;  4L59 A;  2KQW A;  4PJO F;  3L2Z A;  2R5M A;  4FL6 A;  5GAO r;  1VQN T;  4J9G A;  1WLF A;  3KXT A;  1EX4 A;  3VJP A;  3MB5 A;  3SWN B;  1VIF A;  1XOV A;  3Q1J A;  3RR6 A;  2A36 A;  2RN8 A;  1YJW Q;  1RUW A;  2EFI A;  5HKC A;  1Q95 G;  5C18 A;  4AS1 A;  4R56 A;  1N8R C;  4ELY C;  5IHI A;  2MIO A;  3FPR A;  3CME T;  1OZ3 A;  1TOV A;  2CP3 A;  4FSS A;  4M7D B;  3JCM h;  1T3S A;  2CGH A;  4O5V A;  3O5Z A;  1N5Z A;  1QVP A;  2OTL A;  1NEG A;  3EG9 A;  4M75 D;  1VQL A;  1JB0 E;  4M7D A;  1M4Z A;  3H0F A;  2FPD A;  2EGE A;  3V7C A;  2CZ1 B;  3FDR A;  4PFZ A;  4KUD K;  1K73 R;  2LZ6 B;  4JS5 A;  4XU2 A;  1K9M R;  1ZSZ C;  2NUP A;  4OB2 B;  1YWP A;  5CKD A;  4N4G A;  4M78 A;  4GBQ A;  1Q86 U;  1UE9 A;  1Q82 R;  4RCB A;  2EAY A;  2LNH B;  2YLC A;  3E1S A;  4JLI A;  2DAQ A;  4E7I A;  5LJ3 d;  3OW2 P;  4IUP A;  2DX1 A;  3MCA B;  2EYZ A;  3C95 A;  1W2B S;  1T0H A;  4A4K A;  2G6F X;  3A5Z B;  4F7U E;  3G1J A;  1AZG B;  4JZ4 A;  4ESR A;  4C92 D;  1K9A A;  1LNX A;  1D09 B;  2D1X A;  4MZM A;  2DNU A;  3EFO A;  1GXI E;  3QXE B;  1W2B A;  3LH0 A;  4GLM A;  5IXB A;  5DM7 R;  3CCJ T;  5GMK i;  2VXF A;  1XNI A;  5CKH A;  3KFV A;  3CD6 T;  4E7Z A;  4Z89 A;  3X26 B;  4X34 A;  2XKO C;  2OTJ A;  4Y91 A;  4PKC C;  3H9N A;  2OTJ Q;  2GF7 A;  1IHW A;  1VQP Q;  5GAM d;  1ZBX A;  1WHM A;  2BZX A;  1RAI B;  2A28 A;  1YHQ Q;  4PJO E;  3C12 A;  5ECA A;  3OYA A;  3L2W A;  3TU4 K;  4BE1 A;  3JCM f;  1K4U S;  2RNA A;  2PWY A;  2DM1 A;  2KYB A;  2DET A;  2LW6 A;  2CZ7 B;  4J9B A;  4FYY B;  2JV2 A;  2DL3 A;  3OYI A;  4IIO A;  2QXF A;  2ECZ A;  1M90 R;  3QSU A;  1AZE A;  1WNL A;  1OUL A;  2AK5 A;  3JV3 A;  5CK9 A;  4C8Q F;  5DY9 A;  4EIK A;  3GNG A;  4PJM A;  2MK5 A;  3L2V A;  4J7F A;  1Q7Y U;  1ARK A;  4J9D A;  3LYI A;  3JCM b;  1WIE A;  3I56 Q;  3ASK A;  1SPK A;  3G4S A;  1QQJ A;  1W70 A;  4FW2 A;  4VUB A;  2CUD A;  3RMS A;  5GAN 2;  2NUT B;  4OVA A;  1TH7 A;  1WHK A;  4IUU A;  4A4F A;  1D3B A;  2DEU A;  3KBG A;  4FT2 A;  1VQ4 Q;  2NYS A;  1VOM A;  1JXM A;  4KRT A;  3JB9 I;  2DPP B;  3BE3 A;  2KXC A;  4BI3 A;  2K5F A;  5KYN A;  5GAO p;  2RA2 A;  2NUT A;  3CC7 A;  4NL2 A;  3CMA T;  1S3S A;  5FU6 B;  2VYT A;  4IIM A;  4PJN A;  2O9S A;  4A54 A;  3JCM V;  3UF4 A;  2LCL A;  3PT9 A;  3FJP A;  4HVV A;  4DA4 A;  1IGU A;  4RG8 A;  1I9G A;  2DXC A;  2YRD A;  4KUL A;  1IO6 A;  3E9F A;  3A98 A;  3BW1 A;  4HCK A;  2QEX T;  3QYH B;  1Q82 C;  2R57 A;  2EQJ A;  3ZEH A;  5EC7 A;  4F17 A;  1QVG P;  2HQE A;  2ZAE A;  2K3B A;  3I55 Q;  2MCN A;  3RNJ A;  4R55 A;  2L0A A;  3VKI A;  1M3B A;  3DB4 A;  2EW3 A;  1M8V A;  2PVD B;  1UDL A;  2K5L A;  3LW5 E;  3ZL7 C;  1JEG A;  1G5V A;  5FTN A;  5IN1 A;  1ZA1 B;  2M0O A;  3G71 Q;  1H92 A;  3VYH B;  1UEC A;  1JU5 C;  4MDX A;  4C0G A;  5LJ3 j;  1YCS B;  2DJQ A;  4OMO A;  4J9E A;  2AT1 B;  3A8G B;  4FYX B;  2KVQ G;  1OX9 A;  3A1P A;  1G3S A;  4C0Z A;  2HSE B;  4DOW A;  3CCS Q;  1VQN A;  3QO3 A;  2OX7 A;  1WJR A;  2YRC A;  3RIR A;  3OYN A;  2JW4 A;  3CCQ T;  2PVO B;  4M75 F;  3CEY A;  5GAN h;  4C0D B;  3MP1 A;  3NMZ C;  4C0F A;  4HXJ A;  3PVQ A;  2XIC A;  3CCU T;  3CME A;  1M2V B;  3M55 A;  3H8Z A;  4DOV A;  1KQ1 A;  5AYF A;  2IG0 A;  5GAM j;  4ME7 A;  3LGF A;  4M7A E;  3FRN A;  2PUO B;  5GAO l;  2KR3 A;  3CQT A;  4HT8 A;  4M77 C;  3HTR A;  2X4W A;  1M2V A;  4RTU A;  1YJW T;  1QCS A;  2HQH A;  2HD0 A;  2X4X A;  2DF6 A;  1OPL A;  4KT0 E;  3SDZ A;  1M90 C;  1R7R A;  3SFM A;  1HXD A;  2L8D A;  3HRU A;  1MMN A;  