5D6XA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6xA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6xA02
4BE1A 2EQUA 4ZTJA 1WGSA 2MWOA 2X4YA 3NTKA 3P8HA 1WJSA 4N4IA 2L3RA 4C5IA 2MWPA 3QIIA 1OI1A 4QQDA 3OYNA 3OA6A 4QQGA 3OS1A 2GF7A 3QBYA 3QJ6A 2RJFA 3OYKA 5D6XA 4QW2A 5CIUA 3OY9A 3GOXA 3LX7A 1G5VA 2RHIA 2O4XB 2M0OA 2YRVA 3O8VA 3L42A 2E5QA 3FLGA 3PMIA 2RJEA 3ME9A 2R58A 3MP6A 4A4FA 2JTFA 3DB3A 4PL6A 3OYLA 2RHXA 5D6YA 2WACA 4B9WA 4A4GA 3H8ZA 3LGLA 4II1A 3H6ZA 4A4HA 2XK0A 3S6WA 4ZTFA 3KUFA 2QQRA 3E9FA 4FL6A 3L2WA 2K3XA 2L89A 2LTOA 2O4XA 3CEYA 2R5AA 3OB9A 4IURA 3OYFA 5FROA 2EQKA 2DAQA 3LYIA 3PFSA 4GY5A 2K3YA 4QVZA 5KCOA 2X4WA 2D9TA 4OVAA 3ZEHA 3FC3A 2F5KA 3OMCA 4PLLA 4EDUA 5KH6A 3OYMA 5C0MA 3EAEA 3Q1JA 4Q5WA 5IAYA 5J39A 5FRMA 2HQXA 2P0KA 5KE2A 1OZ3A 3META 4UC4A 3S3NA 3DB4A 1WJRA 2BKDN 3MO8A 4RG2A 1H3ZA 3OS0A 2RJDA 3E9GA 3OYEA 2JZ2A 3OYGA 2EFIA 2XDPA 4BE0A 2RI5A 3QKJA 2CKKA 2G3RA 2DIQA 3L2VA 4IUPA 2EQMA 4N4HA 3OMGA 4E7KA 1N27A 4L59A 4E7LA 2LRQA 5KCHA 3M9QA 3F70A 3NTIA 4QQ6A 3OYAA 3MEAA 2GFAA 3MEWA 2RHZA 4A4EA 4C5GA 4IKFA 3MP8A 1WJQA 3OYBA 2IG0A 2LCCA 4C5EA 5M9OA 2DIGA 2RJCA 2L8DA 2LDMA 2RHUA 3ASKA 4Z02A 3PMTA 2LVMA 3BDLA 2M1HA 4BD3A 4CRIA 1OZ2A 2NLUA 3OQ5A 3LGFA 3OYCA 3OYJA 4BACA 1SSFA 1XNIA 2E6NA 4NS5A 3OYHA 3L2RA 5J26A 2EQJA 1MHNA 4IUTA 2GFUA 2QQSA 2RHYA 3PNWC 3UT1A 3DLMA 3OYIA 4E7HA 4FU6A 2RI2A 5FRNA 4BDZA 4IUUA 5D6WA 3L2QA 3FDRA 2FHDA 3FEOA 3LLRA 2HQEA 4HCZA 3OS2A 4X34A 4N4GA 4PLIA 4BDYA 3OYDA 2B8AA 2RO0A 3MEVA 2PQWA 5C6SA 2BUDA 3S3OA 2EKOA 2R57A 2X35A 3MEUA 4LD6A 3LH0A 3S3MA 3MP1A 3SD4A 3UWNA 1KHCA 4B9XA 2BIVA 2M16A 2VYTA 3P8DA 3L2UA 4E7JA 5KE3A 4IUVA 4IUQA 2R5MA 5IN1A 1RI0A 2RI3A 3C4SA 1OYXA 4C5HA 2X4XA 3NTHA 4E7IA 4BE2A
chains in the Genus database with same CATH superfamily
