5D6XA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6xA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6xA02
1WGSA 3L42A 4IUUA 5D6XA 2XDPA 2LVMA 1SSFA 3OQ5A 1OZ3A 3MEVA 2BUDA 2MWPA 3OS2A 4C5GA 5C0MA 3L2VA 4IKFA 2DIQA 5KE2A 3H6ZA 3FLGA 3OYNA 3OYAA 3OYBA 4QVZA 5KCOA 4N4GA 4Q5WA 3OYMA 3MP8A 4IUVA 2EFIA 2M0OA 4II1A 4FU6A 2M16A 2PQWA 2RI2A 3QKJA 3MEWA 4E7HA 3PMTA 2JZ2A 2K3YA 3PFSA 4N4IA 5CIUA 1RI0A 2IG0A 4X34A 3LH0A 3S3MA 3QIIA 2DIGA 3BDLA 4FL6A 3OYJA 3FC3A 3E9FA 4IUTA 1WJSA 2NLUA 2VYTA 2RJDA 3DB4A 4ZTJA 2RI3A 2RJFA 2DAQA 2HQXA 2XK0A 3P8HA 5FRMA 4PL6A 3LYIA 3QBYA 2G3RA 4IUQA 4PLLA 3OY9A 2RHXA 3OYHA 3UT1A 2GFUA 3OYFA 2B8AA 3FEOA 2YRVA 3OYKA 2X4YA 3EAEA 3OYEA 3CEYA 4B9XA 4GY5A 4N4HA 2BKDN 3FDRA 3SD4A 3OS1A 2X4WA 3OA6A 3L2QA 4L59A 4A4EA 3OYDA 5KCHA 2HQEA 2RHYA 3OYIA 3OMGA 2EQUA 3NTKA 3OB9A 5C6SA 5J39A 1KHCA 2K3XA 5J26A 3GOXA 1OYXA 2RI5A 3NTHA 4QQGA 4C5EA 3L2WA 3S3NA 4NS5A 2LRQA 4C5IA 4BDYA 2EQMA 2L3RA 2R57A 2RO0A 2O4XA 2F5KA 4IUPA 3M9QA 4HCZA 5M9OA 4E7KA 2LCCA 3P8DA 5D6WA 3S6WA 3Q1JA 4B9WA 2R5AA 2RHIA 2X35A 4A4GA 2L8DA 2L89A 2QQSA 5FROA 3L2UA 2R58A 4QQDA 4BACA 2EQJA 3PNWC 3QJ6A 2P0KA 3E9GA 5KE3A 3C4SA 4Z02A 4BDZA 2O4XB 3L2RA 3OYLA 4BE0A 2EKOA 4A4HA 3S3OA 2JTFA 2R5MA 3OMCA 1H3ZA 3MEUA 4BD3A 2WACA 4PLIA 4BE1A 3ZEHA 4IURA 1G5VA 4ZTFA 4BE2A 3LLRA 3MEAA 2M1HA 3O8VA 2E5QA 2RJCA 4LD6A 2EQKA 5IN1A 3OS0A 4A4FA 4OVAA 3OYCA 1MHNA 4EDUA 1WJQA 4E7LA 1OI1A 3MP6A 4RG2A 2LDMA 3DB3A 3LGFA 2MWOA 2RHUA 2FHDA 3META 2BIVA 4QW2A 1N27A 2X4XA 2QQRA 4C5HA 3PMIA 5FRNA 4E7JA 1OZ2A 3H8ZA 2GFAA 3DLMA 5D6YA 4CRIA 3NTIA 4QQ6A 4E7IA 3MP1A 3OYGA 2RHZA 3KUFA 3UWNA 2CKKA 2D9TA 4UC4A 3LX7A 3LGLA 1XNIA 2LTOA 2E6NA 3F70A 3MO8A 5KH6A 1WJRA 3ME9A 2GF7A 5IAYA 2RJEA 3ASKA
chains in the Genus database with same CATH superfamily
4RTZA 1RL2A 1E6HA 2NUPB 1YN8A 1ZSZA 3L2VA 1ZBXA 3CBMA 2BZ8A 5GAOp 1QVPA 3OYMA 1KJWA 2YUJA 2M0OA 1RLQC 4FU6A 1TG0A 2RI2A 2LP5A 1KQSP 5GANd 2MCNA 2RH2A 5HY6A 4M78B 2CP2A 2KQWA 4LD9K 5LJ5g 1QP2A 2K5LA 1K9MU 3V7SA 4QVCA 2RPNA 3FJ5A 3DB4A 1SKUB 5I11A 4OMNA 4LNPA 4LDWA 1Q7YR 5FTMA 5FTJA 2FL7A 3PVQA 3QYHB 1RUWA 5FTLA 1TS9A 2E65A 1AT1B 3OYEA 5HK3A 3C0CA 2LQNA 3A98A 1OULA 4M7AE 3A8LB 1QP3A 5LJ3j 3MKDA 1H8KA 1YWOA 4AFQC 2RHYA 1KFZA 4OMMA 3GIBA 3PIPA 3H0HA 4P5NA 2QA4T 3CCLA 4IKFA 1CKBA 2KT1A 2E1HA 2M51A 2EJGA 2ZPIB 2EW3A 2VWFA 5EQJB 3FRNA 3CC2A 4A4GA 2QG9B 2XU8A 1BK2A 2CP5A 4D6WA 5IXBA 3JB9D 3C4SA 1BIBA 5KYNA 2CREA 2QQBA 4K11A 1M2VA 2JTFA 1Y0MA 4LDYA 4PFPA 1C0MA 2KT8A 2YSQA 5GANg 4AQ7A 4ZTFA 3EG3A 4X9CA 2DA9A 4A4FA 3CCUA 1MHNA 1WJQA 2FYKA 1AWWA 3VS5A 4M77E 3CCSQ 1EFNA 3UATA 1FXXA 4OB1B 3LWHA 3CD6T 5CAIA 2D9TA 5L8RE 1YJWQ 4M75D 1RAEB 2EGAA 3ME9A 2V8JA 1PRLC 1RI9A 1ZLMA 2LVMA 2GNCA 4M77B 4XTZA 1UHCA 3JCMg 2JOYA 3OYNA 3HU2A 1XOVA 1ZX6A 2DKGA 2CH4W 5KCOA 2DM1A 2EFIA 3CC4Q 1G3TA 3RDVA 3RMQA 1CKAA 3HFOA 1ZSZB 4MZPA 2FZKB 2AK5A 1FMKA 2RQVA 4M75C 3EHQA 1UGPB 1WJSA 1IRXA 4PL6A 4OMQA 1M5Q1 2MOXA 2ESWA 1XJWB 2OTJQ 3M4GA 2WSCE 4L59A 2RNAA 2DL7A 5CCAA 1K76A 2EBPA 3RUXA 3CC7T 2E3HA 4XU3A 2J6OA 2LJ0A 4C5IA 3ZL7C 4F16A 3M9QA 4FIBA 3I5RA 5FU6B 2KRSA 2GCXA 3RKXA 3Q1JA 5GAOl 2XKOC 2F2WA 2E64A 4LUDA 1MMAA 5ERGB 2ATCB 1WYXA 3EGUA 3V7CA 1I8FA 3SEMA 2CDTA 1Y96A 2C0IA 2EKOA 5CO7A 1WLPB 2O2OA 2GBQA 3OS0A 2DD5A 1P92A 2YDLA 4E7LA 1M2VB 5GJVB 4CC7A 4ELZC 2JTMA 2YXYA 3M0TA 2KEAA 1MUZA 3VS0A 2MM0A 3CCLQ 3EG0A 3UWNA 1WLFA 3X26B 1RAGB 1XNIA 3L2ZA 3CC2Q 2RJEA 3CCRT 4HVVA 3QYGB 4KDIA 4EPCA 2DNUA 2DIQA 4J6XA 4KODA 2VGNA 3UA6A 1N9SA 4II1A 3CCVT 2D6FA 5FLXE 1KC8R 5DLQE 3CCUQ 2ED1A 2OTLA 2RK1A 4RTYA 4R56A 4ZTJA 1YI2T 2EKHA 5CD1A 3JB9J 1WXUA 4PJNA 1D09B 1JJ2A 1LVKA 1K73U 2D0NA 2F5TX 3X20B 1BU1A 3CCMT 1U5SA 2RD1A 1YFNA 4KUDK 5GAMe 1OEBA 2K6DA 4JLIA 3OB9A 1YJNA 3H0FA 3GOXA 2EQIA 2YUQA 2JS2A 4TVRA 1R0CB 5I2MA 4J9GA 3HTRA 2P4TA 2CS7A 1WHJA 2E10A 1M1KR 1U3OA 1VQ9A 1G3WA 3FPRA 4LE9A 3GBQA 4F7UA 4F7UG 2EGCA 1R7RA 2MYSA 2ZZDA 3H41A 3JCMc 1M9SA 4KGVB 1Q86C 4IURA 4BE2A 4O6JA 4KUIA 2FRYA 3OYCA 4EDUA 1GCQA 1ABOA 4L6V5 3LGFA 2KXCA 3X25B 2FHDA 2D8JA 2EGEA 4GLKA 4UC4A 1WHHA 3LGLA 5GAOr 4FT4A 4M7DA 5CCXA 2E6NA 4M7DG 5D7UA 4HCZA 1QQJA 4ME7A 4JDSA 1SEMA 1KD1R 1QVGA 1Q81R 5KE2A 2COYA 1I07A 2I2LA 3CCJA 2LT1A 2YLCA 2HNIA 1UECA 3OYBA 3M54A 2A08A 1NJIR 5EG2A 3A8HB 2KYMA 3PFSA 3FB9A 2LQWA 4ZGJB 4PJOD 2L5QA 4RTXA 2K3BA 4C92F 1M8MA 3NGPA 3AHUA 1YHQA 1VQ7T 1VQ5A 3OBWA 4CQNA 3JCMX 1YITA 1KQ2A 1MMDA 2ENMA 3JV3A 2BZXA 3OYHA 1K0SA 1NEGA 5CQXA 3TSZA 3EAEA 2HBWA 4NOYA 1TU0B 4BI3A 2ROTA 3VS6A 3OMGA 1N9RA 4JJDA 1YIJQ 1MV0B 1OOTA 1VQ8T 4PJOC 3TIWA 4OP0A 1I1JA 3KXTA 4HVUA 3UPUA 1NM7A 3VS1A 1UTIA 1SHFA 2PVOB 4F7UE 1OX9A 2LX7A 3CMEQ 4JPBW 3DKMA 1K4US 1KIKA 1Y07A 1X2KA 1W2BA 3M0SA 2HQHA 2XIDA 2OTLQ 5EPPA 3HRTA 3PVLA 3I55A 3J7AF 4DQ2A 2JM9A 2VXEA 3G6ET 1M1GA 2YUPA 2KR3A 3LLRA 3MEAA 2SEMA 1ZA1B 2NUTA 4F7UB 4LD6A 4ORZA 5GAMh 2Z0WA 3FJPA 3QXEB 2CYZB 3OW2A 1QCNA 1ZUUA 2P0PA 1IXDA 1D0ZA 5AYFA 3OS5A 1YJNQ 3QHSA 4M7DE 2LZ6B 1Y57A 1T3SA 4DEYA 1M90R 4B6MA 1S72A 4R0KA 2CZ0B 4RMOA 1WXBA 1M3CA 3QSUA 4KO8A 1HD3A 1VYVA 1VQ9Q 2PNIA 4AFSC 3G4ST 3A1PA 3CXCA 5GAOq 3O5ZA 2AKKA 2RMOA 4M7DB 1D1BA 1QCFA 3I9QA 1WDXA 4C8QA 2H8HA 4C8QG 1K9AA 2M16A 1PD0A 4E7HA 2JZ2A 2CT3A 1T3LA 5LJ3f 2Y4XA 3BDLA 4J9CA 2XICA 1D1AA 3VV0A 1Q82U 2Q1DX 1PCXA 3HP9A 3ZFJA 2KAFA 1MNDA 1K9MC 2RI3A 2DERA 5FRMA 1VA7A 1QLYA 3NHNA 3FEOA 3URGA 2GQIA 2KI7A 2X4YA 2GQVA 1WNLA 2EJFA 2JXBA 2CUDA 2MMPA 3HU1A 5KCHA 1WFWA 2VC8A 1NJIU 2Y4YA 1UDLA 1MGQA 4J7IA 1OYXA 2HKNA 3L2WA 4QQGA 2DXTA 5A2QE 3CCJQ 2R57A 5M9OA 1BIAA 5CCBA 2K7AA 4KBMB 1BB9A 2DBMA 2L89A 4Y28E 4KULA 3PNWC 1S72T 4Z88A 4ELYC 5LJ5j 4BE0A 5FU7C 3OMCA 1YHQQ 3VS3A 1VQ5Q 1Z9ZA 2PWYA 1YITQ 4JJNK 2AKLA 3ZBDA 3JCMP 4M7AG 1N8RR 4LDVA 3JCMV 1NLPC 4A53A 4Y92A 2J6FA 4HKEA 1LNXA 3INZA 4M78F 5IXFA 1R77A 4M4ZA 3NTIA 4QQ6A 4HT9A 1HXDA 3MP1A 1I4K1 4AFZC 2CKKA 5LJ5d 1G2BA 4Z8AA 1D0XA 4DBHA 1X43A 1HSQA 3M0UA 2FZCB 1JJ2P 4DEXA 2HBPA 3P8BB 4C8QE 7AT1B 3MEVA 4Y91A 4PFZA 3I55Q 2QDYB 4JRPA 1X69A 2V8IA 1ABQA 1W4SA 4FSSA 4N4GA 4F04B 5GANj 4XTXA 5GAMg 3UA7A 5CK9A 2DVJA 4A54A 1DJ7B 4C0DB 2K57A 3LH0A 5J3BA 1M90U 3QIIA 2RQWA 1YJ9A 4FYWB 1OX8A 3CCEA 4C8QB 3C94A 3ER0A 3RKYA 4KLNA 2RHXA 2L3QA 2VVKA 2XI9A 1UE9A 4GY5A 1S72Q 2X3XD 3CCST 1Z9QA 1PC0A 3OA6A 1IGQA 1RAFB 1VYTA 4EMHA 2C0TA 2BE7D 3S3NA 1YJWT 2LRQA 4LDUA 4RTWA 1MNEA 3RERA 2AZSA 4CC3A 4ZN1A 2VXFA 4JS5A 4J9DA 3CQTA 2QQAA 2LQ8A 1QVFA 1FMVA 2B86A 4CI0C 1K8AR 4FYXB 3CC4T 3JAME 1QVGP 4PLIA 2CH4A 3M59A 4M77F 4J9IA 4WF2A 5GMKe 3SWNA 4BUGA 2DF6A 3JCMd 1PWTA 4XU1A 2LJ1A 1RADB 1BI0A 4QW2A 4M7AB 3EH1A 5DM7R 1QMCA 4J83A 2QQ9A 2OTJT 1BI2A 2EJ9A 2FPFA 1B34A 1YJ9T 4XU0A 2BTTA 3BW1A 1N6AA 4VUBA 1VQOA 2DJQA 3ASKA 1UGVA 2BZYA 2JUFA 2YRDA 1SSFA 1N8RU 5GAN7 2JMAA 1NZ9A 4EMKC 4C5GA 5C0MA 2JTEA 2YRCA 2MPXC 2KMTA 4XU2A 4Q5WA 2K79A 1QDNA 5GMKi 1T0HA 3DLLA 3TCJA 1RI0A 4FL6A 3OYJA 2M9UA 5IHNA 3SFMA 1D3BA 2CP3A 2XK0A 