2AZS A;  2ED1 A;  1NZ9 A;  1WGS A;  1IZ6 A;  1C1A A;  4LD9 K;  5CQY A;  4PJO D;  4LUD A;  3ER0 A;  3CBO A;  4C8Q B;  4FYV B;  2LJ3 A;  1WQW A;  1FMV A;  3QJY A;  2RHI A;  2RI2 A;  3E9G A;  2OTL T;  4C8Q G;  1TUG B;  2DEQ A;  4AG2 C;  1IXD A;  3CCL Q;  1CSK A;  1Q81 U;  1M9S A;  4KH1 B;  1PRM C;  1ZA2 B;  5CKF A;  4HVU A;  1T0J A;  4LNP A;  4JJD A;  4ARC A;  1X43 A;  4LDV A;  4IUV A;  4CI0 C;  2RJC A;  1N9S A;  3H6Z A;  4AQ7 A;  4E7L A;  1VQ6 Q;  4ZGD B;  1DJ7 B;  4KGZ B;  2LCC A;  1N27 A;  3VS4 A;  2JTF A;  3OYC A;  2QYZ A;  3CCJ A;  3OS1 A;  1UTI A;  3EG3 A;  4FW1 A;  3VS6 A;  1BIA A;  2FHD A;  3RKW A;  1YI2 Q;  2Y90 A;  4HT9 A;  2FZG B;  3JCM c;  5LJ5 h;  1X27 A;  2KE9 A;  2H3J A;  2LJ1 A;  2V26 A;  5GAN f;  2DVE A;  1LPL A;  5KH6 A;  2OJ2 A;  4IKF A;  2QDY B;  1PHT A;  2AIR B;  3QQ8 A;  3DB3 A;  4A4G A;  2G3R A;  2XI9 A;  1X6O A;  5GLF A;  1MND A;  2QTV A;  2DIQ A;  1N6A A;  2E70 A;  2SEM A;  1PSE A;  1UJ0 A;  3PNW C;  3M57 A;  3HSB A;  2YRV A;  1LJO A;  2OTJ T;  2HSP A;  3CCV A;  1VQP T;  5KYW B;  3M59 A;  3I9Q A;  1ZBJ A;  4QVZ A;  2CP7 A;  2WSC E;  5I2S A;  3OYH A;  3EGD B;  2IVW A;  4JJB A;  3P8D A;  3QZ9 B;  5KYW A;  5M9O A;  1YP5 A;  4DEX A;  4M77 E;  1N8R R;  2CDT A;  4XU3 A;  1OPK A;  1VUB A;  3PTA A;  2K2V A;  4MMK A;  2ZPI B;  2JM8 A;  3EGD A;  2M9U A;  1CKA A;  3NPF A;  1WLP B;  3ZGZ A;  5GMK j;  2MOX A;  1I07 A;  5FWC A;  1ZUY A;  3R6N A;  4M75 B;  2BTT A;  2IPO B;  4D8K A;  2CS7 A;  2P0P A;  2NWM A;  4ANJ A;  4M7D C;  4CRI A;  4XTX A;  4M75 G;  3LHD A;  2EPD A;  4MZT A;  3I56 T;  1X75 C;  3CMA A;  4B9W A;  4OB3 B;  4BDY A;  2D8J A;  2DFU A;  2MAM A;  1G3Y A;  2LQ8 A;  2V8J A;  1VQ4 T;  3TVT A;  4ARI A;  2QQ9 A;  4XAX B;  2EIF A;  1PWT A;  2VC8 A;  3PE0 A;  3LWI A;  1RAF B;  2QEX A;  3EH2 A;  3GLX A;  3QPH A;  4KOD A;  2DA9 A;  1H3Z A;  1TXQ A;  1NE8 A;  1GFC A;  2RJE A;  4QVC A;  4M7A D;  1R8O B;  4BUG A;  5CCX A;  4BD3 A;  4JDS A;  2Q19 X;  1D1C A;  5LJ5 f;  1I0C A;  5DLQ E;  4C92 B;  2ABL A;  2XG8 D;  2F5T X;  2YVL A;  1M2O A;  1RLQ C;  2B86 A;  2P4R A;  3M5A A;  2HCK A;  5EQJ B;  1H8K A;  1U3O A;  1KFZ A;  1WJQ A;  4FM4 B;  1QLY A;  4B6M A;  4C92 A;  2YUP A;  1YCY A;  3SHW A;  5GMK l;  4MML A;  1QCO A;  1OYX A;  2J05 A;  3I55 T;  5CR2 A;  1QKX A;  4F7U F;  1KG1 A;  1MUZ A;  3M58 A;  4XTV A;  1ZC1 A;  1GCQ A;  1MGQ A;  4DBQ A;  2VGM A;  1KQS S;  3VS3 A;  4E47 A;  2F2V A;  5DLO A;  1BK2 A;  2DE0 X;  3H0H A;  3M53 A;  3G71 T;  2ZPH B;  2WAC A;  3OQ5 A;  3CCR A;  3RER A;  4R0K A;  1E32 A;  2CRE A;  1KQS A;  3MP6 A;  2KGT A;  4DBF A;  3QWZ A;  3CCQ A;  4FIB A;  1E7O A;  2E5K A;  2YDL A;  2GCX A;  4X9C A;  2J6O A;  3CCU A;  4LD6 A;  4FSX A;  1QKW A;  4XU1 A;  3CCS T;  1M1K U;  4AFZ C;  4DBH A;  2DD5 A;  3FB9 A;  4LXC A;  1Q86 R;  4HVW A;  2DL5 A;  2J7I A;  3AT1 B;  1YJW A;  3HHT B;  2VAS A;  5IAY A;  2QDL A;  1E6G A;  2WSE E;  2C06 A;  4M7D E;  1VQK Q;  1MNE A;  2VB6 A;  2O9V A;  4HCB A;  4MDW A;  1FX7 A;  1KD1 U;  3SWN A;  3FIF A;  4PFP A;  4ZNX A;  1KC8 C;  1YN8 A;  3CC2 Q;  2V8K A;  2V1R A;  1ZQ1 A;  4M78 E;  4OMF B;  2E41 A;  2E10 A;  4OB0 B;  3MHX A;  3S3M A;  1NYG A;  5D6W A;  2CP2 A;  2H8H A;  2E3H A;  1KJW A;  4RTY A;  2CUB A;  2P0K A;  1NBE B;  2XD0 A;  3VS5 A;  3PMI A;  4XTU A;  5FU6 C;  1SRL A;  2MI6 A;  3FPT A;  2FO0 A;  1VQ5 Q;  1UHC A;  4M77 D;  1R0C B;  2E1H A;  2KRM A;  3OMC A;  5HCK A;  2XDD A;  3CCL T;  3ME9 A;  1YJN Q;  3LLR A;  5J3B A;  4J8O A;  2CSQ A;  2C0T