2JM9A 4PNOA 2DEUA 3VS5A 2K5IA 5GANd 3VS1A 2A36A 4J6WA 4QQGA 1MMDA 1TUCA 1H8KA 2V1QA 1WXUA 3HU2A 3OY9A 4OGEA 1ZSZC 2O01E 2R58A 2VGMA 3MP6A 1TXQA 2JMCA 2DE0X 5D6YA 1FMKA 4OMOA 3CPWA 4XU2A 2NUZA 3DLLA 3A8LB 4Y28E 2ZPHB 3TVTA 5CCXA 3SEMA 5LJ5h 3L2WA 2M51A 2R5AA 5B6CA 1NG2A 1AT1B 1YJWA 4PJOC 3JCMW 3JB9I 1WHGA 2D9TA 4J6XA 1ZUUA 2CZ6B 5GMKi 1MMAA 1OX9A 2OTLQ 1YJ9Q 2HQXA 3V7RA 5KE2A 4M7AE 2YWWA 4FW1A 3HRUA 3WXMB 3SB2A 4LDUA 4ZGDB 3OS0A 3OYEA 1PNJA 5EG2A 3A8GB 2EFIA 3QWZA 2KYBA 1BI1A 2QA4T 1I5OB 3EFOB 2DXBA 3I56Q 4KGVB 1M90R 5GMKm 4M7AC 3H0FA 3NTIA 2OTLT 5CD1A 1YJ9T 1K73C 3OSVA 5GAOp 1K4US 1WJQA 3OYBA 1I8FA 1VIFA 2RHUA 3G6ET 4RUGA 1OEBA 2NYSA 3U23A 3MKDA 2ZPIB 4LXCA 4AMCA 1PHTA 1Q7YU 4F7UB 4FM4B 1GFDA 3CXCP 1KC8C 2B8AA 2KY9A 6AT1B 3LH0A 2B25A 3VV0A 3UA6A 4BY6B 1B7TA 4DBHA 1ZX6A 2CP3A 2CT4A 4IUVA 3A8MB 2NUTB 4XQ3A 3CCUT 3RKYA 2RQVA 3CC4Q 3CMAQ 4AFQC 1NE8A 3P8HA 2O2OA 2V8IA 1OPLA 1RUWA 2MWPA 3BFMA 1V76A 2EYZA 3UDCA 2YUPA 2WSCE 4WF2A 4MZTA 2JS2A 4O5VA 4J9BA 1WHMA 5GAN5 4HT8A 2K2VA 2JW4A 4C8QD 4ELZC 4LDXA 2XG8D 4ARCA 5CCAA 3X26B 2EGCA 1QVGA 3THKA 2QYZA 2LTOA 1D0YA 1AVZC 3UF4A 1EIFA 4E47A 3V7SA 1UG1A 5GAMj 3OYYA 3CD6Q 2DXCA 2M9UA 1PRMC 2A08A 1VYUA 3ULRB 3C0CA 4LDYA 4F14A 4FYYB 3JCMg 4M7AA 3FRNA 5KYXB 4AS1A 2LNVA 2IIMA 1NLOC 3M0SA 1UGQB 3I5RA 2ECZA 1VIEA 1C1AA 1YI2A 4LUDA 1M8MA 2JTEA 2PVOB 4C5EA 1X27A 1CZ4A 4YTLA 3ASKA 3TREA 3CCVA 1X43A 2CREA 3OYJA 1OZ2A 4BACA 4M75E 3BDUA 3DKMA 1GL5A 1IHWA 2FHDA 4EMGA 3S3OA 3MEVA 5C6SA 1Y96B 4ME7A 2X35A 3JCMQ 2DD5A 4J9IA 1PCXA 2AIRB 1FWZA 2HNIA 3MJXA 5IHKA 2XDDA 1BI3A 2RI3A 1UTIA 3VS3A 2CUBA 3X28B 3VU3C 2ZCFB 4EPCA 3H41A 1YJWQ 1RAEB 3PIOA 2L3RA 5KYWB 1Q95G 4RTXA 1BB9A 1FMVA 4HKEA 1QP3A 5D6XA 1YBYA 2RHIA 1WZOA 1BIBA 2CH4A 3OYLA 2DNUA 1YJWT 1T0JA 2DLPA 1RADB 1X6BA 2MYSA 1VQNA 5I11A 2H8HA 4HVVA 3KUFA 4R0KA 5KYYA 2YUQA 1KIKA 4IURA 5FROA 2SEMA 4OP0A 2CH4W 5GLFA 4GBQA 2EKHA 2EYWA 3G4SA 3BE3A 2CP7A 4AFSC 2VVKA 5AYFA 