4J9BA 3TEEA 1JRIA 5GAOn 2QK0A 3GNFB 5GAN8 1UJ0A 2X9HA 2BKDN 3OYYA 1K73C 3M4YA 3QZ5B 4LXCA 3OW2P 3CCLT 4E6RA 4AMCA 2QI2A 2RI5A 2ZPHB 1FYNA 2DXCA 4A4KA 2EQMA 2YT6A 3CC2T 2FRWA 4OMLA 3QPHA 4XTUA 2DL8A 2OI3A 3J80E 3CF2A 1EX4A 1X01A 5FROA 2XDBA 2XDDA 3CPWP 3C95A 4RG8A 3GNGA 4L5GA 1YJ9Q 3OYLA 3CCEQ 3QUIA 3S3OA 2R5MA 2HDAA 4ZNXA 2DMOA 4BD3A 4J6WA 3CCUT 3EFRA 1VQPA 3LW5E 3LWIA 1OI1A 1Y71A 3DB3A 2KVQG 1U06A 3EGDA 5IHKA 4PJMA 5CKHA 2K2VA 3X28B 1Q7YU 4C92D 3SWNB 1KQ1A 1NPRA 3H8ZA 2DX1A 1M27C 4PK4A 4CRIA 4E7IA 4DBRA 4O5VA 1RAAB 3BFMA 1K8AU 3L1AA 2HL3A 1R0BG 4QKUA 3PIOA 5DYGA 2GF7A 5B6CA 1H3HA 3JB9I 3L42A 4IUUA 3R6OA 1NEBA 1I5OB 4C0FA 4XAXB 2BUDA 4EMKA 5GMKh 3OYAA 2FEIA 1ZC1A 3PT9A 5KYYA 3ZGZA 3EH2A 4J9HA 2PUOB 3JRZA 4HA8A 2L3PA 4C92C 2DL5A 3JB9G 2B25A 3M0PA 4X34A 3VJPA 2KSSA 2ZGWA 3S3MA 2HQXA 1YIJA 3VS7A 2K4YA 3J81E 1O75A 5I2SA 4B9XA 2ZCFB 2O31A 3CMEA 4NL2A 4PJJA 1VQOQ 1D3BB 2RQRA 1VQ4A 2OAWA 2MIOA 1KHIA 4HT8A 4PKCC 2CUBA 2P0QA 3VS2A 4NS5A 4M75A 2RB6A 4M75G 3OSSC 2L3RA 2DO3A 1X2QA 1IHWA 2KE9A 3HFNA 2R5AA 2X35A 2YVLA 2E12A 4DOVA 2EQJA 1U1SA 1WZOA 4DOWA 2XMFA 3E9GA 1I5LA 1C6VX 4ARIA 1JB0E 5DLOA 2QEXA 2NUZA 4OVAA 4XTWA 4BB7A 2KRNA 2FZGB 2LDMA 1IB8A 2BE9B 3T9NA 3H9NA 4E7JA 1QKXA 1MV3A 5A0GA 3EGDB 1VQNA 2DEQA 3JCMJ 5KH6A 1YIJT 1OQKA 4RV0A 3UF4A 5I22A 2JW4A 2XDPA 3CMAA 1AWXA 2ROLA 1Y96B 1H92A 1G3SA 2EYZA 3CMET 1E7OA 4OB2B 2V26A 1MMGA 1VIFA 1CSKA 2LNVA 3SDZA 3LHDA 1VQPQ 2V8KA 4C92A 3PGGA 2LC4A 2OTLT 3PMTA 1QW1A 1AZGB 1S3SA 2NYSA 2PTKA 2DIGA 3N5BB 5KYYB 1UHFA 2LJ3A 3JCMW 4WCIA 3HHTB 1KQSA 1Q82C 2EYQA 4KRTA 4Z89A 2ZAEA 1YWPA 1X75C 2C0OA 4PFOA 3OYKA 1YBYA 2AT1B 3FDRA 1I9GA 2F69A 2EAYA 1KD1C 1Q81C 2I0NA 3HRSA 1YJNT 4M75E 2QASA 2AZVA 5CKFA 1RAHB 5C6SA 4EMGA 1KHCA 1NJIC 4JZ4A 2EVRA 4C5EA 3PE0A 5CVIA 1AVZC 4KH1B 2IIMA 1VIEA 4M78D 2K5IA 1VQ9T 4JRQA 2EYWA 3JCMb 1RABB 1IHVA 4J5YA 2R58A 2XHCA 4HCKA 4M75B 1PM3A 3V8JA 2DBKA 4OGCA 2DL3A 4FCYA 4C0ZA 3ZEHA 1AZEA 1KC8U 1NBEB 3O8VA 2EQKA 1B3QA 4JRIA 2M0YA 2QYZA 2DTHA 4M7DF 2DRMA 4M78C 1VQKA 2NWMA 1UJYA 2DFUA 2E4HA 1VQ4Q 3QG1A 3SB2A 2X4XA 2EIFA 3GPLA 1HK9A 1C1AA 1PKTA 4DBFA 6AT1B 2KGTA 2MI6A 2E6ZA 1NPPA 5GANf 4IIMA 1CR5A 2Q1CX 4RCBA 1UB4A 2QDLA 3MO8A 3QQ7A 2YWWA 1GFCA 1WGSA 1LPLA 2W0ZA 5GMKl 5CR2A 3CCJT 2C06A 4C92E 2KNBB 4J7FA 2JV2A 2EYXA 3H6ZA 2CT4A 2DEUA 2CP7A 1GCPA 4LDXA 4QVZA 2CZ6B 1VQMA 1M1KU 2QEXQ 4FYYB 5CKDA 1WHGA 2COWA 3HL8A 1OPKA 3TVTA 1X27A 2IG0A 2HSPA 5DYIA 1YHQT 5LJ3e 1VQ5T 1M90C 1YITT 1W70A 2VYTA 2RJFA 3P8HA 3VKIA 1G8XA 3JCMf 5GAN4 2CP6A 3OY9A 2KK4A 2ED0A 4KH0B 5GAOm 1VQNQ 5GLFA 2Q1AX 4M77D 5FWCA 2X4WA 4X1VA 3D7SB 2L2PA 1PNJA 4QT7A 3CMAQ 1VQ6A 1O9SA 4J6YA 1PRMC 3HU3A 2RK2A 2Y90A 4IUPA 1W6XA 4AS1A 5D6WA 1WA7A 2L0AA 4B9WA 2DVEA 5GAMj 8ATCB 2KXDA 1KD1U 1Q81U 3BE3A 3I55T 2LT4A 2P0KA 2K9GA 3NPFA 2WSFE 4YTLA 9ATCB 4M77C 2NUPA 3VRYA 4HCCA 1K9MR 1SSHA 5FW9A 3QO3A 2OJ2A 3CCQA 4PJOA 4PJOG 3X24B 3LGAA 1TSFA 2DD4A 2MAMA 2P4RA 4FW1A 4M78A 5GAN2 1JJ2S 3I56A 1VQLA 1OV3A 2JNGA 2QAZA 1U1TA 4FYVB 3TREA 1CZ4A 1ZBJA 3QQ8A 2QQRA 5GAMd 3GLXA 2DJZA 5GAN3 1WI7A 4C8QF 3G71A 1V1CA 2LCLA 3LX7A 1GBRA 4ANJA 2J06A 2RM4A 5IAYA 5D6XA 2AIRB 3BDUA 3CBPA 1WIEA 1N8RC 2W10A 4HCBA 1AOJA 2RF0A 3H0IA 2NUTB 3M56A 3QKJA 3IQLA 5FU6C 4X9DA 3E1SA 2SRCA 2HAXA 1VQKQ 3WXMB 2VV5A 3MB5A 3RESA 2DAQA 3C12A 3QBYA 4J9FA 2QGGA 1VOMA 4JRKA 2MF2A 2VUBA 5DY9A 4IIOA 2HL5C 1AWJA 2DRKA 4ARCA 4N0AC 2F2XA 2OAUA 5J39A 1J3TA 2A0FB 1QKWA 1QVGS 3TQ7P 2HZYA 2KYBA 2Q19X 2QA4A 2O4XA 2F5KA 1HJDA 1VQMQ 4M7AF 3QZ9B 5LJ3h 2KRMA 2RHIA 2L8DA 2LCSA 1M30A 4PJOE 2DTOA 3G71T 1ZHIA 3WVEB 2CZ7B 3M5AA 4M78E 2LQKA 1FX7A 4RTUA 2E5QA 5A0LA 3NMZC 1WPYA 4JUVA 4E2FB 5LL6S 4PJOB 1BBZA 2HD0A 3TU4K 1Q7YC 1VQ6Q 2GFAA 3DLMA 2ABLA 2RHZA 4OGEA 1NE8A 1NG2A 4MDXA 2DILA 4BI4A 3CD6A 1PD1A 2ZPGB 1ZSGA 1K8AC 2OX7A 2K5FA 1W2BS 4ESRA 2J05A 4LUEA 1OZ3A 1UEBA 1AWOA 4E7ZA 2MWPA 3OS2A 2JN0A 2FO0A 2COZA 1KSWA 3LH5A 4MMLA 1ACMB 3CCQQ 2FVUA 2LNHB 1TOVA 2G6FX 2P84A 2F1LA 3CCET 3I56Q 1XTDA 1VQLQ 2J6KA 2KROA 2DYBA 4NL3A 1BYMA 2RJDA 1Y7XA 3OW2S 1YP5A 5IH2A 3LYIA 4IUQA 4PLLA 2QTXA 2H3JA 2GFUA 5GAN6 2O9SA 4N4HA 3G71Q 3CPWS 2HQEA 2X4JA 4N0AA 5LJ3d 3U23A 1GL5A 5FWBA 2EQUA 2K3XA 4JZ3A 2M02A 3CXCS 1W2BP 3CC7A 4JJBA 1JO8A 2DPPB 2VKNA 1TWBA 3RKWA 4E7KA 3FPTA 1PG5B 1WHMA 5GMKm 2QXFA 1SG5A 2VASA 4AFUC 3UDCA 2V1QA 2IVWA 1SPKA 1H641 4BDZA 2O4XB 3L2RA 1GBQA 4KGZB 2E5KA 5HCKA 1D0YA 3EHRA 3TSWA 4AT1B 3EG1A 2LW6A 2CP0A 2FPEA 3REBB 3RIRA 4BI8B 1GXIE 1U8RA 3VYHB 1K73R 2YHTA 2MWOA 1IGUA 4CC4B 2YLBA 1BKBA 5FRNA 2DTIA 2GTOA 1LCKA 1SRLA 3G7ZA 3RBBB 3OYGA 3CXCP 1VQOT 2QA4Q 1RAIB 5LJ3g 4JJCA 3HKSA 3QDFA 4J9EA 1YCSB 1KK7A 3PTAA 3QWXX 2RN8A 2HSEB 3QWYA 2RA2A 3FPUA 1EIFA 3CCRA 3I35A 5FU7B 3SHWA 1XQHA 1BI3A 2K2MA 4RTTA 2PQWA 3MEWA 1B07A 3CCVA 3M0RA 2A7YA 1VUBA 5CQYA 3VU3C 2XD0A 4OF1A 1UFFA 1YI2A 1B34B 3OYFA 2B8AA 2YRVA 3CEYA 4E7SA 4KGXB 1JBMA 3OBYA 3CD6Q 1FWZA 1SRMA 2PJHB 2X3WD 2FG0A 1IREB 4FW2A 4M7DD 3CCMA 5ECAA 2JMCA 1OU9A 5J26A 2DLPA 3FIFA 4HXJA 4BDYA 2KY9A 1GCQC 4ZN3A 3THKA 3KBGA 5KYUA 2PUKB 3ZJTA 3L2UA 1V76A 1OPLA 1AHJB 3QJ6A 1ZUYA 2X51A 3RR6A 1SHGA 1HYOA 4XTYA 1NYFA 4BY6C 4A4HA 1VQPT 1K0XA 1EZZB 2DZCA 4M7DC 5L23A 1TXQA 2Q18X 1V29B 1KC8C 4A63B 3WVDB 2FPDA 3META 1ARKA 1Q95G 4C5HA 2QTVA 2E3IA 1OZ2A 4MZMA 4OMOA 1MMNA 5GMKj 3CC7Q 1F1BB 2A28A 1W1FA 1TH7A 1R8OB 1B7TA 3JB9F 5KYWA 1GFDA 1YCYA 2DYIA 3VRZA 4OMFB 2JM8A 1QVFS 1GRIA 2D8HA 2HEQA 2MK5A 2JJ9A 3OSVA 1FMWA 3I5SA 2KDSA 3M55A 2V1RA 4MMKA 2EWNA 1M1KC 2F2VA 2K3YA 5AT1B 4ATOA 1UUEA 1SF9A 4FM4B 4DBQA 3QC8A 4J8OA 2NLUA 4MZTA 3MCAB 4ZGDB 3REAB 3VYGA 1VQ7A 2GGRA 4M75F 2PZ1A 2MM2A 4RKUE 2CSIA 4F17A 1Q86R 3JB9H 1TTHB 5GAMf 1VQ4T 2O01E 1LOJA 1RACB 4C92G 1X6OA 3OYIA 1RLPC 3NTKA 4EMKB 3CCRQ 3NTHA 2HKQB 1QVFP 4V2SA 5LJ5e 1VQ8A 3A8MB 1M8VA 2A3LA 3HRUA 1JEGA 3V8LA 3ZJUA 1QCOA 1M3BA 3HSBA 3NFCA 1OU8A 4C8QD 3CCVQ 4DA4A 1G3YA 4BACA 1NYGA 5KE3A 4OMPA 1JU5C 2DXBA 4E47A 5GJWB 2EYYA 4PNOA 2QEXT 2O88A 1H3ZA 1Q82R 4F7UF 2WACA 4D8DA 4RUGA 5KYUB 1X6GA 3CPFA 1ZA2B 5LJ5f 1YI2Q 3EFOA 2LMJA 3G6EA 1N5ZA 1WXTA 1TUDA 2AHJB 2CZ1B 4C0GA 1UGSB 4C0DC 4RG2A 3JSCA 5IT9E 1WX6A 1N27A 4JLGA 4C8QC 3CCMQ 1QCSA 2XG8D 3PMIA 2J7IA 2FB7A 1VQNT 2L3SA 5D6YA 3VUBA 1WQWA 3KUFA 3BQBA 2D0QB 2CGHA 4CC2A 5GANe 2YUOA 3F70A 3MPUB 3CMAT 2JT4A 3E19A 2DZ9A 4OB0B 3EG2A 3OQ5A 1JQQA 2IPOB 3G4SA 3MJXA 3VUZA 1M3AA 3A5ZB 5KYWB 3MP8A 4XK8E 1I81A 3EG9A 1M2OA 5CIUA 3V8KA 4M7AD 1UGRB 5A0DA 3JCMQ 3M53A 1T0JA 2PVDB 2JVVA 3UT1A 3JCMe 1TUCA 5CKBA 1PSEA 2A37A 3OS1A 3EGXA 2ZPFB 4XQ3A 2CSQA 4EIKA 3OYDA 1I0CA 4RTVA 4AG2C 1IO6A 4M7AC 1NLOC 2DL4A 3RNJA 1BI1A 2PVGB 2RO0A 1PKSA 1KG1A 4MDWA 1AEYA 4C92B 2LCCA 3AT1B 3P8DA 1QWFA 5KYXA 2DETA 2ZPEB 1UG1A 2HCKA 2QQSA 2E41A 4Z02A 1WQ7A 1Q86U 3KFVA 3MEUA 2VB6A 3CPWA 1G5VA 4LN2A 2VGMA 1QWEA 2M1HA 1VQ7Q 4AG1C 5IN1A 2JS0A 1E32A 1VQKT 1D1CA 3E2UA 4BY6B 3MHXA 3MP6A 5LJ5h 2RHUA 3RMSA 5C1BA 2BIVA 4JS4A 1LJOA 3EFOB 3R6NA 3EFSA 1M1FA 2YUNA 1YNZA 1VQ8Q 4QVDA 1WHLA 2D1XA 2LTOA 4R55A 1WJRA 4A4EA 2RQUA 4XTVA 1ZSZC 4M78G 1JXMA 3FLGA 1VQMT 5HKCA 2DK3A 2EPDA 2ECZA 4D8KA 1ZUKA 1O54A 3VS4A 4IUVA 3G1JA 2RQTA 3G6EQ 5FTKA 4N4IA 2HMAA 1CZ5A 3FC3A 1JXOA 2DXUA 3E9FA 4IUTA 4RCCA 4OB3B 1BCMA 2KBTA 3EG9B 5I21A 2G3RA 2ZPBB 1S1NA 5GANh 4WTOB 1G83A 4F14A 1K1ZA 3A8OB 3SD4A 1A0NB 5FTNA 3L2QA 4FT2A 4ZGEB 3CCSA 3QJYA 3CBOA 1VQ6T 3HPWA 4GLMA 1PHTA 4M7AA 3GP8A 1TUGB 3G4SQ 3SWNC 3M57A 3EGXB 1IZ6A 4GBQA 4PJOF 1YJWA 4FSXA 3S6WA 3ULRB 3QDRB 4HVWA 1WHKA 5GAN5 3ZJVA 2LX9A 1E6GA 1X6BA 4QQDA 4PJLA 2QGFB 2E70A 3A8GB 3JCMh 2H3EB 3CCQT 4KDLA 2A36A 2GTJA 8AT1B 1KQSS 5KYXB 4BE1A 3CC4A 1ZQ1A 1VYUA 2RJCA 4KT0E 3I56T 1VQLT 1PSFA 2DE0X 3GF5A 3V7RA 1UGQB 3BY7A 5C18A 5EC7A 5HK0A 3M58A 4M77A 4M77G 1BCOA 2O9VA 5CKEA 2PU9B 2OTJA 3QWZA 1AD5A 5IHIA 2WSEE 3M0QA 1M4ZA