A;  2L89 A;  3JSC A;  1CKB A;  1IGQ A;  5I11 A;  2JNG A;  5FRN A;  1K76 A;  2DTO A;  2DMO A;  2RQU A;  3EH1 A;  3HFN A;  1M1G A;  1VQ6 T;  3OS2 A;  3M4Y A;  4OF1 A;  1BI1 A;  2K9G A;  2F2W A;  1FYN A;  4A53 A;  2L3Q A;  2X3X D;  1AWW A;  3J80 E;  3QUI A;  1BI3 A;  2HBW A;  3ZJT A;  3LWH A;  2D8H A;  3CPF A;  2PNI A;  4QKU A;  1Z9Q A;  2LDM A;  1YI2 T;  2HL5 C;  5GAO m;  1VQ9 Q;  3I5R A;  5IXF A;  4DQ2 A;  3JCM P;  3RDV A;  4E7S A;  3OW2 S;  1VQP A;  2F69 A;  3C4S A;  2MPX C;  1IHV A;  1BCM A;  2O88 A;  4F7U B;  1YHQ A;  4RTV A;  1VYV A;  4KLN A;  2XDP A;  4F7U G;  4PFO A;  2EWN A;  2DZ9 A;  3OW2 A;  5KYX B;  4F7U A;  1K73 U;  2DLP A;  3L2U A;  3GIB A;  2KT8 A;  1ZUU A;  1K9M U;  1O9S A;  2J06 A;  1QCF A;  3CCV T;  4JJC A;  4KDI A;  4ZN1 A;  2LT1 A;  4CC3 A;  4C5I A;  2RI3 A;  1Q82 U;  1Q86 C;  5LJ3 h;  4E6R A;  2MYS A;  2KEA A;  1ABO A;  3REA B;  1OX8 A;  2KK4 A;  4AT1 B;  2AHJ B;  2QQB A;  3EHR A;  1M27 C;  2K7A A;  1YIJ A;  2Y4Y A;  3I56 A;  1SF9 A;  3M0R A;  4P5N A;  1IRE B;  4M7A F;  2BE9 B;  3IQL A;  4N4I A;  1YIJ Q;  4PJO B;  3V7S A;  3OY9 A;  4BB7 A;  2C0I A;  2QGF B;  4C5G A;  1VQ4 A;  3JCM Q;  4PJO G;  1E6H A;  1TS9 A;  4RKU E;  1SSH A;  4X1V A;  2YLB A;  4JRK A;  4PJO A;  1U5S A;  2OAU A;  3DKM A;  2DXB A;  1WXU A;  2DXT A;  5A0G A;  2EQK A;  1D1A A;  2KY9 A;  4C8Q C;  1QVF P;  2B8A A;  2E6Z A;  4LDW A;  2M0Y A;  2EGA A;  1X69 A;  1YIT Q;  3QG1 A;  1O54 A;  1VYT A;  4L6V 5;  2V1Q A;  1HYO A;  5GAM h;  2JM9 A;  2R5A A;  2A3L A;  3X28 B;  2XK0 A;  1AT1 B;  4PK4 A;  4M7D D;  3D7S B;  2EQM A;  2YUN A;  4EDU A;  2PJH B;  2AKL A;  5ERG B;  1VQO A;  3MJX A;  2ZPB B;  2M02 A;  2F1L A;  4JLG A;  1VQO Q;  3I55 A;  1Y7X A;  2GNC A;  3FPU A;  4J9C A;  4LUE A;  1AEY A;  4M78 D;  1NJI U;  2FEI A;  5KCO A;  4XTY A;  2QA4 Q;  3G71 A;  2PTK A;  3VRZ A;  4A4H A;  4PLL A;  5CO7 A;  3SEM A;  3CCM Q;  1UEB A;  1CZ4 A;  1U1T A;  4CC4 B;  1I81 A;  4LN2 A;  4QQ6 A;  3EAE A;  1Q7Y C;  1HK9 A;  2RF0 A;  4RCC A;  1X2K A;  1QVG S;  3CCS A;  5LJ3 f;  1N9R A;  4QT7 A;  4EMG A;  5A0L A;  2KRN A;  2GTJ A;  5D6Y A;  3CCR T;  1M8M A;  2HDA A;  2HAX A;  1WFW A;  2X51 A;  2RJD A;  1OZ2 A;  2RQT A;  1QVG A;  1PNJ A;  1Q81 R;  2EYW A;  2L3S A;  3THK A;  2DJZ A;  3JB9 H;  4QW2 A;  3VYG A;  3BY7 A;  3VS7 A;  4OMM A;  1W4S A;  3VV0 A;  5FU7 B;  2Q1A X;  2CP6 A;  4M77 F;  5IHK A;  1FMW A;  1WXT A;  5HY6 A;  2RHU A;  2JTE A;  3HP9 A;  1K0X A;  2KAF A;  4M75 C;  1VIE A;  1XQH A;  1P92 A;  3CC4 Q;  1YJ9 Q;  1RI9 A;  2O31 A;  2ZGW A;  4XQ3 A;  5GAM f;  2HMA A;  3NGP A;  4RMO A;  3TRE A;  5CD1 A;  1WXB A;  2W10 A;  5GMK m;  3RMQ A;  1GL5 A;  1KIK A;  5I22 A;  3QDR B;  1S72 Q;  3CCL A;  1QCN A;  4ZGE B;  3S3N A;  1S1N A;  2A08 A;  4M7A B;  3QQ7 A;  2RJF A;  4CC2 A;  4C5H A;  2FRW A;  2DO3 A;  4GLK A;  2KXD A;  4ZTF A;  1AVZ C;  4M7A G;  4C8Q A;  2DL4 A;  5FTJ A;  3QWY A;  2KI7 A;  5GMK h;  2EJF A;  1MMD A;  2D0Q B;  1VQ5 T;  2JMC A;  2RB6 A;  3A8L B;  1YBY A;  1AD5 A;  2XU8 A;  2KMT A;  1Y0M A;  2LNV A;  1VQ6 A;  1YJN T;  4C92 C;  2JTM A;  2XID A;  3M4G A;  4RTT A;  4A4E A;  1VYU A;  1OEB A;  2DTH A;  2JXB A;  1SKU B;  2RD1 A;  1GCQ C;  2ENM A;  1QW1 A;  3MEU A;  3UDC A;  3A8M B;  2LP5 A;  2LT4 A;  1YI2 A;  3X25 B;  1QP3 A;  3ZJU A;  2ZPF B;  1RAE B;  2H3E B;  1NG2 A;  1XTD A;  2LRQ A;  4GY5 A;  3CPW P;  3WVD B;  1MV0 B;  1RAB B;  1QDN A;  5CCB A;  1SSF A;  2YUQ A;  1WHG A;  2EVR A;  2Q1C X;  1TUD A;  2M1H A;  5GAN 4;  2RMO A;  