5GMKj 1MMGA 3CPFA 2X9HA 1RLQC 4KGXB 1KG1A 3C94A 2LZ6B 4KH0B 1UEBA 1IREB 5LJ5g 4N4HA 2A3LA 4E7LA 2E1HA 4F04B 3UPUA 2G6FX 1BCMA 2MOXA 1E6HA 1Q7YR 1WI7A 2HAXA 2KROA 5CK9A 5GAN7 1BK2A 2O9VA 2L8DA 4J5YA 2LQNA 2KGTA 2PUKB 2RMOA 1WHLA 1SSFA 1GCQC 2DL7A 4IUTA 3PNWC 5A0DA 1Q81U 1Q82C 5FLXE 2O9SA 2JT4A 2QXFA 4M75A 1WIEA 3QUIA 3GLXA 5J3BA 5A0GA 1S3SA 1QW1A 1RLPC 1SHFA 2K6DA 1K8AR 2DKGA 4HCBA 2RB6A 2A7YA 1OYXA 2XU8A 5GAOl 1VQ7A 1M27C 3SHWA 2X3WD 3OW2S 1WNLA 4XK8E 1VQ5A 1M2VB 2Q19X 2EYYA 2DTIA 4CC2A 1M1KC 1PC0A 3L42A 2WSEE 2EJ9A 2KSSA 2DZCA 2FRWA 1N9SA 5IXFA 1KK7A 4A4GA 4JZ4A 2DYBA 1YI2Q 2CDTA 2OTJA 4JJBA 1W2BP 2X4WA 4OVAA 2JN0A 2MF2A 1KD1U 3CCVQ 3EAEA 3GP8A 3OSSC 3TIWA 5LJ5j 1EFNA 2DPPB 1YJNT 1SKUB 1NBEB 2MCNA 2P4RA 1O75A 5KYUA 4C92E 1YI2T 1EX4A 4M7DE 2LCSA 1YITT 2G3RA 2D1XA 2ROLA 2CS7A 2KXDA 4KLNA 4J83A 3SFMA 4EMHA 5FU6B 2E12A 2VASA 2GQVA 2PNIA 1VQPA 1BI0A 1TUGB 3I55A 2QQAA 3REBB 2KEAA 3V8LA 1X2KA 2ENMA 2D0NA 1CSKA 2IPOB 3A8OB 2KI7A 3E1SA 5FTKA 5FTNA 4J9EA 5FTMA 1WXTA 4ZGJB 1VQNQ 2QDYB 2JM8A 4HCKA 4NL2A 2X4XA 3NTHA 1VQKA 4M78F 2BZXA 2QGFB 5GANh 3MHXA 3RESA 5LJ3g 1I4K1 4Z8AA 2Y90A 2VV5A 2BTTA 3RERA 3A5ZB 4DEXA 3UA7A 3RMQA 3OS1A 2F2WA 2NUPB 4XTYA 1WLFA 4MDXA 1JJ2S 1YCYA 4RV0A 4M78B 4DBRA 2KBTA 1VQNT 3ZBDA 2GNCA 1K73R 5EPPA 3CXCA 1ARKA 2X3XD 5GAN2 3SWNA 1J3TA 3DB3A 3QG1A 4C92G 1WX6A 4M7DG 5EQJB 4FYWB 1QKWA 3G4ST 4D8DA 1FMWA 1NJIU 2DFUA 1M3CA 5CKDA 5CQYA 3OYFA 4M77F 4JPBW 3LYIA 1KC8R 2F2VA 4PFPA 2E5KA 3TSZA 4X1VA 3EHRA 5C0MA 3EGUA 1G3YA 4AFZC 4C0ZA 1GBQA 2FB7A 4RG2A 5GAOm 2VXEA 1VA7A 1KQSP 1K0XA 5CKFA 2LMJA 3JCMf 1KSWA 4OMFB 3N5BB 4C92A 1Q81R 4M7DA 2MMPA 1MV3A 3OYAA 4RCBA 1RAFB 2ZPFB 1LJOA 1VQ7Q 2EJFA 2P4TA 1I9GA 3QYGB 2M1HA 4RMOA 3CC7A 1T3LA 3OYCA 3CCMT 1VQ5Q 2PZ1A 3M0UA 4Z89A 3L2RA 5J26A 2AZSA 3OYIA 4J9GA 2RI2A 4X34A 1D3BA 4FIBA 2RPNA 2Z0WA 2DD4A 1MNDA 4ZN1A 2XMFA 2CSQA 