chains in the Genus database with same CATH topology
1RL2A 3CXCA 2XDPA 5GAOq 3CMAA 2RA2A 3FPUA 1EIFA 3CCRA 1Y96B 3L2VA 5FU7B 1G3SA 1ZBXA 3CMET 4MDXA 1XQHA 4OB2B 1BI3A 3CBMA 5GAOp 1QVPA 1VIFA 4M7DB 2LNVA 3OYMA 3SDZA 4C8QA 2YUJA 2M0OA 4C8QG 3LHDA 4FU6A 2M16A 2PQWA 2RI2A 2V8KA 3PGGA 3MEWA 4C92A 2LC4A 4E7HA 5GANd 3PMTA 1QW1A 2JZ2A 2OTLT 2RH2A 5HY6A 3CCVA 4M78B 1S3SA 2A7YA 2KQWA 5LJ3f 1VUBA 5CQYA 2DIGA 2Y4XA 3BDLA 3N5BB 2XICA 5LJ5g 4LD9K 1QP2A 2K5LA 3JCMW 1K9MU 3V7SA 3VV0A 4QVCA 3VU3C 3HP9A 1Q82U 3ZFJA 3HHTB 2Q1DX 1KQSA 2KAFA 3DB4A 1K9MC 2RI3A 1Q82C 2EYQA 2XD0A 4OF1A 5FTMA 4LDWA 5FRMA 5FTJA 2FL7A 1YI2A 1B34B 1X75C 3QYHB 3OYFA 5FTLA 2B8AA 3FEOA 2E65A 2YRVA 3URGA 1YBYA 3OYKA 2X4YA 3OYEA 3CEYA 5HK3A 2GQVA 1WNLA 2EJFA 1JBMA 3FDRA 2F69A 2EAYA 1KD1C 1Q81C 4M7AE 3A8LB 1QP3A 3OBYA 1I9GA 2MMPA 1FWZA 3HRSA 5LJ3j 3HU1A 1YJNT 4M75E 5KCHA 2VC8A 1NJIU 2PJHB 2RHYA 2Y4YA 1IREB 5CKFA 4M7DD 5C6SA 3CCMA 1MGQA 4EMGA 1KHCA 4J7IA 1NJIC 3GIBA 3PIPA 5J26A 1OYXA 3FIFA 4C5EA 4P5NA 4QQGA 5CVIA 3L2WA 2QA4T 2DXTA 3CCLA 1VIEA 5A2QE 4BDYA 4M78D 2R57A 4IKFA 2K5IA 2KY9A 1BIAA 2E1HA 4ZN3A 5M9OA 4JRQA 1VQ9T 5CCBA 2EJGA 2ZPIB 3JCMb 3KBGA 5EQJB 3FRNA 3CC2A 2PUKB 4KBMB 4A4GA 3ZJTA 2XU8A 4Y28E 2L89A 4J5YA 3L2UA 2R58A 2XHCA 4KULA 4D6WA 1AHJB 3PNWC 3QJ6A 4M75B 3JB9D 1S72T 3V8JA 3C4SA 1BIBA 4XTYA 2QQBA 4ELYC 5LJ5j 4BE0A 4OGCA 5FU7C 4BY6C 4A4HA 2JTFA 3OMCA 1VQPT 4LDYA 2PWYA 5GANg 4C0ZA 3ZEHA 2DZCA 4JJNK 4ZTFA 4M7DC 2Q18X 4AQ7A 3ZBDA 1KC8U 3JCMP 4M7AG 3O8VA 2EQKA 4X9CA 1V29B 4JRIA 4LDVA 4A4FA 3CCUA 1MHNA 1KC8C 3JCMV 2DTHA 1WJQA 2FYKA 4M7DF 4M78C 4A53A 1VQKA 4M77E 3WVDB 3META 4HKEA 1LNXA 3INZA 2X4XA 2EIFA 3QG1A 1FXXA 4M78F 3SB2A 4C5HA 1HK9A 1OZ2A 3GPLA 4MZMA 4OB1B 3LWHA 3NTIA 4QQ6A 2MI6A 5GMKj 4HT9A 2E6ZA 1HXDA 3MP1A 3CD6T 1I4K1 1NPPA 5CAIA 2CKKA 5LJ5d 2D9TA 5GANf 5L8RE 1TH7A 1R8OB 4M75D 1CR5A 3JB9F 2Q1CX 4RCBA 1UB4A 3MO8A 3QQ7A 1YCYA 3ME9A 2HBPA 2V8JA 4OMFB 1WGSA 1QVFS 3OSVA 2LVMA 3P8BB 4M77B 4XTZA 4C8QE 5GMKl 5CR2A 2KDSA 3M55A 3MEVA 3JCMg 4C92E 3CCJT 4Y91A 2C06A 2JOYA 4J7FA 2JV2A 3H6ZA 3OYNA 2QDYB 4JRPA 2V8IA 3HU2A 1XOVA 2DKGA 4LDXA 1W4SA 4QVZA 4N4GA 5KCOA 2CZ6B 1VQMA 4MMKA 1M1KU 2EFIA 2EWNA 5GANj 1G3TA 3RMQA 4XTXA 5CKDA 5GAMg 1M1KC 2K3YA 3HL8A 5CK9A 4A54A 3HFOA 4MZPA 2IG0A 4ATOA 1DJ7B 4C0DB 2K57A 3LH0A 5DYIA 5J3BA 1M90U 4FM4B 3QIIA 1YHQT 1YJ9A 5LJ3e 1VQ5T 4M75C 1M90C 3QC8A 1YITT 1UGPB 1WJSA 4J8OA 3CCEA 2NLUA 2VYTA 3MCAB 4MZTA 4C8QB 2RJFA 3C94A 3ER0A 3P8HA 3VKIA 4PL6A 3RKYA 3JCMf 4ZGDB 5GAN4 4KLNA 3OY9A 2RHXA 3VYGA 2KK4A 1M5Q1 4M75F 1VQ7A 2XI9A 2MM2A 5GAOm 4RKUE 4GY5A 5GLFA 2Q1AX 3CCST 3M4GA 4M77D 2WSCE 2X4WA 3OA6A 3JB9H 5GAMf 1VQ4T 2O01E 4L59A 1LOJA 5CCAA 4C92G 1X6OA 3OYIA 3NTKA 4EMKB 3RUXA 3CC7T 4EMHA 4XU3A 1VQ6A 1O9SA 3NTHA 3S3NA 4J6YA 4V2SA 5LJ5e 1YJWT 1VQ8A 2LRQA 4C5IA 4LDUA 3HU3A 3A8MB 2RK2A 2Y90A 3RERA 1M8VA 4IUPA 4ZN1A 3M9QA 2A3LA 2VXFA 4JS5A 3HRUA 4AS1A 4FIBA 3V8LA 2QQAA 2LQ8A 5D6WA 3ZJUA 5FU6B 2GCXA 3RKXA 3Q1JA 1QVFA 3HSBA 4B9WA 2DVEA 3NFCA 5GAMj 2XKOC 5GAOl 4C8QD 4DA4A 2E64A 1KD1U 1G3YA 1Q81U 5ERGB 3I55T 4BACA 2LT4A 3V7CA 1I8FA 2P0KA 5KE3A 2WSFE 4YTLA 4M77C 2DXBA 4E47A 1Y96A 4CI0C 2QEXT 2EKOA 4PNOA 4HCCA 3CC4T 1H3ZA 3JAME 5CO7A 4F7UF 3QO3A 2WACA 4PLIA 3CCQA 3M59A 4PJOA 3CPFA 4M77F 4PJOG 5LJ5f 3X24B 4WF2A 3LGAA 5GMKe 2DD4A 3SWNA 3OS0A 2MAMA 2DD5A 1P92A 4BUGA 3G6EA 2AHJB 3JCMd 2CZ1B 4M78A 4C0GA 5GAN2 4E7LA 1UGSB 4C0DC 1JJ2S 4RG2A 4XU1A 3JSCA 3I56A 1VQLA 2JNGA 1CZ4A 3TREA 1U1TA 5CCXA 5IT9E 4ELZC 1BI0A 2JTMA 4QW2A 4M7AB 1N27A 5DM7R 4J83A 4JLGA 2QQRA 4C8QC 1QCSA 2XG8D 3PMIA 3GLXA 2QQ9A 5GAMd 2FB7A 2DJZA 1VQNT 2OTJT 2MM0A 5D6YA 1BI2A 5GAN3 2EJ9A 1B34A 1YJ9T 3VUBA 1WQWA 3KUFA 4XU0A 3UWNA 1WLFA 3BQBA 4C8QF 3G71A 3BW1A 2D0QB 2LCLA 3LX7A 1N6AA 2CGHA 4VUBA 1XNIA 3X26B 5GANe 1VQOA 3F70A 3L2ZA 3CMAT 2RM4A 2RJEA 3CCRT 5IAYA 3ASKA 3E19A 2JUFA 5D6XA 2DZ9A 4OB0B 1SSFA 1N8RU 3QYGB 5GAN7 4KDIA 3BDUA 3OQ5A 3CBPA 1NZ9A 4EMKC 3G4SA 4C5GA 4EPCA 5C0MA 1N8RC 2DIQA 3VUZA 3A5ZB 4J6XA 4HCBA 4KODA 2VGNA 1N9SA 2KMTA 4XU2A 4Q5WA 3MP8A 1QDNA 4II1A 3CCVT 3M56A 4XK8E 5GMKi 2D6FA 3QKJA 3DLLA 1I81A 3TCJA 5FLXE 5CIUA 5DLQE 5FU6C 3V8KA 1RI0A 4X9DA 4M7AD 3E1SA 1UGRB 2OTLA 2HAXA 2RK1A 5A0DA 4FL6A 3OYJA 2M9UA 4R56A 3WXMB 3JCMQ 2VV5A 3M53A 3MB5A 4ZTJA 3RESA 3SFMA 1YI2T 2DAQA 1D3BA 3C12A 2XK0A 5CD1A 3TEEA 3JB9J 2PVDB 3QBYA 2JVVA 3UT1A 3JCMe 1JRIA 5CKBA 5GAOn 3GNFB 4JRKA 2MF2A 2VUBA 1PSEA 5DY9A 5GAN8 1JJ2A 2BKDN 3OS1A 1K73U 3OYYA 2ZPFB 4XQ3A 2F5TX 3X20B 4ARCA 1K73C 3OYDA 3CCMT 2RD1A 3M4YA 4KUDK 5GAMe 4N0AC 4JLIA 2OAUA 3OB9A 3QZ5B 5J39A 1YJNA 3CCLT 4M7AC 3GOXA 2QI2A 2RI5A 2ZPHB 1QVGS 2DXCA 4A4KA 1BI1A 2PVGB 2Q19X 2EQMA 4TVRA 2QA4A 2RO0A 2O4XA 2F5KA 5I2MA 4MDWA 2P4TA 4C92B 3CC2T 2LCCA 4M7AF 2CS7A 3QZ9B 3P8DA 2E10A 3QPHA 5LJ3h 4XTUA 1VQ9A 1G3WA 2RHIA 3J80E 3CF2A 2ZPEB 1X01A 2L8DA 3FPRA 5FROA 2QQSA 4F7UA 2XDBA 2E41A 4F7UG 2XDDA 1R7RA 4PJOE 3C95A 4RG8A 2DTOA 2ZZDA 3GNGA 3G71T 4L5GA 4Z02A 1WQ7A 3JCMc 3OYLA 1M9SA 1ZHIA 3QUIA 2CZ7B 2R5MA 3M5AA 3WVEB 3S3OA 1Q86U 3MEUA 4M78E 2LQKA 4J6WA 4BD3A 1FX7A 1Q86C 3CPWA 4IURA 1G5VA 3CCUT 3EFRA 2VGMA 4BE2A 2M1HA 4O6JA 1VQPA 4KUIA 2E5QA 3LW5E 5IN1A 3LWIA 5A0LA 3OYCA 1WPYA 1VQKT 4JUVA 1E32A 4EDUA 4BY6B 3MHXA 1OI1A 3MP6A 1Y71A 3DB3A 2KVQG 4L6V5 5LL6S 3LGFA 5LJ5h 3X25B 2RHUA 3RMSA 2FHDA 5C1BA 5CKHA 2K2VA 2BIVA 3X28B 4JS4A 1LJOA 1Q7YU 4PJOB 2HD0A 4C92D 3SWNB 1KQ1A 1NPRA 3H8ZA 3TU4K 1Q7YC 2GFAA 3DLMA 3EFSA 4CRIA 4E7IA 1M1FA 4O5VA 3BFMA 2RHZA 4QVDA 4OGEA 1NE8A 4GLKA 4UC4A 3LGLA 4BI4A 5GAOr 4FT4A 3L1AA 2LTOA 2E6NA 2ZPGB 4R55A 1K8AU 3PIOA 3CD6A 4M7DA 4M7DG 5DYGA 1K8AC 1WJRA 4HCZA 2GF7A 4A4EA 2K5FA 1W2BS 5B6CA 3JB9I 3L42A 4IUUA 3R6OA 4JDSA 4ME7A 4XTVA 1KG1A 1OZ3A 1UEBA 4C0FA 4XAXB 2BUDA 2MWPA 4M78G 4EMKA 3OS2A 1QVGA 2JN0A 5KE2A 5GMKh 3FLGA 3OYAA 1VQMT 3PT9A 5HKCA 1ZC1A 2I2LA 2DK3A 3CCJA 2LT1A 2YLCA 3ZGZA 2HNIA 3OYBA 3M54A 1O54A 4MMLA 4IUVA 2PUOB 2FVUA 3JRZA 4HA8A 5EG2A 4C92C 3JB9G 2B25A 3A8HB 5FTKA 3PFSA 4N4IA 3FB9A 4X34A 3VJPA 4ZGJB 2KSSA 2ZGWA 4PJOD 1CZ5A 2L5QA 3S3MA 3CCET 