2BZ8 A;  2CKK A;  1WHH A;  1X01 A;  1K8A U;  1H64 1;  1VQ9 T;  1D1B A;  1PKT A;  3H0I A;  3CD6 Q;  2AKK A;  1JXO A;  2DVJ A;  4KDL A;  3EFR A;  2EYY A;  2P84 A;  5KYU B;  4J6W A;  5C0M A;  2KYM A;  2JT4 A;  2V8I A;  1RAG B;  2IIM A;  1ABQ A;  2DL7 A;  4PL6 A;  3F70 A;  1YHQ T;  2OAW A;  4F16 A;  5KYU A;  4N0A C;  4Z02 A;  1GCP A;  1SEM A;  2RPN A;  5IH2 A;  2DL8 A;  3SWN C;  3G7Z A;  1Q81 C;  3A8H B;  2FG0 A;  1Z9Z A;  3TCJ A;  1F1B B;  2CT3 A;  4WTO B;  1KC8 R;  1UJY A;  3ZBD A;  4NS5 A;  3CPW A;  2FPE A;  4M7D F;  2ZZD A;  3EGX B;  2ZCF B;  2QTX A;  3QJ6 A;  4OMN A;  2P4T A;  3M0P A;  4OB1 B;  1UGP B;  1G3T A;  2FB7 A;  1WHL A;  3JB9 D;  1V76 A;  1KQ2 A;  2JUF A;  1D0Z A;  1YIJ T;  4N4H A;  3QHS A;  4M75 A;  3EGX A;  2KBT A;  3CCE Q;  2GFU A;  3NHN A;  3JCM W;  4M77 B;  4M78 F;  5GAN e;  1BI2 A;  4ZGJ B;  1M1F A;  4M77 G;  2D0N A;  1B3Q A;  1M30 A;  4ORZ A;  1VQ7 Q;  1IRX A;  3M0S A;  1M3A A;  3GNF B;  4E7H A;  1HSQ A;  3QWX X;  1UGV A;  3G6E Q;  1SHG A;  2AZV A;  3HU2 A;  3REB B;  3WVE B;  2E65 A;  4C92 E;  2VGN A;  2I0N A;  1YIT T;  1BBZ A;  3V8K A;  3LH5 A;  3JCM J;  2K2M A;  2ROL A;  2O4X B;  1PG5 B;  1X6G A;  4BDZ A;  1C0M A;  2EJG A;  9ATC B;  5GAO n;  2XDB A;  1TUC A;  5EPP A;  1TG0 A;  2YWW A;  2PVG B;  4FT4 A;  1M1K R;  3CF2 A;  1SHF A;  2RQV A;  2O4X A;  1B34 B;  2BZY A;  3I5S A;  3URG A;  2F2X A;  2D6F A;  1ZUK A;  5EG2 A;  3SB2 A;  1XJW B;  4XTZ A;  1SG5 A;  1D0Y A;  1VQO T;  5B6C A;  3NFC A;  2GBQ A;  5A0D A;  2SRC A;  2LCS A;  3RKX A;  1N8R U;  1B34 A;  2LJ0 A;  1MV3 A;  1V1C A;  1WQ7 A;  1WI7 A;  5FRM A;  1VQ8 Q;  2QA4 T;  2DRK A;  1KD1 R;  3CXC P;  4PJL A;  2LX9 A;  4J9F A;  4ELZ C;  4RTX A;  5D7U A;  2DYI A;  1J3T A;  1ZLM A;  2EYX A;  2COW A;  1RLP C;  3CCM T;  3HU1 A;  2ED0 A;  2JMA A;  3JRZ A;  3L2R A;  1A0N B;  4NOY A;  2VWF A;  4AFS C;  2JS0 A;  1WYX A;  2YSQ A;  2LVM A;  4OMP A;  2JVV A;  1HJD A;  8AT1 B;  2YXY A;  1G3W A;  3MEA A;  3ZFJ A;  2QQS A;  2YUO A;  1M3C A;  1PKS A;  3JAM E;  2ZPG B;  3UAT A;  1NPP A;  3OYF A;  3OSV A;  1BI0 A;  2A37 A;  3EG1 A;  2LMJ A;  5J26 A;  1QMC A;  1VQK A;  5LJ5 e;  4LDY A;  3VS0 A;  2Q1D X;  2DKG A;  1G8X A;  3EHQ A;  5GAN 7;  4N0A A;  3MPU B;  2HNI A;  2MM2 A;  4AFQ C;  1ACM B;  4MZP A;  3CC2 A;  3UPU A;  3EFS A;  4PJO C;  2FPF A;  5HK0 A;  3M0T A;  4JRQ A;  4L5G A;  3RES A;  3CC4 T;  2EYQ A;  1YJ9 T;  1UUE A;  1UFF A;  1FWZ A;  2FL7 A;  2RM4 A;  1KSW A;  1U06 A;  5CAI A;  3C94 A;  4QVD A;  1RAD B;  5KE2 A;  1PCX A;  3JCM X;  1HD3 A;  3HRS A;  3V8J A;  3H41 A;  4BY6 B;  3V7R A;  4HKE A;  1JBM A;  1T3L A;  1GFD A;  3EG9 B;  2VKN A;  2KT1 A;  1VQ5 A;  4RUG A;  4J83 A;  4EMH A;  3OYL A;  3ZJV A;  4M7D G;  1S72 T;  1YJN A;  4CQN A;  3FC3 A;  3OYK A;  4EMK B;  5A2Q E;  4TVR A;  4OGE A;  3JB9 J;  3BDL A;  1ZSG A;  2GQI A;  4J9I A;  5KCH A;  2OTL Q;  4QQG A;  1W2B P;  2NUP B;  2DBK A;  1VQL Q;  1VQM A;  3L1A A;  3LX7 A;  4M78 B;  4EMK A;  4M4Z A;  1PM3 A;  1VQM Q;  4M78 G;  1UGQ B;  3RBB B;  1WPY A;  1QWF A;  1U1S A;  5CKE A;  1H3H A;  5DYG A;  5GAN g;  1AWJ A;  1CZ5 A;  1M1K C;  1WX6 A;  1UGS B;  5GAN 3;  2C0O A;  3HFO A;  3NTH A;  3E2U A;  5DYI A;  3FJ5 A;  3OMG A;  1Q7Y R;  5FW9 A;  5CCA A;  1VQ9 A;  1YFN A;  3EFO B;  3HRT A;  1LVK A;  2VUB A;  1KD1 C;  1JO8 A;  3INZ A;  4IUQ A;  3VU3 C;  2RHX A;  1UHF A;  1FXX A;  3M54 A;  4BE0 A;  3DLL A;  2BIV A;  4HCZ A;  1G83 A;  3PVL A;  4C5E A;  2ZPE B;  2VVK A;  2OI3 A;  3M56 A;  3QYG B;  