4KGZB 1N6AA 3SD4A 2LQ8A 1P92A 5KE3A 1QVPA 3HU3A 1VQ9T 1VQ5T 2LX9A 2PTKA 4PJOF 3INZA 1Y07A 5EC7A 1ZBJA 2OTJQ 2ZPEB 3MCAB 3LH5A 4KULA 2LQWA 2ED1A 2YUNA 4C8QE 1TG0A 2DXUA 3JCMe 1G5VA 3H0IA 3HFNA 1VQMA 3NHNA 2RH2A 3FLGA 1WHKA 3PMIA 4LUEA 5IHNA 2DF6A 3CCQA 4Y91A 1KD1R 4BI3A 2ZAEA 1M2OA 3JCMJ 3H8ZA 4BI4A 3JB9J 3MB5A 1MGQA 3ZJVA 4FSXA 4XTUA 5DLQE 4M7AB 4IIMA 2F2XA 2D6FA 1VQPQ 2LJ3A 2DJQA 3I55Q 3OYMA 1Y0MA 4KRTA 4BUGA 2WSFE 1D09B 4B6MA 3WVDB 1G3TA 1KQ1A 2LJ0A 2L3PA 2CKKA 1SPKA 1VQPT 3F70A 1Y7XA 4ATOA 1ZA1B 1VQKQ 3CCRA 4DA4A 1NYGA 2COWA 2ED0A 1S72Q 2B86A 2K79A 1G2BA 4M77G 2KRMA 2Q1CX 5GAMg 4TVRA 3M0RA 1T3SA 4JS5A 4OB3B 4C8QG 4KH1B 4PJNA 2A37A 1O54A 1UHFA 1QWEA 2XI9A 1ZUYA 4AT1B 4F7UF 1AWWA 1N8RU 1DJ7B 1MNEA 1Q86U 4E7IA 5HY6A 2JOYA 2YUOA 3I56T 1AWXA 1WJSA 2HKNA 4N4IA 2DVJA 1UB4A 4M78D 1V29B 2J06A 3CBOA 3JCMd 2QEXQ 4QQDA 1VUBA 1VQOA 1PD0A 1NJIR 2C0OA 5I2MA 4MZPA 1X01A 2ZPBB 5LJ5e 5D7UA 1XTDA 4C8QA 2CP6A 4F17A 1SG5A 2FO0A 1UGSB 5GANg 2HD0A 4D8KA 1VYTA 3E9FA 3BQBA 1Q82R 2LT1A 1UGPB 2OX7A 1VQ8Q 2DAQA 3PFSA 2K3YA 5C18A 1K8AU 4M77D 3C12A 3CC7Q 3Q1JA 4UC4A 3S3NA 3CC4T 3TQ7P 3CMAT 4OF1A 1OV3A 1ABOA 2RJDA 3OYGA 2DZ9A 5GJVB 3OBWA 1LOJA 3QKJA 5I21A 1RI9A 3RUXA 3OMGA 1U06A 5CKHA 1W1FA 4J9HA 1NEGA 3EGXA 2BE9B 1WPYA 1B34A 3VS6A 2X4JA 1GXIE 4RKUE 1M1KR 3HRTA 1BCOA 2PVDB 2LCCA 1W2BA 4M75B 2RJCA 1K9MC 2DL3A 4K11A 3I5SA 4BD3A 2RQRA 3URGA 3EGDA 4CC4B 2M0YA 2SRCA 3RIRA 2CGHA 4A4KA 4E7HA 1PD1A 4FU6A 1NYFA 1VQMQ 2RA2A 4N4GA 1H3ZA 2DEQA 2R57A 3CCQQ 2CZ1B 1X69A 3MP1A 3CD6T 2W0ZA 2FL7A 4M4ZA 3L2UA 1AOJA 2DRKA 3TCJA 4OB2B 2E70A 4C5HA 1NPRA 3QZ5B 3VS4A 2X4YA 1MUZA 1VQMT 4PJOD 1I1JA 1QVFA 1UHCA 5LJ3f 3CPWS 1TU0B 1QCFA 4RTYA 2AK5A 2ROTA 4AG2C 1U1SA 3HKSA 5GANj 3QO3A 4BB7A 2DO3A 4M75C 3ME9A 1UE9A 1HYOA 2JMAA 1BYMA 2ABLA 4PKCC 4LE9A 4XTVA 2AT1B 3I9QA 2CP5A 3GF5A 3HP9A 4DOVA 3H6ZA 2KAFA 1FYNA 