3FC3A 1XTDA 4C92F 2DXUA 3E9FA 4IUTA 4NL3A 3AHUA 1BYMA 2RJDA 4RCCA 1Y7XA 4OB3B 3OW2S 1YHQA 1VQ7T 3OBWA 1VQ5A 4CQNA 2HQXA 3JCMX 1YITA 1KQ2A 5I21A 3LYIA 1YIJA 2G3RA 2ZPBB 4IUQA 2QTXA 4PLLA 5GANh 3OYHA 2H3JA 2GFUA 5CQXA 2K4YA 5GAN6 3J81E 1O75A 5I2SA 3EAEA 3A8OB 4B9XA 4NOYA 2ZCFB 4N4HA 3SD4A 3CMEA 5FTNA 4NL2A 3L2QA 4FT2A 4ZGEB 3CCSA 1D3BB 3QJYA 3CBOA 4BI3A 3CPWS 2HQEA 2X4JA 4N0AA 5LJ3d 1VQ6T 3HPWA 1VQ4A 3OMGA 1N9RA 2EQUA 4PJOC 2K3XA 1KHIA 1VQ8T 3GP8A 4HT8A 4PKCC 4OP0A 3CXCS 3KXTA 2P0QA 3UPUA 4M7AA 3TIWA 3SWNC 3CC7A 3M57A 4NS5A 2DPPB 2RB6A 1IZ6A 2PVOB 4M75G 4M75A 4F7UE 3OSSC 3RKWA 2L3RA 2DO3A 4E7KA 3FPTA 4PJOF 3DKMA 5GMKm 1YJWA 3QQ8A 1Y07A 4FSXA 2QXFA 3HFNA 3S6WA 3UDCA 1W2BA 3QDRB 5GAN5 3ZJVA 2R5AA 2X35A 2IVWA 2LX9A 2YVLA 2E12A 4DOVA 2XIDA 4QQDA 2EQJA 1H641 1U1SA 4DOWA 5EPPA 2E70A 3E9GA 3A8GB 3HRTA 4BDZA 3JCMh 3I55A 2O4XB 3L2RA 3J7AF 3CCQT 1I5LA 4KDLA 4DQ2A 4ARIA 1JB0E 5DLOA 2VXEA 3G6ET 1M1GA 2QEXA 4BE1A 1KQSS 3CC4A 3LLRA 3MEAA 1ZQ1A 4F7UB 2LW6A 2RJCA 4LD6A 4KT0E 5GAMh 4OVAA 3I56T 3RIRA 1VQLT 4BI8B 1GXIE 1PSFA 4XTWA 4BB7A 1U8RA 3FJPA 3GF5A 3V7RA 3VYHB 2LDMA 2YHTA 3QXEB 2CYZB 1UGQB 2MWOA 3OW2A 2P0PA 3BY7A 5C18A 2YLBA 3T9NA 5HK0A 5AYFA 3OS5A 1BKBA 5FRNA 4E7JA 3QHSA 4M7DE 2DTIA 3M58A 4M77A 4M77G 5A0GA 3G7ZA 3OYGA 5CKEA 2PU9B 1VQOT 1S72A 2CZ0B 1VQNA 2OTJA 3QWZA 4RMOA 3QSUA 2DEQA 5LJ3g 4KO8A 3JCMJ 2WSEE 5KH6A 3HKSA 1YIJT 4RV0A 1M4ZA 3PTAA 3G4ST
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGS A;  3L42 A;  4IUU A;  5D6X A;  2XDP A;  2LVM A;  1SSF A;  3OQ5 A;  1OZ3 A;  3MEV A;  2BUD A;  2MWP A;  3OS2 A;  4C5G A;  5C0M A;  3L2V A;  4IKF A;  2DIQ A;  5KE2 A;  3H6Z A;  3FLG A;  3OYN A;  3OYA A;  3OYB A;  4QVZ A;  5KCO A;  4N4G A;  4Q5W A;  3OYM A;  3MP8 A;  4IUV A;  2EFI A;  2M0O A;  4II1 A;  4FU6 A;  2M16 A;  2PQW A;  2RI2 A;  3QKJ A;  3MEW A;  4E7H A;  3PMT A;  2JZ2 A;  2K3Y A;  3PFS A;  4N4I A;  5CIU A;  1RI0 A;  2IG0 A;  4X34 A;  3LH0 A;  3S3M A;  3QII A;  2DIG A;  3BDL A;  4FL6 A;  3OYJ A;  3FC3 A;  3E9F A;  4IUT A;  1WJS A;  2NLU A;  2VYT A;  2RJD A;  3DB4 A;  4ZTJ A;  2RI3 A;  2RJF A;  2DAQ A;  2HQX A;  2XK0 A;  3P8H A;  5FRM A;  4PL6 A;  3LYI A;  3QBY A;  2G3R A;  4IUQ A;  4PLL A;  3OY9 A;  2RHX A;  3OYH A;  3UT1 A;  2GFU A;  3OYF A;  2B8A A;  3FEO A;  2YRV A;  3OYK A;  2X4Y A;  3EAE A;  3OYE A;  3CEY A;  4B9X A;  4GY5 A;  4N4H A;  2BKD N;  3FDR A;  3SD4 A;  3OS1 A;  2X4W A;  3OA6 A;  3L2Q A;  4L59 A;  4A4E A;  3OYD A;  5KCH A;  2HQE A;  2RHY A;  3OYI A;  3OMG A;  2EQU A;  3NTK A;  3OB9 A;  5C6S A;  5J39 A;  1KHC A;  2K3X A;  5J26 A;  3GOX A;  1OYX A;  2RI5 A;  3NTH A;  4QQG A;  4C5E A;  3L2W A;  3S3N A;  4NS5 A;  2LRQ A;  4C5I A;  4BDY A;  2EQM A;  2L3R A;  2R57 A;  2RO0 A;  2O4X A;  2F5K A;  4IUP A;  3M9Q A;  4HCZ A;  5M9O A;  4E7K A;  2LCC A;  3P8D A;  5D6W A;  3S6W A;  3Q1J A;  4B9W A;  2R5A A;  2RHI A;  2X35 A;  4A4G A;  2L8D A;  2L89 A;  2QQS A;  5FRO A;  3L2U A;  2R58 A;  4QQD A;  4BAC A;  2EQJ A;  3PNW C;  3QJ6 A;  2P0K A;  3E9G A;  5KE3 A;  3C4S A;  4Z02 A;  4BDZ A;  2O4X B;  3L2R A;  3OYL A;  4BE0 A;  2EKO A;  4A4H A;  3S3O A;  2JTF A;  2R5M A;  3OMC A;  1H3Z A;  3MEU A;  4BD3 A;  2WAC A;  4PLI A;  4BE1 A;  3ZEH A;  4IUR A;  1G5V A;  4ZTF A;  4BE2 A;  3LLR A;  3MEA A;  2M1H A;  3O8V A;  2E5Q A;  2RJC A;  4LD6 A;  2EQK A;  5IN1 A;  3OS0 A;  4A4F A;  4OVA A;  3OYC A;  1MHN A;  4EDU A;  1WJQ A;  4E7L A;  1OI1 A;  3MP6 A;  4RG2 A;  2LDM A;  3DB3 A;  3LGF A;  2MWO A;  2RHU A;  2FHD A;  3MET A;  2BIV A;  4QW2 A;  1N27 A;  2X4X A;  2QQR A;  4C5H A;  3PMI A;  5FRN A;  4E7J A;  1OZ2 A;  3H8Z A;  2GFA A;  3DLM A;  5D6Y A;  4CRI A;  3NTI A;  4QQ6 A;  4E7I A;  3MP1 A;  3OYG A;  2RHZ A;  3KUF A;  3UWN A;  2CKK A;  2D9T A;  4UC4 A;  3LX7 A;  3LGL A;  1XNI A;  2LTO A;  2E6N A;  3F70 A;  3MO8 A;  5KH6 A;  1WJR A;  3ME9 A;  2GF7 A;  5IAY A;  2RJE A;  3ASK A; 
#chains in the Genus database with same CATH topology
 4RTZ A;  1RL2 A;  1E6H A;  2NUP B;  1YN8 A;  1ZSZ A;  3L2V A;  1ZBX A;  3CBM A;  2BZ8 A;  5GAO p;  1QVP A;  3OYM A;  1KJW A;  2YUJ A;  2M0O A;  1RLQ C;  4FU6 A;  1TG0 A;  2RI2 A;  2LP5 A;  1KQS P;  5GAN d;  2MCN A;  2RH2 A;  5HY6 A;  4M78 B;  2CP2 A;  2KQW A;  4LD9 K;  5LJ5 g;  1QP2 A;  2K5L A;  1K9M U;  3V7S A;  4QVC A;  2RPN A;  3FJ5 A;  3DB4 A;  1SKU B;  5I11 A;  4OMN A;  4LNP A;  4LDW A;  1Q7Y R;  5FTM A;  5FTJ A;  2FL7 A;  3PVQ A;  3QYH B;  1RUW A;  5FTL A;  1TS9 A;  2E65 A;  1AT1 B;  3OYE A;  5HK3 A;  3C0C A;  2LQN A;  3A98 A;  1OUL A;  4M7A E;  3A8L B;  1QP3 A;  5LJ3 j;  3MKD A;  1H8K A;  1YWO A;  4AFQ C;  2RHY A;  1KFZ A;  4OMM A;  3GIB A;  3PIP A;  3H0H A;  4P5N A;  2QA4 T;  3CCL A;  4IKF A;  1CKB A;  2KT1 A;  2E1H A;  2M51 A;  2EJG A;  2ZPI B;  2EW3 A;  2VWF A;  5EQJ B;  3FRN A;  3CC2 A;  4A4G A;  2QG9 B;  2XU8 A;  1BK2 A;  2CP5 A;  4D6W A;  5IXB A;  3JB9 D;  3C4S A;  1BIB A;  5KYN A;  2CRE A;  2QQB A;  4K11 A;  1M2V A;  2JTF A;  1Y0M A;  4LDY A;  4PFP A;  1C0M A;  2KT8 A;  2YSQ A;  5GAN g;  4AQ7 A;  4ZTF A;  3EG3 A;  4X9C A;  2DA9 A;  4A4F A;  3CCU A;  1MHN A;  1WJQ A;  2FYK A;  1AWW A;  3VS5 A;  4M77 E;  3CCS Q;  1EFN A;  3UAT A;  1FXX A;  4OB1 B;  3LWH A;  3CD6 T;  5CAI A;  2D9T A;  5L8R E;  1YJW Q;  4M75 D;  1RAE B;  2EGA A;  3ME9 A;  2V8J A;  1PRL C;  1RI9 A;  1ZLM A;  2LVM A;  2GNC A;  4M77 B;  4XTZ A;  1UHC A;  3JCM g;  2JOY A;  3OYN A;  3HU2 A;  1XOV A;  1ZX6 A;  2DKG A;  2CH4 W;  5KCO A;  2DM1 A;  2EFI A;  3CC4 Q;  1G3T A;  3RDV A;  3RMQ A;  1CKA A;  3HFO A;  1ZSZ B;  4MZP A;  2FZK B;  2AK5 A;  1FMK A;  2RQV A;  4M75 C;  3EHQ A;  1UGP B;  1WJS A;  1IRX A;  4PL6 A;  4OMQ A;  1M5Q 1;  2MOX A;  2ESW A;  1XJW B;  2OTJ Q;  3M4G A;  2WSC E;  4L59 A;  2RNA A;  2DL7 A;  5CCA A;  1K76 A;  2EBP A;  3RUX A;  3CC7 T;  2E3H A;  4XU3 A;  2J6O A;  2LJ0 A;  4C5I A;  3ZL7 C;  4F16 A;  3M9Q A;  4FIB A;  3I5R A;  5FU6 B;  2KRS A;  2GCX A;  3RKX A;  3Q1J A;  5GAO l;  2XKO C;  2F2W A;  2E64 A;  4LUD A;  1MMA A;  5ERG B;  2ATC B;  1WYX A;  3EGU A;  3V7C A;  1I8F A;  3SEM A;  2CDT A;  1Y96 A;  2C0I A;  2EKO A;  5CO7 A;  1WLP B;  2O2O A;  2GBQ A;  3OS0 A;  2DD5 A;  1P92 A;  2YDL A;  4E7L A;  1M2V B;  5GJV B;  4CC7 A;  4ELZ C;  2JTM A;  2YXY A;  3M0T A;  2KEA A;  1MUZ A;  3VS0 A;  2MM0 A;  3CCL Q;  3EG0 A;  3UWN A;  1WLF A;  3X26 B;  1RAG B;  1XNI A;  3L2Z A;  3CC2 Q;  2RJE A;  3CCR T;  4HVV A;  3QYG B;  4KDI A;  4EPC A;  2DNU A;  2DIQ A;  4J6X A;  4KOD A;  2VGN A;  3UA6 A;  1N9S A;  4II1 A;  3CCV T;  2D6F A;  5FLX E;  1KC8 R;  5DLQ E;  3CCU Q;  2ED1 A;  2OTL A;  2RK1 A;  4RTY A;  4R56 A;  4ZTJ A;  1YI2 T;  2EKH A;  5CD1 A;  3JB9 J;  1WXU A;  4PJN A;  1D09 B;  1JJ2 A;  1LVK A;  1K73 U;  2D0N A;  2F5T X;  3X20 B;  1BU1 A;  3CCM T;  1U5S A;  2RD1 A;  1YFN A;  4KUD K;  5GAM e;  1OEB A;  2K6D A;  4JLI A;  3OB9 A;  