2GGR A;  4K11 A;  1BKB A;  3JB9 F;  1BU1 A;  5J39 A;  2Q18 X;  1JRI A;  2F5K A;  2PQW A;  1X6B A;  3FEO A;  4C0D C;  4CC7 A;  3TIW A;  3P8B B;  1RAC B;  5L8R E;  5GAN 5;  3QII A;  1IB8 A;  5KYX A;  1FMK A;  5FU7 C;  1U8R A;  4RTZ A;  1NM7 A;  2DIL A;  3DLM A;  4XK8 E;  2HEQ A;  3SD4 A;  1ZHI A;  1QWE A;  2DTI A;  3BDU A;  2YT6 A;  4BI4 A;  4BI8 B;  1NJI R;  1D0X A;  2M51 A;  4JS4 A;  2GFA A;  2BUD A;  1B7T A;  1WDX A;  2LQN A;  1W6X A;  1WJS A;  2DZC A;  2CH4 W;  2JN0 A;  2O01 E;  4JJN K;  2RK1 A;  3U23 A;  3CCE T;  1BIB A;  4PLI A;  1YIT A;  4PJJ A;  2HKQ B;  1D3B B;  2PUK B;  5LJ5 g;  2DK3 A;  1WZO A;  4M7A C;  3GOX A;  2KRO A;  3PGG A;  3X20 B;  1NYF A;  3G4S Q;  1VQ7 T;  1G2B A;  2E64 A;  1Y71 A;  4KBM B;  1UB4 A;  3G6E T;  3M9Q A;  5I21 A;  2MM0 A;  2K3X A;  3VUZ A;  4E7J A;  1UG1 A;  2RK2 A;  3S6W A;  2KRS A;  3JCM e;  2LC4 A;  3T9N A;  1OU9 A;  1GRI A;  3MO8 A;  3CC7 Q;  4KUI A;  1ZSZ B;  3TSW A;  3KUF A;  4F04 B;  2DBM A;  2QA4 A;  2HQX A;  2K79 A;  3HKS A;  5GAN d;  1QVF S;  1K73 C;  2RHY A;  1GBQ A;  2HZY A;  2MWP A;  1K9M C;  1PC0 A;  2FVU A;  5FLX E;  1ZSZ A;  2GTO A;  3CCM A;  5KE3 A;  3CBP A;  1M90 U;  4HCC A;  1QVF A;  2COY A;  4AMC A;  1W1F A;  1VQ8 T;  2KSS A;  2XHC A;  1PD0 A;  4OMQ A;  4AG1 C;  4J6Y A;  3OYG A;  1OQK A;  2E4H A;  3PFS A;  1TU0 B;  2CZ6 B;  1K1Z A;  4BE2 A;  2EQU A;  2J6K A;  1YWO A;  2E6N A;  4IUR A;  2L2P A;  3BQB A;  3LGL A;  4QQD A;  1YNZ A;  2CSI A;  2WSF E;  3GPL A;  2NLU A;  2QAS A;  3QZ5 B;  5AT1 B;  4YTL A;  3P8H A;  3OBW A;  3GBQ A;  4Z88 A;  3MEV A;  3I35 A;  4D6W A;  2QG9 B;  1OV3 A;  2ATC B;  1Y57 A;  4RTW A;  2QK0 A;  5IT9 E;  3UA6 A;  4ZN3 A;  4JRI A;  2EKH A;  2RI5 A;  1OOT A;  2P0Q A;  4B9X A;  1CR5 A;  3GF5 A;  4KH0 B;  1PD1 A;  1YJ9 A;  3CC4 A;  3J7A F;  1VQN Q;  2HL3 A;  2DIG A;  5FTK A;  5GAN 6;  1BB9 A;  3JB9 G;  1VQK T;  8ATC B;  2JOY A;  3RKY A;  4Z8A A;  3OYE A;  3L42 A;  2M16 A;  2MF2 A;  5GAN 8;  3VS2 A;  2BKD N;  4C8Q E;  1LOJ A;  4Y28 E;  3CME Q;  1TTH B;  3CC2 T;  2HBP A;  2QI2 A;  1X2Q A;  1NJI C;  1LCK A;  1V29 B;  4RG2 A;  2CYZ B;  4KGV B;  4LE9 A;  1S72 A;  3OSS C;  3QKJ A;  3WXM B;  3M0Q A;  2EBP A;  3S3O A;  2ESW A;  3A8O B;  4E7K A;  1NLO C;  5LJ5 d;  2K5I A;  3L2Q A;  4Y92 A;  1TSF A;  2QGG A;  4OGC A;  3VUB A;  1K8A R;  4IUT A;  1B07 A;  1I4K 1;  3M0U A;  5LJ3 e;  3VRY A;  3TSZ A;  2X9H A;  2DD4 A;  5FTL A;  2DRM A;  4M7A A;  2K57 A;  3TEE A;  4OP0 A;  4C92 F;  2MWO A;  3OS0 A;  3OYB A;  2X35 A;  3VS1 A;  4KGX B;  2L3P A;  1I1J A;  1AWX A;  1VQL T;  4J5Y A;  1EFN A;  5GJV B;  3O8V A;  4WCI A;  1K0S A;  2K6D A;  4KO8 A;  1JJ2 P;  5KYY B;  1VQM T;  2GQV A;  2W0Z A;  1AOJ A;  2FZK B;  5FWB A;  4JPB W;  5L23 A;  2LTO A;  4X9D A;  3MET A;  2PZ1 A;  3QC8 A;  5KYY A;  2YHT A;  4NL3 A;  1WA7 A;  2CZ0 B;  1M5Q 1;  2YUJ A;  3E19 A;  5GAM e;  2QQR A; 
#chains in the Genus database with same CATH homology
 5CIU A;  4R55 A;  3VKI A;  2LX9 A;  4ELZ C;  3DB4 A;  2FYK A;  3J80 E;  5FRO A;  3QUI A;  1BI3 A;  3ZJT A;  1M8V A;  2PVD B;  2K5L A;  3LWH A;  3LW5 E;  4ATO A;  3JCM g;  1OI1 A;  5GAN j;  1G5V A;  5FTN A;  5IN1 A;  3CCM T;  2M0O A;  3CD6 A;  3CPF A;  2EKO A;  2PU9 B;  3NTI A;  3HU1 A;  1JJ2 S;  3VYH B;  2LDM A;  1YI2 T;  5GAO m;  3JRZ A;  4MDX A;  4C0G A;  4DQ2 A;  5D6X A;  5LJ3 j;  3JCM P;  3L2R A;  4NOY A;  3OW2 S;  1KHC A;  2A7Y A;  1VQP A;  2F69 A;  3OA6 A;  3C4S A;  4LDX A;  3OYJ A;  2LVM A;  3A8G B;  2JVV A;  4F7U B;  4II1 