2DMOA 1GBRA 5KYUB 2MAMA 4F7UG 4HA8A 3QWYA 2FPDA 3EG9A 4QVZA 3MPUB 2VKNA 3V8JA 3CCRQ 2RF0A 1PG5B 2RD1A 3G1JA 1TUDA 1VQ4A 5CVIA 1LPLA 1PSEA 1ZQ1A 3EFOA 1XOVA 1W4SA 1G3WA 2OI3A 1WQWA 2E65A 2XDPA 1UUEA 2RI5A 3CCRT 4FYVB 3EHQA 4QT7A 5C1BA 1WHHA 1K73U 5DLOA 4CC3A 5LJ3e 3FJPA 3EH2A 2DM1A 4A63B 1T0HA 2E3HA 1UJ0A 3QDFA 1I0CA 4FCYA 3JCMV 1WQ7A 3M0PA 3VJPA 2MK5A 1N8RR 1VQOQ 1TTHB 2GBQA 3EH1A 3UT1A 1Q86R 2QQSA 2DETA 4GLKA 1KC8U 1WYXA 2HL5C 4PLIA 2NUTA 4XAXB 2Q1DX 1G3SA 2EYXA 4WCIA 2FYKA 3P8DA 1D1BA 3EG2A 1ACMB 3RKXA 2R5MA 2LJ1A 1EZZB 4OMNA 3NGPA 1YFNA 2YRDA 1Y57A 3JSCA 2MI6A 1PKTA 3E2UA 2GGRA 1YP5A 3QSUA 3OYKA 3RNJA 2IVWA 2VUBA 1SF9A 1XQHA 1QVGS 3O8VA 2JVVA 2YSQA 4HVUA 5FU7C 1X6OA 2H3EB 3VRZA 1E7OA 2COZA 3QDRB 3S6WA 4ZTFA 4RCCA 4V2SA 1K0SA 1OU9A 1D0ZA 2K3XA 2O4XA 1VQLA 3QQ7A 3REAB 2E41A 2PU9B 2K7AA 1JXMA 3ER0A 3ZEHA 1BI2A 7AT1B 3VYGA 2AKLA 3OMCA 1M1GA 1CKBA 4LNPA 3JAME 3META 4DOWA 3LHDA 1CKAA 2DJZA 1K9AA 5A0LA 5DY9A 3RR6A 3E9GA 1PM3A 3SWNC 5LJ3d 2FEIA 3L2VA 2OAWA 1TH7A 2A28A 3I35A 3JB9H 3MEWA 2CZ0B 2RHZA 3CCLA 3H9NA 1QVFS 2LX7A 2XIDA 2XHCA 1LCKA 2LDMA 1BBZA 1RAIB 4DEYA 2HEQA 1V1CA 2DILA 3A1PA 2VGNA 2MPXC 3LLRA 5GAMf 2C0TA 2E3IA 3TEEA 3OYDA 4PJLA 2YVLA 4RTWA 3CCVT 3OW2P 1K76A 4LD6A 4AG1C 2L5QA 3NPFA 1R0BG 3R6NA 1QWFA 3TSWA 1QLYA 1TSFA 4MMLA 2HBWA 4C92C 2V8JA 3D7SB 4ARIA 1OPKA 4M7DC 4C0DC 5A2QE 3G71A 3C4SA 1YHQA 1X6GA 3NFCA 2KT8A 5AT1B 5FTLA 1OI1A 1X75C 2FZCB 1VQ4Q 2FZGB 3LX7A 3QWXX 1WDXA 2E5QA 1Z9ZA 2M02A 2AHJB 4A4FA 4ELYC 3JB9F 2YDLA 1UJYA 1N9RA 2RHXA 2GQIA 2PJHB 2D0QB 4FT2A 3LGLA 1S72A 3JV3A 1VQ4T 3OB9A 1IXDA 2BZYA 4DBFA 5KCOA 2DVEA 1OX8A 3LW5E 3VS7A 3R6OA 1RACB 5GAMe 3PVQA 2K5FA 3ZGZA 2QA4A 1LVKA 1AD5A 4Q5WA 1OOTA 3M57A 4J9FA 1AHJB 1R7RA 2QK0A 3TU4K 5FW9A 1WXBA 3GNGA 1ZC1A 2FVUA 3QHSA 4BE0A 2EVRA 1JEGA 1M3AA 3G6EA 2EQMA 4XTWA 2JTMA 1NEBA 1KJWA 2RN8A 3PGGA 5KCHA 2E6ZA 1SRMA 2LC4A 3QC8A 4KUIA 1JQQA 2QEXA 4IKFA 4PJJA 4JZ3A 3EG1A 1VQ6A 2HMAA 4FSSA 3OQ5A 3LGFA 1ZLMA 1UGRB 1IB8A 1Q82U 4PK4A 5GAN8 2RHYA 5IH2A 2MM2A 3CCUA 2ESWA 3FDRA 4HCZA 1Q7YC 1AWOA 4ANJA 3FPUA 3MEUA 2QI2A 4DBQA 3J7AF 1IHVA 2QGGA 4BI8B 2BIVA 4M78E 2M16A 1JJ2P 1VQ8A 4EMKC 4VUBA 2L3QA 1S1NA 2RNAA 5GAN3 1M2VA 4BE1A 1VQLQ 2EQUA 2PUOB 4O6JA 4ZTJA 3JCMh 4LDWA 4JRQA 1JO8A 2W10A 1R8OB 4JJCA 3RMSA 1M1KU 4N0AA 1RABB 1AWJA 1VOMA 1VQ7T 2YRVA 4J7FA 3O5ZA 3GPLA 3SDZA 2JTFA 2LT4A 1WFWA 1K9MR 2DBKA 1IRXA 1XJWB 4R56A 4OMQA 4A4HA 4M77E 2XK0A 2EW3A 5CO7A 1FXXA 1PSFA 1YNZA 2RQUA 2QQRA 2LP5A 3UATA 5GAMd 4J6YA 2KYMA 3CCLQ 2RM4A 3QXEB 4GY5A 1ABQA 4FW2A 3X24B 3FC3A 4FYXB 3CCJA 3J80E 3KBGA 5GMKe 3C95A 4M77C 1OZ3A 2JS0A 3M53A 1B34B 4P5NA 9ATCB 5L23A 2OTJT 4PFZA 4M7AF 1O9SA 4C8QC 4X9CA 3CCLT 2ATCB 2P84A 4GLMA 3FJ5A 4E7KA 3JB9G 2LRQA 1BU1A 3HSBA 2E4HA 2KRNA 3MEAA 2XD0A 5CCBA 4M78G 3G71Q 3FPRA 4A4EA 1YHQQ 2LW6A 3RDVA 1JB0E 2K3BA 2EQIA 1D1CA 3OYHA 2GFUA 3VKIA 3WVEB 4DQ2A 2O31A 4JJNK 4JLGA 3L2QA 1JU5C 2ZGWA 3G71T 3VRYA 3I55T 3QPHA 4EMKA 1SRLA 5LJ5f 2ZZDA 1YHQT 2XDBA 4PJOE 4QVCA 1HXDA 2KE9A 2NWMA 2NUPA 2EPDA 5HCKA 4M78A 3CXCS 2H3JA 2E64A 1YN8A 3QIIA 4OMMA 2QA4Q 2K9GA 3QJ6A 1E6GA 4QW2A 1VQKT 2DRMA 3JCMX 2E10A 2OAUA 1D0XA 3QZ9B 1S72T 1SSHA 1UDLA 3HPWA 3EG9B 2I2LA 4ESRA 1M8VA 1ZA2B 1SEMA 4B9WA 3M5AA 3G6EQ 2CUDA 4II1A 3JB9D 1QMCA 4FL6A 3E19A 1IGUA 2I0NA 1HK9A 3CEYA 4F16A 1JXOA 2CP0A 2JJ9A 4M77A 4XU3A 1VQ6Q 4EDUA 5KYYB 3OS5A 1QP2A 2YRCA 2MM0A 3CCUQ 3VUZA 4CQNA 2QEXT 5GAN6 1VQ6T 3BY7A 3HRSA 3GBQA 4QQ6A 2DYIA 4E2FB 4PJOG 2RK1A 2QAZA 2IG0A 4HXJA 3CQTA 4CRIA 2V1RA 1VYVA 2E6NA 2EYQA 2F5TX 3BW1A 4JS4A 3HHTB 1TWBA 4LDVA 4CC7A 1VQ8T 3HFOA 1PRLC 4M75F 4QKUA 3FPTA 4OGCA 3FEOA 1Q81C 1ZSZA 2COYA 3T9NA 4XU0A 4XU1A 4F7UE 1M30A 2EKOA 3A98A 3EG0A 2KNBB 4MMKA 3CC7T 2DK3A 4M7AG 2EJGA 1U3OA 2CP2A 4J7IA 2L2PA 4IUQA 