1YJN A;  3H0F A;  3GOX A;  2EQI A;  2YUQ A;  2JS2 A;  4TVR A;  1R0C B;  5I2M A;  4J9G A;  3HTR A;  2P4T A;  2CS7 A;  1WHJ A;  2E10 A;  1M1K R;  1U3O A;  1VQ9 A;  1G3W A;  3FPR A;  4LE9 A;  3GBQ A;  4F7U A;  4F7U G;  2EGC A;  1R7R A;  2MYS A;  2ZZD A;  3H41 A;  3JCM c;  1M9S A;  4KGV B;  1Q86 C;  4IUR A;  4BE2 A;  4O6J A;  4KUI A;  2FRY A;  3OYC A;  4EDU A;  1GCQ A;  1ABO A;  4L6V 5;  3LGF A;  2KXC A;  3X25 B;  2FHD A;  2D8J A;  2EGE A;  4GLK A;  4UC4 A;  1WHH A;  3LGL A;  5GAO r;  4FT4 A;  4M7D A;  5CCX A;  2E6N A;  4M7D G;  5D7U A;  4HCZ A;  1QQJ A;  4ME7 A;  4JDS A;  1SEM A;  1KD1 R;  1QVG A;  1Q81 R;  5KE2 A;  2COY A;  1I07 A;  2I2L A;  3CCJ A;  2LT1 A;  2YLC A;  2HNI A;  1UEC A;  3OYB A;  3M54 A;  2A08 A;  1NJI R;  5EG2 A;  3A8H B;  2KYM A;  3PFS A;  3FB9 A;  2LQW A;  4ZGJ B;  4PJO D;  2L5Q A;  4RTX A;  2K3B A;  4C92 F;  1M8M A;  3NGP A;  3AHU A;  1YHQ A;  1VQ7 T;  1VQ5 A;  3OBW A;  4CQN A;  3JCM X;  1YIT A;  1KQ2 A;  1MMD A;  2ENM A;  3JV3 A;  2BZX A;  3OYH A;  1K0S A;  1NEG A;  5CQX A;  3TSZ A;  3EAE A;  2HBW A;  4NOY A;  1TU0 B;  4BI3 A;  2ROT A;  3VS6 A;  3OMG A;  1N9R A;  4JJD A;  1YIJ Q;  1MV0 B;  1OOT A;  1VQ8 T;  4PJO C;  3TIW A;  4OP0 A;  1I1J A;  3KXT A;  4HVU A;  3UPU A;  1NM7 A;  3VS1 A;  1UTI A;  1SHF A;  2PVO B;  4F7U E;  1OX9 A;  2LX7 A;  3CME Q;  4JPB W;  3DKM A;  1K4U S;  1KIK A;  1Y07 A;  1X2K A;  1W2B A;  3M0S A;  2HQH A;  2XID A;  2OTL Q;  5EPP A;  3HRT A;  3PVL A;  3I55 A;  3J7A F;  4DQ2 A;  2JM9 A;  2VXE A;  3G6E T;  1M1G A;  2YUP A;  2KR3 A;  3LLR A;  3MEA A;  2SEM A;  1ZA1 B;  2NUT A;  4F7U B;  4LD6 A;  4ORZ A;  5GAM h;  2Z0W A;  3FJP A;  3QXE B;  2CYZ B;  3OW2 A;  1QCN A;  1ZUU A;  2P0P A;  1IXD A;  1D0Z A;  5AYF A;  3OS5 A;  1YJN Q;  3QHS A;  4M7D E;  2LZ6 B;  1Y57 A;  1T3S A;  4DEY A;  1M90 R;  4B6M A;  1S72 A;  4R0K A;  2CZ0 B;  4RMO A;  1WXB A;  1M3C A;  3QSU A;  4KO8 A;  1HD3 A;  1VYV A;  1VQ9 Q;  2PNI A;  4AFS C;  3G4S T;  3A1P A;  3CXC A;  5GAO q;  3O5Z A;  2AKK A;  2RMO A;  4M7D B;  1D1B A;  1QCF A;  3I9Q A;  1WDX A;  4C8Q A;  2H8H A;  4C8Q G;  1K9A A;  2M16 A;  1PD0 A;  4E7H A;  2JZ2 A;  2CT3 A;  1T3L A;  5LJ3 f;  2Y4X A;  3BDL A;  4J9C A;  2XIC A;  1D1A A;  3VV0 A;  1Q82 U;  2Q1D X;  1PCX A;  3HP9 A;  3ZFJ A;  2KAF A;  1MND A;  1K9M C;  2RI3 A;  2DER A;  5FRM A;  1VA7 A;  1QLY A;  3NHN A;  3FEO A;  3URG A;  2GQI A;  2KI7 A;  2X4Y A;  2GQV A;  1WNL A;  2EJF A;  2JXB A;  2CUD A;  2MMP A;  3HU1 A;  5KCH A;  1WFW A;  2VC8 A;  1NJI U;  2Y4Y A;  1UDL A;  1MGQ A;  4J7I A;  1OYX A;  2HKN A;  3L2W A;  4QQG A;  2DXT A;  5A2Q E;  3CCJ Q;  2R57 A;  5M9O A;  1BIA A;  5CCB A;  2K7A A;  4KBM B;  1BB9 A;  2DBM A;  2L89 A;  4Y28 E;  4KUL A;  3PNW C;  1S72 T;  4Z88 A;  4ELY C;  5LJ5 j;  4BE0 A;  5FU7 C;  3OMC A;  1YHQ Q;  3VS3 A;  1VQ5 Q;  1Z9Z A;  2PWY A;  1YIT Q;  4JJN K;  2AKL A;  3ZBD A;  3JCM P;  4M7A G;  1N8R R;  4LDV A;  3JCM V;  1NLP C;  4A53 A;  4Y92 A;  2J6F A;  4HKE A;  1LNX A;  3INZ A;  4M78 F;  5IXF A;  1R77 A;  4M4Z A;  3NTI A;  4QQ6 A;  4HT9 A;  1HXD A;  3MP1 A;  1I4K 1;  4AFZ C;  2CKK A;  5LJ5 d;  1G2B A;  4Z8A A;  1D0X A;  4DBH A;  1X43 A;  1HSQ A;  3M0U A;  2FZC B;  1JJ2 P;  4DEX A;  2HBP A;  3P8B B;  4C8Q E;  7AT1 B;  3MEV A;  4Y91 A;  4PFZ A;  3I55 Q;  2QDY B;  4JRP A;  1X69 A;  2V8I A;  1ABQ A;  1W4S A;  4FSS A;  4N4G A;  4F04 B;  5GAN j;  4XTX A;  5GAM g;  3UA7 A;  5CK9 A;  2DVJ A;  4A54 A;  1DJ7 B;  4C0D B;  2K57 A;  3LH0 A;  5J3B A;  1M90 U;  3QII A;  2RQW A;  1YJ9 A;  4FYW B;  1OX8 A;  3CCE A;  4C8Q B;  3C94 A;  3ER0 A;  3RKY A;  4KLN A;  2RHX A;  2L3Q A;  2VVK A;  2XI9 A;  1UE9 A;  4GY5 A;  1S72 Q;  2X3X D;  3CCS T;  1Z9Q A;  1PC0 A;  3OA6 A;  1IGQ A;  1RAF B;  1VYT A;  4EMH A;  2C0T A;  2BE7 D;  3S3N A;  1YJW T;  2LRQ A;  4LDU A;  4RTW A;  1MNE A;  3RER A;  2AZS A;  4CC3 A;  4ZN1 A;  2VXF A;  4JS5 A;  4J9D A;  3CQT A;  2QQA A;  2LQ8 A;  1QVF A;  1FMV A;  2B86 A;  4CI0 C;  1K8A R;  4FYX B;  3CC4 T;  3JAM E;  1QVG P;  4PLI A;  2CH4 A;  3M59 A;  4M77 F;  4J9I A;  4WF2 A;  5GMK e;  3SWN A;  4BUG A;  2DF6 A;  3JCM d;  1PWT A;  4XU1 A;  2LJ1 A;  1RAD B;  1BI0 A;  4QW2 A;  4M7A B;  3EH1 A;  5DM7 R;  1QMC A;  4J83 A;  2QQ9 A;  2OTJ T;  1BI2 A;  2EJ9 A;  2FPF A;  1B34 A;  1YJ9 T;  4XU0 A;  2BTT A;  3BW1 A;  1N6A A;  4VUB A;  1VQO A;  2DJQ A;  3ASK A;  1UGV A;  2BZY A;  2JUF A;  2YRD A;  1SSF A;  1N8R U;  5GAN 7;  2JMA A;  1NZ9 A;  4EMK C;  4C5G A;  5C0M A;  2JTE A;  2YRC A;  2MPX C;  2KMT A;  4XU2 A;  4Q5W A;  2K79 A;  1QDN A;  5GMK i;  1T0H A;  3DLL A;  3TCJ A;  1RI0 A;  4FL6 A;  3OYJ A;  2M9U A;  5IHN A;  3SFM A;  1D3B A;  2CP3 A;  2XK0 A;  4J9B A;  3TEE A;  1JRI A;  5GAO n;  2QK0 A;  3GNF B;  5GAN 8;  1UJ0 A;  2X9H A;  2BKD N;  3OYY A;  1K73 C;  3M4Y A;  3QZ5 B;  4LXC A;  3OW2 P;  3CCL T;  4E6R A;  4AMC A;  2QI2 A;  2RI5 A;  2ZPH B;  1FYN A;  2DXC A;  4A4K A;  2EQM A;  2YT6 A;  3CC2 T;  2FRW A;  4OML A;  3QPH A;  4XTU A;  2DL8 A;  2OI3 A;  3J80 E;  3CF2 A;  1EX4 A;  1X01 A;  5FRO A;  2XDB A;  2XDD A;  3CPW P;  3C95 A;  4RG8 A;  3GNG A;  4L5G A;  1YJ9 Q;  3OYL A;  3CCE Q;  3QUI A;  3S3O A;  2R5M A;  2HDA A;  4ZNX A;  2DMO A;  4BD3 A;  4J6W A;  3CCU T;  3EFR A;  1VQP A;  3LW5 E;  3LWI A;  1OI1 A;  1Y71 A;  3DB3 A;  2KVQ G;  1U06 A;  3EGD A;  5IHK A;  4PJM A;  5CKH A;  2K2V A;  3X28 B;  1Q7Y U;  4C92 D;  3SWN B;  1KQ1 A;  1NPR A;  3H8Z A;  2DX1 A;  1M27 C;  4PK4 A;  4CRI A;  4E7I A;  4DBR A;  4O5V A;  1RAA B;  3BFM A;  1K8A U;  3L1A A;  2HL3 A;  1R0B G;  4QKU A;  3PIO A;  5DYG A;  2GF7 A;  5B6C A;  1H3H A;  3JB9 I;  3L42 A;  4IUU A;  3R6O A;  1NEB A;  1I5O B;  4C0F A;  4XAX B;  2BUD A;  4EMK A;  5GMK h;  3OYA A;  2FEI A;  1ZC1 A;  3PT9 A;  5KYY A;  3ZGZ A;  3EH2 A;  4J9H A;  2PUO B;  3JRZ A;  4HA8 A;  2L3P A;  4C92 C;  2DL5 A;  3JB9 G;  2B25 A;  3M0P A;  4X34 A;  3VJP A;  2KSS A;  2ZGW A;  3S3M A;  2HQX A;  1YIJ A;  3VS7 A;  2K4Y A;  3J81 E;  1O75 A;  5I2S A;  4B9X A;  2ZCF B;  2O31 A;  3CME A;  4NL2 A;  4PJJ A;  1VQO Q;  1D3B B;  2RQR A;  1VQ4 A;  2OAW A;  2MIO A;  1KHI A;  4HT8 A;  4PKC C;  2CUB A;  2P0Q A;  3VS2 A;  4NS5 A;  4M75 A;  2RB6 A;  4M75 G;  3OSS C;  2L3R A;  2DO3 A;  1X2Q A;  1IHW A;  2KE9 A;  3HFN A;  2R5A A;  2X35 A;  2YVL A;  2E12 A;  4DOV A;  2EQJ A;  1U1S A;  1WZO A;  4DOW A;  2XMF A;  3E9G A;  1I5L A;  1C6V X;  4ARI A;  1JB0 E;  5DLO A;  2QEX A;  2NUZ A;  4OVA A;  4XTW A;  4BB7 A;  2KRN A;  2FZG B;  2LDM A;  1IB8 A;  2BE9 B;  3T9N A;  3H9N A;  4E7J A;  1QKX A;  1MV3 A;  5A0G A;  3EGD B;  1VQN A;  2DEQ A;  3JCM J;  5KH6 A;  1YIJ T;  1OQK A;  4RV0 A;  3UF4 A;  5I22 A;  2JW4 A;  2XDP A;  3CMA A;  1AWX A;  2ROL A;  1Y96 B;  1H92 A;  1G3S A;  2EYZ A;  3CME T;  1E7O A;  4OB2 B;  2V26 A;  1MMG A;  1VIF A;  1CSK A;  2LNV A;  3SDZ A;  3LHD A;  1VQP Q;  2V8K A;  