A;  5HK3 A;  1YHQ A;  1QP2 A;  2KVQ G;  1JJ2 A;  1G3W A;  3MEA A;  1G3S A;  3ZFJ A;  2QQS A;  2XDP A;  4KLN A;  3PMT A;  4F7U G;  2ZPG B;  4C0Z A;  3JAM E;  4DOW A;  2EWN A;  2DZ9 A;  3OW2 A;  2LQK A;  1RI0 A;  3MEW A;  1Y96 B;  3OYD A;  3CPW S;  1NPP A;  3OYF A;  1VQN A;  3QO3 A;  2VV5 A;  4F7U A;  3OSV A;  1K73 U;  1WJR A;  3RIR A;  1BI0 A;  3FLG A;  3L2U A;  4M75 E;  3GIB A;  3OYN A;  2B25 A;  3CCQ T;  4JUV A;  2PVO B;  1K9M U;  4M75 F;  3CEY A;  4O6J A;  5I2M A;  5J26 A;  3J81 E;  1VQK A;  1O9S A;  5LJ5 e;  5GAN h;  4C0D B;  3MP1 A;  4LDY A;  2RH2 A;  1Y96 A;  3CCV T;  2E5Q A;  4KDI A;  1BYM A;  2Q1D X;  4ZN1 A;  2LT1 A;  2DKG A;  4C0F A;  4C5I A;  5GAN 7;  4N0A A;  2RI3 A;  1Q82 U;  2XIC A;  2HNI A;  3CCU T;  1Q86 C;  3CME A;  5LJ3 h;  2MM2 A;  2D9T A;  3M55 A;  3H8Z A;  4MZP A;  3UPU A;  3CC2 A;  3EFS A;  2KK4 A;  3OBY A;  5CVI A;  2AHJ B;  2QQB A;  4RV0 A;  4DOV A;  2MMP A;  1KQ1 A;  5AYF A;  2IG0 A;  5GAM j;  2Y4Y A;  4ME7 A;  3LGF A;  3I56 A;  3CCE A;  1YIJ A;  4PJO C;  1RL2 A;  5HK0 A;  4M7A E;  3FRN A;  4P5N A;  2PUO B;  5GAO l;  4HT8 A;  4JRQ A;  1IRE B;  4L5G A;  2X4W A;  4M77 C;  3RES A;  3CC4 T;  2EYQ A;  3N5B B;  1YJ9 T;  1YJW T;  4M7A F;  1QCS A;  4N4I A;  1FWZ A;  2FL7 A;  2R58 A;  2RM4 A;  3AHU A;  3V7S A;  3OY9 A;  4BB7 A;  1I5L A;  4PJO B;  2HD0 A;  2X4X A;  5CAI A;  4J6X A;  3OYM A;  3C94 A;  4KT0 E;  4QVD A;  3CC2 T;  3SDZ A;  4C5G A;  5KE2 A;  1M90 C;  1VQ4 A;  4BY6 C;  3JCM Q;  1VQ7 A;  4PJO G;  3JCM X;  3PIO A;  3HU3 A;  1O75 A;  1R7R A;  3SFM A;  1HXD A;  2L8D A;  4RKU E;  2L5Q A;  3HRU A;  4XU0 A;  3HRS A;  2YLB A;  4JRK A;  3V8J A;  1NZ9 A;  3G6E A;  2RO0 A;  4BY6 B;  3V7R A;  1WGS A;  4PJO A;  4HKE A;  1JBM A;  2OAU A;  4M77 A;  3DKM A;  3R6O A;  1IZ6 A;  2DXB A;  3CMA T;  1VQ5 A;  2DXT A;  5A0G A;  4Q5W A;  2EQK A;  2KY9 A;  4C8Q C;  4LD9 K;  5CQY A;  4J83 A;  3UWN A;  2Y4X A;  4EMH A;  2B8A A;  3OYL A;  4EMK C;  4PJO D;  3ZJV A;  2E6Z A;  4LDW A;  1KHI A;  2K3Y A;  5LL6 S;  3ER0 A;  3CBO A;  5C6S A;  1S72 T;  4M7D G;  1YJN A;  4C8Q B;  4CQN A;  2JZ2 A;  3FC3 A;  3OYK A;  1WQW A;  4EMK B;  3QJY A;  2RHI A;  2RI2 A;  2KDS A;  5A2Q E;  3E9G A;  3G4S T;  4TVR A;  1K8A C;  3QG1 A;  4OGE A;  2OTL T;  1O54 A;  4L6V 5;  1EIF A;  4M78 C;  5GAM h;  3JB9 J;  4C8Q G;  3BDL A;  2R5A A;  2A3L A;  2DEQ A;  3X28 B;  5KCH A;  3PIP A;  4V2S A;  2XK0 A;  4QQG A;  1VQM A;  3L1A A;  3QBY A;  3LX7 A;  4M78 B;  4UC4 A;  3UT1 A;  1M9S A;  1Q81 U;  4M7D D;  2L3R A;  1MHN A;  4EMK A;  2EQM A;  2I2L A;  4FU6 A;  2X4Y A;  5CKF A;  4EDU A;  5LJ5 j;  2PJH B;  5ERG B;  1VQO A;  4M78 G;  4ARC A;  1UGQ B;  4LDV A;  4HA8 A;  4IUV A;  1WPY A;  2ZPB B;  4C8Q D;  4CI0 C;  4XTW A;  1U1S A;  5CKE A;  3RUX A;  3CC7 T;  5DYG A;  5GAN g;  4BAC A;  4JLG A;  3I55 A;  3X24 B;  5CQX A;  1VQ8 A;  1PSF A;  2RJC A;  1M1K C;  1Y7X A;  1CZ5 A;  1N9S A;  1UGS B;  3H6Z A;  5GAN 3;  4AQ7 A;  3FPU A;  4E7L A;  3HFO A;  4PNO A;  3NTH A;  4ZGD B;  5LJ3 g;  5DYI A;  1DJ7 B;  2QQA A;  4M78 D;  2LCC A;  1KC8 U;  1N27 A;  1NJI U;  3OS5 A;  5KCO A;  4XTY A;  2JTF A;  3OYC A;  4C92 G;  4J7I A;  3OMG A;  3G71 A;  3CCJ A;  3OS1 A;  4JRP A;  2DXU A;  5C1B A;  5CCA A;  2X4J A;  5GMK e;  4A4H A;  1S3S A;  1VQ9 A;  4PLL A;  4HT9 A;  2EJ9 A;  5CO7 A;  1BIA A;  1UEB A;  3HRT A;  1CZ4 A;  2VUB A;  2E12 A;  2RHZ A;  2VXE A;  3JCM d;  1KD1 C;  3INZ A;  1U1T A;  1Y07 A;  4IUQ A;  3VU3 C;  2FHD A;  1I81 A;  2RHX A;  2Y90 A;  5CKB A;  