5IN1A 4AQ7A 1PWTA 3V8KA 4PJOA 2DL8A 2LQKA 3PIPA 5CAIA 2CYZB 3CCJQ 4Z88A 1QCSA 3QQ8A 8ATCB 1AEYA 4E7SA 2V8KA 4BY6C 1IO6A 2O4XB 2M0OA 1YIJA 1OU8A 2GTOA 3M0QA 4Y92A 3OW2A 2Y4XA 4A53A 3OBYA 2MIOA 1D1AA 3KFVA 2Q1AX 2FPFA 3CCJT 1YCSB 1YJNA 1GCPA 2P0PA 5I2SA 4OMPA 5LJ5d 3CCQT 1NM7A 3EFRA 3CCSA 1YITA 5IAYA 5FRMA 2DTOA 2P0QA 4FT4A 1KD1C 2K2MA 2EWNA 2X51A 3CF2A 3ZJTA 2J6FA 4QVDA 3MO8A 2GCXA 5LJ3h 2K5LA 3PT9A 3VS0A 2JV2A 4L6V5 5I22A 4KUDK 4M7AD 1U8RA 5KYNA 2KXCA 1AZEA 1N27A 5CR2A 1K1ZA 2ZPGB 2QTVA 3L2ZA 4J9CA 3ZFJA 1H3HA 2KT1A 3HU1A 1NLPC 2JUFA 4C5GA 1ZBXA 3H0HA 3PMTA 4OB1B 4CI0C 2KVQG 1W70A 3PTAA 4J8OA 4D6WA 5GAOq 2F69A 1KHIA 2EQJA 2PVGB 1UECA 4BDZA 1C0MA 3OS2A 1CR5A 1H92A 4BDYA 3GIBA 1QCOA 2C0IA 3JCMP 1HSQA 2CSIA 1AZGB 1SHGA 2KRSA 3CPWP 3VS2A 3X20B 1MMNA 4B9XA 2K57A 1NPPA 4PFOA 4F7UA 1BKBA 2QQBA 1Y71A 4RTVA 3CCEA 5FU7B 2JNGA 3HTRA 2QG9B 4HCCA 1M90C 1H641 1B3QA 2DXTA 1KQSA 2EGAA 2GF7A 1RAGB 2HKQB 2D8HA 1GRIA 5HK3A 1M3BA 1TS9A 4M75G 1RAHB 2FG0A 4KDIA 2KK4A 5FWCA 1VQOT 3J81E 5FWBA 1JJ2A 2HDAA 3M0TA 4NOYA 1TOVA 3SWNB 2D8JA 1B07A 1OULA 1NJIC 2EBPA 3L1AA 2HCKA 3ZL7C 5J39A 4NL3A 1JBMA 4XTXA 2YLCA 2BKDN 3QJYA 1ZSGA 2FZKB 3CC2A 2QQ9A 1W2BS 4KBMB 4C92F 4IUPA 1G8XA 4M7DF 4R55A 4E6RA 2HQHA 5DYGA 1E32A 3CCMA 1F1BB 1A0NB 8AT1B 4EIKA 1K9MU 5CKBA 4HVWA 2J6KA 5KYXA 1M5Q1 4C92B 4MZMA 4ZGEB 4M7DB 4C0DB 1RL2A 1I07A 1XNIA 4ORZA 2J7IA 2XKOC 4JLIA 1MHNA 3M58A 3G7ZA 5ERGB 2VC8A 3DLMA 4PJMA 2HL3A 1VQ9A 5D6WA 1RAAB 2HQEA 4XTZA 1YIJQ 3KXTA 3CMEA 2RQTA 4M75D 2YT6A 1IZ6A 2KMTA 3LGAA 3UWNA 1BIAA 1KHCA 4JDSA 3GNFB 5HKCA 4E7JA 1D3BB 1QVGP 2L3SA 1RI0A 1YJNQ 4RTZA 3X25B 3AHUA 2DL5A 1WHJA 2MWOA 3NTKA 1Y96A 3AT1B 1YIJT 2QTXA 2HSPA 4LN2A 5ECAA 4C5IA 2DBMA 3CCSQ 2YXYA 1YITQ 3OYNA 3M59A 2OJ2A 5CIUA 3GOXA 2Q18X 2LNHB 1YWOA 4RG8A 1KQ2A 2DL4A 2AKKA 3PVLA 4PL6A 5KYWA 1U1TA 1IGQA 2DX1A 2WACA 2C06A 1JRIA 5GAMh 