4C92 A;  3PGG A;  2LC4 A;  2OTL T;  3PMT A;  1QW1 A;  1AZG B;  1S3S A;  2NYS A;  2PTK A;  2DIG A;  3N5B B;  5KYY B;  1UHF A;  2LJ3 A;  3JCM W;  4WCI A;  3HHT B;  1KQS A;  1Q82 C;  2EYQ A;  4KRT A;  4Z89 A;  2ZAE A;  1YWP A;  1X75 C;  2C0O A;  4PFO A;  3OYK A;  1YBY A;  2AT1 B;  3FDR A;  1I9G A;  2F69 A;  2EAY A;  1KD1 C;  1Q81 C;  2I0N A;  3HRS A;  1YJN T;  4M75 E;  2QAS A;  2AZV A;  5CKF A;  1RAH B;  5C6S A;  4EMG A;  1KHC A;  1NJI C;  4JZ4 A;  2EVR A;  4C5E A;  3PE0 A;  5CVI A;  1AVZ C;  4KH1 B;  2IIM A;  1VIE A;  4M78 D;  2K5I A;  1VQ9 T;  4JRQ A;  2EYW A;  3JCM b;  1RAB B;  1IHV A;  4J5Y A;  2R58 A;  2XHC A;  4HCK A;  4M75 B;  1PM3 A;  3V8J A;  2DBK A;  4OGC A;  2DL3 A;  4FCY A;  4C0Z A;  3ZEH A;  1AZE A;  1KC8 U;  1NBE B;  3O8V A;  2EQK A;  1B3Q A;  4JRI A;  2M0Y A;  2QYZ A;  2DTH A;  4M7D F;  2DRM A;  4M78 C;  1VQK A;  2NWM A;  1UJY A;  2DFU A;  2E4H A;  1VQ4 Q;  3QG1 A;  3SB2 A;  2X4X A;  2EIF A;  3GPL A;  1HK9 A;  1C1A A;  1PKT A;  4DBF A;  6AT1 B;  2KGT A;  2MI6 A;  2E6Z A;  1NPP A;  5GAN f;  4IIM A;  1CR5 A;  2Q1C X;  4RCB A;  1UB4 A;  2QDL A;  3MO8 A;  3QQ7 A;  2YWW A;  1GFC A;  1WGS A;  1LPL A;  2W0Z A;  5GMK l;  5CR2 A;  3CCJ T;  2C06 A;  4C92 E;  2KNB B;  4J7F A;  2JV2 A;  2EYX A;  3H6Z A;  2CT4 A;  2DEU A;  2CP7 A;  1GCP A;  4LDX A;  4QVZ A;  2CZ6 B;  1VQM A;  1M1K U;  2QEX Q;  4FYY B;  5CKD A;  1WHG A;  2COW A;  3HL8 A;  1OPK A;  3TVT A;  1X27 A;  2IG0 A;  2HSP A;  5DYI A;  1YHQ T;  5LJ3 e;  1VQ5 T;  1M90 C;  1YIT T;  1W70 A;  2VYT A;  2RJF A;  3P8H A;  3VKI A;  1G8X A;  3JCM f;  5GAN 4;  2CP6 A;  3OY9 A;  2KK4 A;  2ED0 A;  4KH0 B;  5GAO m;  1VQN Q;  5GLF A;  2Q1A X;  4M77 D;  5FWC A;  2X4W A;  4X1V A;  3D7S B;  2L2P A;  1PNJ A;  4QT7 A;  3CMA Q;  1VQ6 A;  1O9S A;  4J6Y A;  1PRM C;  3HU3 A;  2RK2 A;  2Y90 A;  4IUP A;  1W6X A;  4AS1 A;  5D6W A;  1WA7 A;  2L0A A;  4B9W A;  2DVE A;  5GAM j;  8ATC B;  2KXD A;  1KD1 U;  1Q81 U;  3BE3 A;  3I55 T;  2LT4 A;  2P0K A;  2K9G A;  3NPF A;  2WSF E;  4YTL A;  9ATC B;  4M77 C;  2NUP A;  3VRY A;  4HCC A;  1K9M R;  1SSH A;  5FW9 A;  3QO3 A;  2OJ2 A;  3CCQ A;  4PJO A;  4PJO G;  3X24 B;  3LGA A;  1TSF A;  2DD4 A;  2MAM A;  2P4R A;  4FW1 A;  4M78 A;  5GAN 2;  1JJ2 S;  3I56 A;  1VQL A;  1OV3 A;  2JNG A;  2QAZ A;  1U1T A;  4FYV B;  3TRE A;  1CZ4 A;  1ZBJ A;  3QQ8 A;  2QQR A;  5GAM d;  3GLX A;  2DJZ A;  5GAN 3;  1WI7 A;  4C8Q F;  3G71 A;  1V1C A;  2LCL A;  3LX7 A;  1GBR A;  4ANJ A;  2J06 A;  2RM4 A;  5IAY A;  5D6X A;  2AIR B;  3BDU A;  3CBP A;  1WIE A;  1N8R C;  2W10 A;  4HCB A;  1AOJ A;  2RF0 A;  3H0I A;  2NUT B;  3M56 A;  3QKJ A;  3IQL A;  5FU6 C;  4X9D A;  3E1S A;  2SRC A;  2HAX A;  1VQK Q;  3WXM B;  2VV5 A;  3MB5 A;  3RES A;  2DAQ A;  3C12 A;  3QBY A;  4J9F A;  2QGG A;  1VOM A;  4JRK A;  2MF2 A;  2VUB A;  5DY9 A;  4IIO A;  2HL5 C;  1AWJ A;  2DRK A;  4ARC A;  4N0A C;  2F2X A;  2OAU A;  5J39 A;  1J3T A;  2A0F B;  1QKW A;  1QVG S;  3TQ7 P;  2HZY A;  2KYB A;  2Q19 X;  2QA4 A;  2O4X A;  2F5K A;  1HJD A;  1VQM Q;  4M7A F;  3QZ9 B;  5LJ3 h;  2KRM A;  2RHI A;  2L8D A;  2LCS A;  1M30 A;  4PJO E;  2DTO A;  3G71 T;  1ZHI A;  3WVE B;  2CZ7 B;  3M5A A;  4M78 E;  2LQK A;  1FX7 A;  4RTU A;  2E5Q A;  5A0L A;  3NMZ C;  1WPY A;  4JUV A;  4E2F B;  5LL6 S;  4PJO B;  1BBZ A;  2HD0 A;  3TU4 K;  1Q7Y C;  1VQ6 Q;  2GFA A;  3DLM A;  2ABL A;  2RHZ A;  4OGE A;  1NE8 A;  1NG2 A;  4MDX A;  2DIL A;  4BI4 A;  3CD6 A;  1PD1 A;  2ZPG B;  1ZSG A;  1K8A C;  2OX7 A;  2K5F A;  1W2B S;  4ESR A;  2J05 A;  4LUE A;  1OZ3 A;  1UEB A;  1AWO A;  4E7Z A;  2MWP A;  3OS2 A;  2JN0 A;  2FO0 A;  2COZ A;  1KSW A;  3LH5 A;  4MML A;  1ACM B;  3CCQ Q;  2FVU A;  2LNH B;  1TOV A;  2G6F X;  2P84 A;  2F1L A;  3CCE T;  3I56 Q;  1XTD A;  1VQL Q;  2J6K A;  2KRO A;  2DYB A;  4NL3 A;  1BYM A;  2RJD A;  1Y7X A;  3OW2 S;  1YP5 A;  5IH2 A;  3LYI A;  4IUQ A;  4PLL A;  2QTX A;  2H3J A;  2GFU A;  5GAN 6;  2O9S A;  4N4H A;  3G71 Q;  3CPW S;  2HQE A;  2X4J A;  4N0A A;  5LJ3 d;  3U23 A;  1GL5 A;  5FWB A;  2EQU A;  2K3X A;  4JZ3 A;  2M02 A;  3CXC S;  1W2B P;  3CC7 A;  4JJB A;  1JO8 A;  2DPP B;  2VKN A;  1TWB A;  3RKW A;  4E7K A;  3FPT A;  1PG5 B;  1WHM A;  5GMK m;  2QXF A;  1SG5 A;  2VAS A;  4AFU C;  3UDC A;  2V1Q A;  2IVW A;  1SPK A;  1H64 1;  4BDZ A;  2O4X B;  3L2R A;  1GBQ A;  4KGZ B;  2E5K A;  5HCK A;  1D0Y A;  3EHR A;  3TSW A;  4AT1 B;  3EG1 A;  2LW6 A;  2CP0 A;  2FPE A;  3REB B;  3RIR A;  4BI8 B;  1GXI E;  1U8R A;  3VYH B;  1K73 R;  2YHT A;  2MWO A;  1IGU A;  4CC4 B;  2YLB A;  1BKB A;  5FRN A;  2DTI A;  2GTO A;  1LCK A;  1SRL A;  3G7Z A;  3RBB B;  3OYG A;  3CXC P;  1VQO T;  2QA4 Q;  1RAI B;  5LJ3 g;  4JJC A;  3HKS A;  3QDF A;  4J9E A;  1YCS B;  1KK7 A;  3PTA A;  3QWX X;  2RN8 A;  2HSE B;  3QWY A;  2RA2 A;  3FPU A;  1EIF A;  3CCR A;  3I35 A;  5FU7 B;  3SHW A;  1XQH A;  1BI3 A;  2K2M A;  4RTT A;  2PQW A;  3MEW A;  1B07 A;  3CCV A;  3M0R A;  2A7Y A;  1VUB A;  5CQY A;  3VU3 C;  2XD0 A;  4OF1 A;  1UFF A;  1YI2 A;  1B34 B;  3OYF A;  2B8A A;  2YRV A;  3CEY A;  4E7S A;  4KGX B;  1JBM A;  3OBY A;  3CD6 Q;  1FWZ A;  1SRM A;  2PJH B;  2X3W D;  2FG0 A;  1IRE B;  4FW2 A;  4M7D D;  3CCM A;  5ECA A;  2JMC A;  1OU9 A;  5J26 A;  2DLP A;  3FIF A;  4HXJ A;  4BDY A;  2KY9 A;  1GCQ C;  4ZN3 A;  3THK A;  3KBG A;  5KYU A;  2PUK B;  3ZJT A;  3L2U A;  1V76 A;  1OPL A;  1AHJ B;  3QJ6 A;  1ZUY A;  2X51 A;  3RR6 A;  1SHG A;  1HYO A;  4XTY A;  1NYF A;  4BY6 C;  4A4H A;  1VQP T;  1K0X A;  1EZZ B;  2DZC A;  4M7D C;  5L23 A;  1TXQ A;  2Q18 X;  1V29 B;  1KC8 C;  4A63 B;  3WVD B;  2FPD A;  3MET A;  1ARK A;  1Q95 G;  4C5H A;  2QTV A;  2E3I A;  1OZ2 A;  4MZM A;  4OMO A;  1MMN A;  5GMK j;  3CC7 Q;  1F1B B;  2A28 A;  1W1F A;  1TH7 A;  1R8O B;  1B7T A;  3JB9 F;  5KYW A;  1GFD A;  1YCY A;  2DYI A;  3VRZ A;  4OMF B;  2JM8 A;  1QVF S;  1GRI A;  2D8H A;  2HEQ A;  2MK5 A;  2JJ9 A;  3OSV A;  1FMW A;  3I5S A;  2KDS A;  3M55 A;  2V1R A;  4MMK A;  2EWN A;  1M1K C;  2F2V A;  2K3Y A;  5AT1 B;  4ATO A;  1UUE A;  1SF9 A;  4FM4 B;  4DBQ A;  3QC8 A;  4J8O A;  2NLU A;  4MZT A;  3MCA B;  4ZGD B;  3REA B;  3VYG A;  1VQ7 A;  2GGR A;  4M75 F;  2PZ1 A;  2MM2 A;  4RKU E;  2CSI A;  4F17 A;  1Q86 R;  3JB9 H;  1TTH B;  5GAM f;  1VQ4 T;  2O01 E;  1LOJ A;  1RAC B;  4C92 G;  1X6O A;  3OYI A;  1RLP C;  3NTK A;  4EMK B;  3CCR Q;  3NTH A;  2HKQ B;  1QVF P;  4V2S A;  5LJ5 e;  1VQ8 A;  3A8M B;  1M8V A;  2A3L A;  3HRU A;  1JEG A;  3V8L A;  3ZJU A;  1QCO A;  1M3B A;  3HSB A;  3NFC A;  1OU8 A;  4C8Q D;  3CCV Q;  4DA4 A;  1G3Y A;  4BAC A;  1NYG A;  5KE3 A;  4OMP A;  1JU5 C;  2DXB A;  4E47 A;  5GJW B;  2EYY A;  4PNO A;  2QEX T;  2O88 A;  1H3Z A;  1Q82 R;  4F7U F;  2WAC A;  4D8D A;  4RUG A;  5KYU B;  1X6G A;  3CPF A;  1ZA2 B;  5LJ5 f;  1YI2 Q;  3EFO A;  2LMJ A;  3G6E A;  1N5Z A;  1WXT A;  1TUD A;  2AHJ B;  2CZ1 B;  4C0G A;  1UGS B;  4C0D C;  4RG2 A;  3JSC A;  5IT9 E;  1WX6 A;  1N27 A;  4JLG A;  4C8Q C;  3CCM Q;  1QCS A;  2XG8 D;  3PMI A;  2J7I A;  2FB7 A;  1VQN T;  2L3S A;  5D6Y A;  3VUB A;  1WQW A;  3KUF A;  3BQB A;  2D0Q B;  2CGH A;  4CC2 A;  5GAN e;  2YUO A;  3F70 A;  3MPU B;  3CMA T;  2JT4 A;  3E19 A;  2DZ9 A;  4OB0 B;  3EG2 A;  3OQ5 A;  1JQQ A;  2IPO B;  3G4S A;  3MJX A;  3VUZ A;  1M3A A;  3A5Z B;  5KYW B;  3MP8 A;  4XK8 E;  1I81 A;  3EG9 A;  1M2O A;  5CIU A;  3V8K A;  4M7A D;  1UGR B;  5A0D A;  3JCM Q;  3M53 A;  1T0J A;  2PVD B;  2JVV A;  3UT1 A;  3JCM e;  1TUC A;  5CKB A;  1PSE A;  2A37 A;  3OS1 A;  3EGX A;  2ZPF B;  4XQ3 A;  2CSQ A;  4EIK A;  3OYD A;  1I0C A;  4RTV A;  4AG2 C;  1IO6 A;  4M7A C;  1NLO C;  2DL4 A;  3RNJ A;  1BI1 A;  2PVG B;  2RO0 A;  1PKS A;  1KG1 A;  4MDW A;  1AEY A;  4C92 B;  2LCC A;  3AT1 B;  3P8D A;  1QWF A;  5KYX A;  2DET A;  2ZPE B;  1UG1 A;  2HCK A;  2QQS A;  2E41 A;  4Z02 A;  1WQ7 A;  1Q86 U;  3KFV A;  3MEU A;  2VB6 A;  3CPW A;  1G5V A;  4LN2 A;  2VGM A;  1QWE A;  2M1H A;  1VQ7 Q;  4AG1 C;  5IN1 A;  2JS0 A;  1E32 A;  1VQK T;  1D1C A;  3E2U A;  4BY6 B;  3MHX A;  3MP6 A;  5LJ5 h;  2RHU A;  3RMS A;  5C1B A;  2BIV A;  4JS4 A;  1LJO A;  3EFO B;  3R6N A;  3EFS A;  1M1F A;  2YUN A;  1YNZ A;  1VQ8 Q;  4QVD A;  1WHL A;  2D1X A;  2LTO A;  4R55 A;  1WJR A;  4A4E A;  2RQU A;  4XTV A;  1ZSZ C;  4M78 G;  1JXM A;  3FLG A;  1VQM T;  5HKC A;  2DK3 A;  2EPD A;  2ECZ A;  4D8K A;  1ZUK A;  1O54 A;  3VS4 A;  4IUV A;  3G1J A;  2RQT A;  3G6E Q;  5FTK A;  4N4I A;  2HMA A;  1CZ5 A;  3FC3 A;  1JXO A;  2DXU A;  3E9F A;  4IUT A;  4RCC A;  4OB3 B;  1BCM A;  2KBT A;  3EG9 B;  5I21 A;  2G3R A;  2ZPB B;  1S1N A;  5GAN h;  4WTO B;  1G83 A;  4F14 A;  1K1Z A;  3A8O B;  3SD4 A;  1A0N B;  5FTN A;  3L2Q A;  4FT2 A;  4ZGE B;  3CCS A;  3QJY A;  3CBO A;  1VQ6 T;  3HPW A;  4GLM A;  1PHT A;  4M7A A;  3GP8 A;  1TUG B;  3G4S Q;  3SWN C;  3M57 A;  3EGX B;  1IZ6 A;  4GBQ A;  4PJO F;  1YJW A;  4FSX A;  3S6W A;  3ULR B;  3QDR B;  4HVW A;  1WHK A;  5GAN 5;  3ZJV A;  2LX9 A;  1E6G A;  1X6B A;  4QQD A;  4PJL A;  2QGF B;  2E70 A;  3A8G B;  3JCM h;  2H3E B;  3CCQ T;  4KDL A;  2A36 A;  2GTJ A;  8AT1 B;  1KQS S;  5KYX B;  4BE1 A;  3CC4 A;  1ZQ1 A;  1VYU A;  2RJC A;  4KT0 E;  3I56 T;  1VQL T;  1PSF A;  2DE0 X;  3GF5 A;  3V7R A;  1UGQ B;  3BY7 A;  5C18 A;  5EC7 A;  5HK0 A;  3M58 A;  4M77 A;  4M77 G;  1BCO A;  2O9V A;  5CKE A;  2PU9 B;  2OTJ A;  3QWZ A;  1AD5 A;  5IHI A;  2WSE E;  3M0Q A;  1M4Z A; 
#chains in the Genus database with same CATH homology
 1RL2 A;  3CXC A;  2XDP A;  5GAO q;  3CMA A;  2RA2 A;  3FPU A;  1EIF A;  3CCR A;  1Y96 B;  3L2V A;  5FU7 B;  1G3S A;  1ZBX A;  3CME T;  4MDX A;  1XQH A;  4OB2 B;  1BI3 A;  3CBM A;  5GAO p;  1QVP A;  1VIF A;  4M7D B;  2LNV A;  3OYM A;  3SDZ A;  4C8Q A;  2YUJ A;  2M0O A;  4C8Q G;  3LHD A;  4FU6 A;  2M16 A;  2PQW A;  2RI2 A;  2V8K A;  3PGG A;  3MEW A;  4C92 A;  2LC4 A;  4E7H A;  5GAN d;  3PMT A;  1QW1 A;  2JZ2 A;  2OTL T;  2RH2 A;  5HY6 A;  3CCV A;  4M78 B;  1S3S A;  2A7Y A;  2KQW A;  5LJ3 f;  1VUB A;  5CQY A;  2DIG A;  2Y4X A;  3BDL A;  3N5B B;  2XIC A;  5LJ5 g;  4LD9 K;  1QP2 A;  2K5L A;  3JCM W;  1K9M U;  3V7S A;  3VV0 A;  4QVC A;  3VU3 C;  3HP9 A;  1Q82 U;  3ZFJ A;  3HHT B;  2Q1D X;  1KQS A;  2KAF A;  3DB4 A;  1K9M C;  2RI3 A;  1Q82 C;  2EYQ A;  2XD0 A;  4OF1 A;  5FTM A;  4LDW A;  5FRM A;  5FTJ A;  2FL7 A;  1YI2 A;  1B34 B;  1X75 C;  3QYH B;  3OYF A;  5FTL A;  2B8A A;  3FEO A;  2E65 A;  2YRV A;  3URG A;  1YBY A;  3OYK A;  2X4Y A;  3OYE A;  3CEY A;  5HK3 A;  2GQV A;  1WNL A;  2EJF A;  1JBM A;  3FDR A;  2F69 A;  2EAY A;  1KD1 C;  1Q81 C;  4M7A E;  3A8L B;  1QP3 A;  3OBY A;  1I9G A;  2MMP A;  1FWZ A;  3HRS A;  5LJ3 j;  3HU1 A;  1YJN T;  4M75 E;  5KCH A;  2VC8 A;  1NJI U;  2PJH B;  2RHY A;  2Y4Y A;  1IRE B;  5CKF A;  4M7D D;  5C6S A;  3CCM A;  1MGQ A;  4EMG A;  1KHC A;  4J7I A;  1NJI C;  3GIB A;  3PIP A;  5J26 A;  1OYX A;  3FIF A;  4C5E A;  4P5N A;  4QQG A;  5CVI A;  3L2W A;  2QA4 T;  2DXT A;  3CCL A;  1VIE A;  5A2Q E;  4BDY A;  4M78 D;  2R57 A;  4IKF A;  2K5I A;  2KY9 A;  1BIA A;  2E1H A;  4ZN3 A;  5M9O A;  4JRQ A;  1VQ9 T;  5CCB A;  2EJG A;  2ZPI B;  3JCM b;  3KBG A;  5EQJ B;  3FRN A;  3CC2 A;  2PUK B;  4KBM B;  4A4G A;  3ZJT A;  2XU8 A;  4Y28 E;  2L89 A;  4J5Y A;  3L2U A;  2R58 A;  2XHC A;  4KUL A;  4D6W A;  1AHJ B;  3PNW C;  3QJ6 A;  4M75 B;  3JB9 D;  1S72 T;  3V8J A;  3C4S A;  1BIB A;  4XTY A;  2QQB A;  4ELY C;  5LJ5 j;  4BE0 A;  4OGC A;  5FU7 C;  4BY6 C;  4A4H A;  2JTF A;  3OMC A;  1VQP T;  4LDY A;  2PWY A;  5GAN g;  4C0Z A;  3ZEH A;  2DZC A;  4JJN K;  4ZTF A;  4M7D C;  2Q18 X;  4AQ7 A;  3ZBD A;  1KC8 U;  3JCM P;  4M7A G;  3O8V A;  2EQK A;  4X9C A;  1V29 B;  4JRI A;  4LDV A;  4A4F A;  3CCU A;  1MHN A;  1KC8 C;  3JCM V;  2DTH A;  1WJQ A;  2FYK A;  4M7D F;  4M78 C;  4A53 A;  1VQK A;  4M77 E;  3WVD B;  3MET A;  4HKE A;  1LNX A;  3INZ A;  2X4X A;  2EIF A;  3QG1 A;  1FXX A;  4M78 F;  3SB2 A;  4C5H A;  1HK9 A;  1OZ2 A;  3GPL A;  4MZM A;  4OB1 B;  3LWH A;  3NTI A;  4QQ6 A;  2MI6 A;  5GMK j;  4HT9 A;  2E6Z A;  1HXD A;  3MP1 A;  3CD6 T;  1I4K 1;  1NPP A;  5CAI A;  2CKK A;  5LJ5 d;  2D9T A;  5GAN f;  5L8R E;  1TH7 A;  1R8O B;  4M75 D;  1CR5 A;  3JB9 F;  2Q1C X;  4RCB A;  1UB4 A;  3MO8 A;  3QQ7 A;  1YCY A;  3ME9 A;  2HBP A;  2V8J A;  4OMF B;  1WGS A;  1QVF S;  3OSV A;  2LVM A;  3P8B B;  4M77 B;  4XTZ A;  4C8Q E;  5GMK l;  5CR2 A;  2KDS A;  3M55 A;  3MEV A;  3JCM g;  4C92 E;  3CCJ T;  4Y91 A;  2C06 A;  2JOY A;  4J7F A;  2JV2 A;  3H6Z A;  3OYN A;  2QDY B;  4JRP A;  2V8I A;  3HU2 A;  1XOV A;  2DKG A;  4LDX A;  1W4S A;  4QVZ A;  4N4G A;  5KCO A;  2CZ6 B;  1VQM A;  4MMK A;  1M1K U;  2EFI A;  2EWN A;  5GAN j;  1G3T A;  3RMQ A;  4XTX A;  5CKD A;  5GAM g;  1M1K C;  2K3Y A;  3HL8 A;  5CK9 A;  4A54 A;  3HFO A;  4MZP A;  2IG0 A;  4ATO A;  1DJ7 B;  4C0D B;  2K57 A;  3LH0 A;  5DYI A;  5J3B A;  1M90 U;  4FM4 B;  3QII A;  1YHQ T;  1YJ9 A;  5LJ3 e;  1VQ5 T;  4M75 C;  1M90 C;  3QC8 A;  1YIT T;  1UGP B;  1WJS A;  4J8O A;  3CCE A;  2NLU A;  2VYT A;  3MCA B;  4MZT A;  4C8Q B;  2RJF A;  3C94 A;  3ER0 A;  3P8H A;  3VKI A;  4PL6 A;  3RKY A;  3JCM f;  4ZGD B;  5GAN 4;  4KLN A;  3OY9 A;  2RHX A;  3VYG A;  2KK4 A;  1M5Q 1;  4M75 F;  1VQ7 A;  2XI9 A;  2MM2 A;  5GAO m;  4RKU E;  4GY5 A;  5GLF A;  2Q1A X;  3CCS T;  3M4G A;  4M77 D;  2WSC E;  2X4W A;  3OA6 A;  3JB9 H;  5GAM f;  1VQ4 T;  2O01 E;  4L59 A;  1LOJ A;  5CCA A;  4C92 G;  1X6O A;  3OYI A;  3NTK A;  4EMK B;  3RUX A;  3CC7 T;  4EMH A;  4XU3 A;  1VQ6 A;  1O9S A;  3NTH A;  3S3N A;  4J6Y A;  4V2S A;  5LJ5 e;  1YJW T;  1VQ8 A;  2LRQ A;  4C5I A;  4LDU A;  3HU3 A;  3A8M B;  2RK2 A;  2Y90 A;  3RER A;  1M8V A;  4IUP A;  4ZN1 A;  3M9Q A;  2A3L A;  2VXF A;  4JS5 A;  3HRU A;  