3CBM A;  3OYY A;  3OB9 A;  1UGR B;  3RKW A;  3JCM c;  5LJ5 h;  4QQ6 A;  3EAE A;  3MP8 A;  1FXX A;  1I8F A;  2H3J A;  3M54 A;  4EPC A;  4BE0 A;  1Q7Y C;  5GAN f;  5FTM A;  2DVE A;  3DLL A;  5KH6 A;  1HK9 A;  2BIV A;  4HCZ A;  2QDY B;  4IKF A;  3QQ7 A;  4RCC A;  4C5E A;  3QQ8 A;  1QVG S;  2ZPE B;  3CCS A;  3M56 A;  3QYG B;  3LGA A;  3JB9 F;  1BKB A;  5LJ3 f;  3DB3 A;  1N9R A;  4A4G A;  2G3R A;  2XI9 A;  1X6O A;  5J39 A;  3V8L A;  4EMG A;  5GLF A;  5A0L A;  3CXC S;  2DIQ A;  3NTK A;  3HL8 A;  2Q18 X;  1N6A A;  1JRI A;  2F5K A;  4WF2 A;  1NPR A;  2E70 A;  5D6Y A;  1PSE A;  3CCR T;  3PNW C;  3M57 A;  2PQW A;  4LDU A;  3FEO A;  2YRV A;  4C0D C;  2HAX A;  3HSB A;  3TIW A;  1LJO A;  3HPW A;  5GAM g;  3P8B B;  2RJD A;  1OZ2 A;  5L8R E;  2OTJ T;  5GAN 5;  5GAO q;  3GP8 A;  3CCV A;  4ZTJ A;  1VQP T;  3M59 A;  3QII A;  3BFM A;  2K4Y A;  1QVG A;  4QVZ A;  5I2S A;  2DJZ A;  2WSC E;  3JB9 H;  3CXC A;  3OYH A;  5FU7 C;  4QW2 A;  3VYG A;  1AHJ B;  1U8R A;  3DLM A;  4XK8 E;  3BY7 A;  2IVW A;  1W4S A;  3VV0 A;  5FU7 B;  3P8D A;  3QZ9 B;  3SD4 A;  5M9O A;  4L59 A;  2KQW A;  2Q1A X;  4PJO F;  3L2Z A;  2R5M A;  4FL6 A;  4M77 E;  5GAO r;  4XU3 A;  4M77 F;  1ZHI A;  1VQN T;  1VUB A;  5HY6 A;  3PTA A;  1WLF A;  2K2V A;  2DTI A;  4MMK A;  3BDU A;  2ZPI B;  2RHU A;  3KXT A;  3HP9 A;  4BI4 A;  3VJP A;  3MB5 A;  3SWN B;  1VIF A;  1XOV A;  2KAF A;  2M9U A;  3Q1J A;  4BI8 B;  4M75 C;  1VIE A;  1XQH A;  1P92 A;  3ZGZ A;  5GMK j;  2EFI A;  5HKC A;  4JS4 A;  2GFA A;  2ZGW A;  2BUD A;  4XQ3 A;  5C18 A;  4R56 A;  4AS1 A;  1N8R C;  4M75 B;  4ELY C;  5GAM f;  1WJS A;  3FPR A;  2CS7 A;  2P0P A;  3CME T;  4M7D C;  4CRI A;  2DZC A;  4XTX A;  1OZ3 A;  4M75 G;  4RMO A;  3TRE A;  4M7D B;  2JN0 A;  3LHD A;  2O01 E;  4JJN K;  2RK1 A;  3JCM h;  3CCE T;  1BIB A;  4MZT A;  3I56 T;  4PLI A;  1X75 C;  3CMA A;  1YIT A;  5CD1 A;  2CGH A;  1D3B B;  5GMK m;  2PUK B;  3RMQ A;  5LJ5 g;  4O5V A;  4B9W A;  4OB3 B;  2DK3 A;  4M7A C;  3GOX A;  1QVP A;  2OTL A;  4BDY A;  3CCL A;  3QDR B;  4ZGE B;  4M75 D;  1VQL A;  1JB0 E;  4M7D A;  2MAM A;  3PGG A;  1M4Z A;  1G3Y A;  4M7A B;  3X20 B;  2RJF A;  2LQ8 A;  2V8J A;  3S3N A;  1VQ4 T;  1VQ7 T;  4ARI A;  2E64 A;  1Y71 A;  2QQ9 A;  4KBM B;  4XAX B;  4C5H A;  1UB4 A;  2DO3 A;  2EIF A;  4GLK A;  2CZ1 B;  3V7C A;  4ZTF A;  3FDR A;  3G6E T;  3M9Q A;  4M7A G;  4C8Q A;  5I21 A;  5FTJ A;  4KUD K;  2MM0 A;  2VC8 A;  3LWI A;  2K3X A;  3VUZ A;  5GMK h;  2EJF A;  4E7J A;  2D0Q B;  4JS5 A;  4XU2 A;  1VQ5 T;  2RB6 A;  2RK2 A;  3S6W A;  3A8L B;  2QEX A;  3JCM e;  3GLX A;  2LC4 A;  3QPH A;  1YBY A;  3T9N A;  2XU8 A;  4KOD A;  1H3Z A;  2KMT A;  2LNV A;  3MO8 A;  4OB2 B;  5CKD A;  1NE8 A;  4N4G A;  4M78 A;  1VQ6 A;  1Q86 U;  1YJN T;  2RJE A;  4C92 C;  4KUI A;  4QVC A;  3FPT A;  4M7A D;  1R8O B;  3KUF A;  2JTM A;  2XID A;  3M4G A;  4BUG A;  4BD3 A;  5CCX A;  4JDS A;  4A4E A;  2Q19 X;  2QA4 A;  2HQX A;  3HKS A;  5GAN d;  1QVF S;  5LJ5 f;  5DLQ E;  1K73 C;  4C92 B;  2DTH A;  4RCB A;  2EAY A;  2RHY A;  2XG8 D;  3E1S A;  2F5T X;  2YLC A;  2YVL A;  4JLI A;  2MWP A;  1K9M C;  2FVU A;  2DAQ A;  4E7I A;  2RD1 A;  5FLX E;  3M5A A;  5LJ3 d;  5EQJ B;  1QW1 A;  3MEU A;  4IUP A;  1WJQ A;  4FM4 B;  3UDC A;  5KE3 A;  3MCA B;  3CCM A;  3CBP A;  3A8M B;  4C92 A;  1YCY A;  1M90 U;  3C95 A;  1W2B S;  4HCC A;  2LT4 A;  5GMK l;  3X25 B;  4A4K A;  1YI2 A;  1QVF A;  3A5Z B;  4MML A;  1QP3 A;  1OYX A;  4F7U E;  3I55 T;  3ZJU A;  1VQ8 T;  5CR2 A;  