4AS1 A;  4FIB A;  3V8L A;  2QQA A;  2LQ8 A;  5D6W A;  3ZJU A;  5FU6 B;  2GCX A;  3RKX A;  3Q1J A;  1QVF A;  3HSB A;  4B9W A;  2DVE A;  3NFC A;  5GAM j;  2XKO C;  5GAO l;  4C8Q D;  4DA4 A;  2E64 A;  1KD1 U;  1G3Y A;  1Q81 U;  5ERG B;  3I55 T;  4BAC A;  2LT4 A;  3V7C A;  1I8F A;  2P0K A;  5KE3 A;  2WSF E;  4YTL A;  4M77 C;  2DXB A;  4E47 A;  1Y96 A;  4CI0 C;  2QEX T;  2EKO A;  4PNO A;  4HCC A;  3CC4 T;  1H3Z A;  3JAM E;  5CO7 A;  4F7U F;  3QO3 A;  2WAC A;  4PLI A;  3CCQ A;  3M59 A;  4PJO A;  3CPF A;  4M77 F;  4PJO G;  5LJ5 f;  3X24 B;  4WF2 A;  3LGA A;  5GMK e;  2DD4 A;  3SWN A;  3OS0 A;  2MAM A;  2DD5 A;  1P92 A;  4BUG A;  3G6E A;  2AHJ B;  3JCM d;  2CZ1 B;  4M78 A;  4C0G A;  5GAN 2;  4E7L A;  1UGS B;  4C0D C;  1JJ2 S;  4RG2 A;  4XU1 A;  3JSC A;  3I56 A;  1VQL A;  2JNG A;  1CZ4 A;  3TRE A;  1U1T A;  5CCX A;  5IT9 E;  4ELZ C;  1BI0 A;  2JTM A;  4QW2 A;  4M7A B;  1N27 A;  5DM7 R;  4J83 A;  4JLG A;  2QQR A;  4C8Q C;  1QCS A;  2XG8 D;  3PMI A;  3GLX A;  2QQ9 A;  5GAM d;  2FB7 A;  2DJZ A;  1VQN T;  2OTJ T;  2MM0 A;  5D6Y A;  1BI2 A;  5GAN 3;  2EJ9 A;  1B34 A;  1YJ9 T;  3VUB A;  1WQW A;  3KUF A;  4XU0 A;  3UWN A;  1WLF A;  3BQB A;  4C8Q F;  3G71 A;  3BW1 A;  2D0Q B;  2LCL A;  3LX7 A;  1N6A A;  2CGH A;  4VUB A;  1XNI A;  3X26 B;  5GAN e;  1VQO A;  3F70 A;  3L2Z A;  3CMA T;  2RM4 A;  2RJE A;  3CCR T;  5IAY A;  3ASK A;  3E19 A;  2JUF A;  5D6X A;  2DZ9 A;  4OB0 B;  1SSF A;  1N8R U;  3QYG B;  5GAN 7;  4KDI A;  3BDU A;  3OQ5 A;  3CBP A;  1NZ9 A;  4EMK C;  3G4S A;  4C5G A;  4EPC A;  5C0M A;  1N8R C;  2DIQ A;  3VUZ A;  3A5Z B;  4J6X A;  4HCB A;  4KOD A;  2VGN A;  1N9S A;  2KMT A;  4XU2 A;  4Q5W A;  3MP8 A;  1QDN A;  4II1 A;  3CCV T;  3M56 A;  4XK8 E;  5GMK i;  2D6F A;  3QKJ A;  3DLL A;  1I81 A;  3TCJ A;  5FLX E;  5CIU A;  5DLQ E;  5FU6 C;  3V8K A;  1RI0 A;  4X9D A;  4M7A D;  3E1S A;  1UGR B;  2OTL A;  2HAX A;  2RK1 A;  5A0D A;  4FL6 A;  3OYJ A;  2M9U A;  4R56 A;  3WXM B;  3JCM Q;  2VV5 A;  3M53 A;  3MB5 A;  4ZTJ A;  3RES A;  3SFM A;  1YI2 T;  2DAQ A;  1D3B A;  3C12 A;  2XK0 A;  5CD1 A;  3TEE A;  3JB9 J;  2PVD B;  3QBY A;  2JVV A;  3UT1 A;  3JCM e;  1JRI A;  5CKB A;  5GAO n;  3GNF B;  4JRK A;  2MF2 A;  2VUB A;  1PSE A;  5DY9 A;  5GAN 8;  1JJ2 A;  2BKD N;  3OS1 A;  1K73 U;  3OYY A;  2ZPF B;  4XQ3 A;  2F5T X;  3X20 B;  4ARC A;  1K73 C;  3OYD A;  3CCM T;  2RD1 A;  3M4Y A;  4KUD K;  5GAM e;  4N0A C;  4JLI A;  2OAU A;  3OB9 A;  3QZ5 B;  5J39 A;  1YJN A;  3CCL T;  4M7A C;  3GOX A;  2QI2 A;  2RI5 A;  2ZPH B;  1QVG S;  2DXC A;  4A4K A;  1BI1 A;  2PVG B;  2Q19 X;  2EQM A;  4TVR A;  2QA4 A;  2RO0 A;  2O4X A;  2F5K A;  5I2M A;  4MDW A;  2P4T A;  4C92 B;  3CC2 T;  2LCC A;  4M7A F;  2CS7 A;  3QZ9 B;  3P8D A;  2E10 A;  3QPH A;  5LJ3 h;  4XTU A;  1VQ9 A;  1G3W A;  2RHI A;  3J80 E;  3CF2 A;  2ZPE B;  1X01 A;  2L8D A;  3FPR A;  5FRO A;  2QQS A;  4F7U A;  2XDB A;  2E41 A;  4F7U G;  2XDD A;  1R7R A;  4PJO E;  3C95 A;  4RG8 A;  2DTO A;  2ZZD A;  3GNG A;  3G71 T;  4L5G A;  4Z02 A;  1WQ7 A;  3JCM c;  3OYL A;  1M9S A;  1ZHI A;  3QUI A;  2CZ7 B;  2R5M A;  3M5A A;  3WVE B;  3S3O A;  1Q86 U;  3MEU A;  4M78 E;  2LQK A;  4J6W A;  4BD3 A;  1FX7 A;  1Q86 C;  3CPW A;  4IUR A;  1G5V A;  3CCU T;  3EFR A;  2VGM A;  4BE2 A;  2M1H A;  4O6J A;  1VQP A;  4KUI A;  2E5Q A;  3LW5 E;  5IN1 A;  3LWI A;  5A0L A;  3OYC A;  1WPY A;  1VQK T;  4JUV A;  1E32 A;  4EDU A;  4BY6 B;  3MHX A;  1OI1 A;  3MP6 A;  1Y71 A;  3DB3 A;  2KVQ G;  4L6V 5;  5LL6 S;  3LGF A;  5LJ5 h;  3X25 B;  2RHU A;  3RMS A;  2FHD A;  5C1B A;  5CKH A;  2K2V A;  2BIV A;  3X28 B;  4JS4 A;  1LJO A;  1Q7Y U;  4PJO B;  2HD0 A;  4C92 D;  3SWN B;  1KQ1 A;  1NPR A;  3H8Z A;  3TU4 K;  1Q7Y C;  2GFA A;  3DLM A;  3EFS A;  4CRI A;  4E7I A;  1M1F A;  4O5V A;  3BFM A;  2RHZ A;  4QVD A;  4OGE A;  1NE8 A;  4GLK A;  4UC4 A;  3LGL A;  4BI4 A;  5GAO r;  4FT4 A;  3L1A A;  2LTO A;  2E6N A;  2ZPG B;  4R55 A;  1K8A U;  3PIO A;  3CD6 A;  4M7D A;  4M7D G;  5DYG A;  1K8A C;  1WJR A;  4HCZ A;  2GF7 A;  4A4E A;  2K5F A;  1W2B S;  5B6C A;  3JB9 I;  3L42 A;  4IUU A;  3R6O A;  4JDS A;  4ME7 A;  4XTV A;  1KG1 A;  1OZ3 A;  1UEB A;  4C0F A;  4XAX B;  2BUD A;  2MWP A;  4M78 G;  4EMK A;  3OS2 A;  1QVG A;  2JN0 A;  5KE2 A;  5GMK h;  3FLG A;  3OYA A;  1VQM T;  3PT9 A;  5HKC A;  1ZC1 A;  2I2L A;  2DK3 A;  3CCJ A;  2LT1 A;  2YLC A;  3ZGZ A;  2HNI A;  3OYB A;  3M54 A;  1O54 A;  4MML A;  4IUV A;  2PUO B;  2FVU A;  3JRZ A;  4HA8 A;  5EG2 A;  4C92 C;  3JB9 G;  2B25 A;  3A8H B;  5FTK A;  3PFS A;  4N4I A;  3FB9 A;  4X34 A;  3VJP A;  4ZGJ B;  2KSS A;  2ZGW A;  4PJO D;  1CZ5 A;  2L5Q A;  3S3M A;  3CCE T;  3FC3 A;  1XTD A;  4C92 F;  2DXU A;  3E9F A;  4IUT A;  4NL3 A;  3AHU A;  1BYM A;  2RJD A;  4RCC A;  1Y7X A;  4OB3 B;  3OW2 S;  1YHQ A;  1VQ7 T;  3OBW A;  1VQ5 A;  4CQN A;  2HQX A;  3JCM X;  1YIT A;  1KQ2 A;  5I21 A;  3LYI A;  1YIJ A;  2G3R A;  2ZPB B;  4IUQ A;  2QTX A;  4PLL A;  5GAN h;  3OYH A;  2H3J A;  2GFU A;  5CQX A;  2K4Y A;  5GAN 6;  3J81 E;  1O75 A;  5I2S A;  3EAE A;  3A8O B;  4B9X A;  4NOY A;  2ZCF B;  4N4H A;  3SD4 A;  3CME A;  5FTN A;  4NL2 A;  3L2Q A;  4FT2 A;  4ZGE B;  3CCS A;  1D3B B;  3QJY A;  3CBO A;  4BI3 A;  3CPW S;  2HQE A;  2X4J A;  4N0A A;  5LJ3 d;  1VQ6 T;  3HPW A;  1VQ4 A;  3OMG A;  1N9R A;  2EQU A;  4PJO C;  2K3X A;  1KHI A;  1VQ8 T;  3GP8 A;  4HT8 A;  4PKC C;  4OP0 A;  3CXC S;  3KXT A;  2P0Q A;  3UPU A;  4M7A A;  3TIW A;  3SWN C;  3CC7 A;  3M57 A;  4NS5 A;  2DPP B;  2RB6 A;  1IZ6 A;  2PVO B;  4M75 G;  4M75 A;  4F7U E;  3OSS C;  3RKW A;  2L3R A;  2DO3 A;  4E7K A;  3FPT A;  4PJO F;  3DKM A;  5GMK m;  1YJW A;  3QQ8 A;  1Y07 A;  4FSX A;  2QXF A;  3HFN A;  3S6W A;  3UDC A;  1W2B A;  3QDR B;  5GAN 5;  3ZJV A;  2R5A A;  2X35 A;  2IVW A;  2LX9 A;  2YVL A;  2E12 A;  4DOV A;  2XID A;  4QQD A;  2EQJ A;  1H64 1;  1U1S A;  4DOW A;  5EPP A;  2E70 A;  3E9G A;  3A8G B;  3HRT A;  4BDZ A;  3JCM h;  3I55 A;  2O4X B;  3L2R A;  3J7A F;  3CCQ T;  1I5L A;  4KDL A;  4DQ2 A;  4ARI A;  1JB0 E;  5DLO A;  2VXE A;  3G6E T;  1M1G A;  2QEX A;  4BE1 A;  1KQS S;  3CC4 A;  3LLR A;  3MEA A;  1ZQ1 A;  4F7U B;  2LW6 A;  2RJC A;  4LD6 A;  4KT0 E;  5GAM h;  4OVA A;  3I56 T;  3RIR A;  1VQL T;  4BI8 B;  1GXI E;  1PSF A;  4XTW A;  4BB7 A;  1U8R A;  3FJP A;  3GF5 A;  3V7R A;  3VYH B;  2LDM A;  2YHT A;  3QXE B;  2CYZ B;  1UGQ B;  2MWO A;  3OW2 A;  2P0P A;  3BY7 A;  5C18 A;  2YLB A;  3T9N A;  5HK0 A;  5AYF A;  3OS5 A;  1BKB A;  5FRN A;  4E7J A;  3QHS A;  4M7D E;  2DTI A;  3M58 A;  4M77 A;  4M77 G;  5A0G A;  3G7Z A;  3OYG A;  5CKE A;  2PU9 B;  1VQO T;  1S72 A;  2CZ0 B;  1VQN A;  2OTJ A;  3QWZ A;  4RMO A;  3QSU A;  2DEQ A;  5LJ3 g;  4KO8 A;  3JCM J;  2WSE E;  5KH6 A;  3HKS A;  1YIJ T;  4RV0 A;  1M4Z A;  3PTA A;  3G4S T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...