4F7U F;  2KSS A;  2XHC A;  1KG1 A;  4C92 D;  2ZPF B;  3M58 A;  1XTD A;  2LRQ A;  4J6Y A;  3OYG A;  4XTV A;  3PFS A;  1LNX A;  4GY5 A;  1ZC1 A;  1MGQ A;  2VGM A;  4MZM A;  3WVD B;  1KQS S;  1QDN A;  4E47 A;  5CCB A;  5DLO A;  1GXI E;  1SSF A;  3QXE B;  1W2B A;  2CZ6 B;  4BE2 A;  2Q1C X;  3LH0 A;  3M53 A;  2EQU A;  2M1H A;  5GAN 4;  5DM7 R;  3G71 T;  2E6N A;  4IUR A;  5GMK i;  3CCJ T;  2CKK A;  2VXF A;  3BQB A;  1X01 A;  3LGL A;  1K8A U;  4QQD A;  1XNI A;  2ZPH B;  2WAC A;  3OQ5 A;  5CKH A;  1H64 1;  1VQ9 T;  3CCR A;  3RER A;  3CD6 T;  2WSF E;  1E32 A;  3GPL A;  1KQS A;  2NLU A;  3MP6 A;  3X26 B;  4X34 A;  3QWZ A;  2XKO C;  3CCQ A;  2OTJ A;  3EFR A;  4FIB A;  4KDL A;  3QZ5 B;  4J6W A;  3P8H A;  3OBW A;  4YTL A;  5C0M A;  2V8I A;  4PKC C;  3MEV A;  4Y91 A;  2GF7 A;  4PL6 A;  4D6W A;  2GCX A;  4X9C A;  5GAM d;  3F70 A;  1ZBX A;  3CCU A;  4LD6 A;  4FSX A;  5IT9 E;  1YHQ T;  4XU1 A;  3CCS T;  1M1K U;  4ZN3 A;  4JRI A;  4PJO E;  4N0A C;  3C12 A;  4Z02 A;  2RI5 A;  2DD5 A;  3FB9 A;  2P0Q A;  3OYA A;  4B9X A;  3L2W A;  1CR5 A;  3SWN C;  3GF5 A;  3G7Z A;  3TU4 K;  1Q81 C;  4BE1 A;  1YJW A;  3JCM f;  3A8H B;  1YJ9 A;  3CC4 A;  3J7A F;  3HHT B;  2PWY A;  3TCJ A;  2DIG A;  5FTK A;  5GAN 6;  5IAY A;  3ZBD A;  3JB9 G;  1VQK T;  4NS5 A;  2LW6 A;  2CZ7 B;  2JOY A;  2WSE E;  3RKY A;  3CPW A;  2C06 A;  4M7D E;  3OYE A;  3L42 A;  2JV2 A;  4M7D F;  2M16 A;  3OYI A;  2ZZD A;  2ZCF B;  2MF2 A;  4HCB A;  2QXF A;  4MDW A;  1FX7 A;  2QTX A;  3QJ6 A;  3SWN A;  5GAN 8;  1KD1 U;  3QSU A;  1WNL A;  3FIF A;  2BKD N;  4C8Q E;  2P4T A;  1LOJ A;  4OB1 B;  5CK9 A;  1UGP B;  1G3T A;  4Y28 E;  2FB7 A;  2HBP A;  2QI2 A;  3GNG A;  5DY9 A;  4C8Q F;  3JB9 D;  3L2V A;  4J7F A;  1KC8 C;  1NJI C;  1KQ2 A;  1V29 B;  2JUF A;  4RG2 A;  1Q7Y U;  1YIJ T;  2V8K A;  2CYZ B;  3QHS A;  4M75 A;  4N4H A;  1S72 A;  3LYI A;  3OSS C;  3QKJ A;  3WXM B;  1ZQ1 A;  3JCM b;  3ASK A;  2GFU A;  4M78 E;  3JCM W;  3G4S A;  2E41 A;  4OB0 B;  2E10 A;  4M77 B;  3MHX A;  4OMF B;  3S3M A;  4M78 F;  4VUB A;  5GAN e;  3S3O A;  1BI2 A;  5D6W A;  3A8O B;  4ZGJ B;  4E7K A;  3RMS A;  5LJ5 d;  5GAN 2;  2K5I A;  3L2Q A;  1M1F A;  4OVA A;  1TH7 A;  4OGC A;  3VUB A;  4M77 G;  4IUU A;  2P0K A;  4A4F A;  4IUT A;  2XD0 A;  1D3B A;  3KBG A;  4FT2 A;  5LJ3 e;  1I4K 1;  3GNF B;  2DPP B;  3JB9 I;  4E7H A;  2DD4 A;  4BI3 A;  2K5F A;  3PMI A;  4XTU A;  5FU6 C;  5FTL A;  5GAO p;  2RA2 A;  4M7A A;  3HU2 A;  3WVE B;  2K57 A;  2E65 A;  4C92 E;  3CC7 A;  2MI6 A;  2VGN A;  4NL2 A;  4OP0 A;  3TEE A;  3V8K A;  1YIT T;  4C92 F;  2MWO A;  3OS0 A;  4M77 D;  3JCM J;  5FU6 B;  3OYB A;  2O4X B;  2X35 A;  2VYT A;  2EJG A;  5GAO n;  4BDZ A;  2E1H A;  2XDB A;  3OMC A;  2XDD A;  3CCL T;  3ME9 A;  4A54 A;  5EPP A;  3JCM V;  1VQL T;  3LLR A;  4J5Y A;  2LCL A;  3PT9 A;  2PVG B;  4FT4 A;  3FJP A;  3CF2 A;  3O8V A;  5J3B A;  4J8O A;  4DA4 A;  4KO8 A;  2L89 A;  2O4X A;  3JSC A;  1B34 B;  1VQM T;  2JNG A;  2GQV A;  4RG8 A;  2DXC A;  3URG A;  5FRN A;  1I9G A;  2D6F A;  4KUL A;  5EG2 A;  3SB2 A;  3E9F A;  4XTZ A;  2DTO A;  3BW1 A;  1VQO T;  2LTO A;  4X9D A;  2QEX T;  3NFC A;  5B6C A;  3MET A;  3QYH B;  5A0D A;  1Q82 C;  3QC8 A;  2R57 A;  3RKX A;  1N8R U;  1B34 A;  2EQJ A;  2YHT A;  3HFN A;  3ZEH A;  1M1G A;  1VQ6 T;  4NL3 A;  1WQ7 A;  5GAM e;  2CZ0 B;  1M5Q 1;  3M4Y A;  2HQE A;  4OF1 A;  1BI1 A;  3OS2 A;  2YUJ A;  5FRM A;  3E19 A;  2QA4 T;  4A53 A;  2QQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...