4KO8A 4JRKA 3CCST 2Y4YA 1I81A 1NZ9A 2L89A 4IIOA 4JUVA 5LL6S 2RQWA 4L5GA 4MDWA 2PWYA 3CBPA 4PLLA 2L0AA 5KH6A 4N0AC 2P0KA 4WTOB 2EIFA 1GCQA 1UFFA 3ZJUA 1WJRA 1QVFP 1Z9QA 4JJDA 2VB6A 4ZN3A 2K4YA 3LWIA 3M56A 1C6VX 1PKSA 1M9SA 1KFZA 1QKXA 2CT3A 4J9DA 2YLBA 5L8RE 3V7CA 5GANf 2XICA 2VWFA 1M4ZA 1X2QA 3M9QA 3M55A 1I5LA 2BE7D 3FIFA 2DTHA 1M1FA 3MP8A 2YUJA 2HSEB 3CCEQ 1KQSS 2DIGA 2J05A 4Z02A 2FRYA 4X9DA 4EMKB 2OTLA 2NLUA 1YJ9A 1UGVA 2DERA 1M90U 1ZHIA 3LWHA 3G4SQ 5FRNA 4KDLA 4IUUA 5GJWB 2VXFA 2AZVA 2RO0A 3QYHB 2PQWA 5FU6C 2BUDA 4E7ZA 3I56A 3CCET 2JXBA 4KT0E 2KR3A 1HD3A 3RKWA 2V26A 3VUBA 1N8RC 2A0FB 4C0FA 1Q86C 1WGSA 2YHTA 2HBPA 1QCNA 3EFSA 3VYHB 4RTTA 2O88A 3OA6A 5GMKl 2RK2A 3P8BB 1OQKA 3QBYA 2RJFA 3PE0A 5CQXA 4OB0B 1HJDA 5GANe 2EGEA 4C8QF 3A8HB 3HL8A 2RJEA 4OMLA 4A54A 3JCMb 2BZ8A 3CC2Q 4M77B 1FX7A 1R0CB 1GFCA 1G83A 2FPEA 1WLPB 3CCMQ 5GMKh 4ZNXA 4C8QB 1W6XA 2QASA 3CMAA 3CC4A 2F1LA 3JRZA 5FTJA 2EQKA 4M78C 4RTUA 2F5KA 3IQLA 1QQJA 3CC2T 1K8AC 3M4GA 1WA7A 2CZ7B 3DB4A 4AFUC 3M4YA 4JRPA 1VQLT 1R77A 2LCLA 5IHIA 1VQ9Q 2JZ2A 2KDSA 3JCMc 3CMEQ 3FB9A 2DIQA 2HZYA 4LD9K 4L59A 3RBBB 5IT9E 2J6OA 5DM7R 4C92D 3M54A 5LJ3j 2GFAA 4M7DD 5IXBA 4C0GA 3CBMA 1ZUKA 2KQWA 1ZSZB 2GTJA 5M9OA 3NMZC 1QDNA 3EGXB 2LVMA 3BDLA 3CMET 1U5SA 3CD6A 4NS5A 1MV0B 5GAOn 2EAYA 5CKEA 5DYIA 1YWPA 3EGDB 1N5ZA 4PJOB 4JRIA 5GAOr 4HT9A 3S3MA 5GAN4 5HK0A 3EG3A 2DA9A 2VYTA 1CZ5A 2QDLA 1LNXA 4KODA 4BE2A
chains in the Genus database with same CATH topology
3V8KA 5GANh 4PJOA 3MHXA 3RESA 5LJ3g 3JSCA 2LQKA 1I4K1 4PNOA 2MI6A 2Y90A 3PIPA 2K5IA 2VV5A 5GANd 5CAIA 2CYZB 3A5ZB 3RERA 1QCSA 3QQ8A 4J6WA 1Q81U 4QQGA 3RMQA 3OS1A 4XTYA 1WLFA 3QSUA 3OYKA 1JJ2S 1YCYA 2V8KA 4MDXA 2IVWA 2VUBA 3OY9A 3HU2A 4M78B 1XQHA 4BY6C 1VQNT 3ZBDA 1QVGS 2O4XB 2M0OA 1YIJA 3O8VA 4OGEA 5EPPA 2O01E 3CXCA 2JVVA 3I55T 2R58A 2VGMA 3MP6A 5GAN2 3OW2A 2Y4XA 3SWNA 3DB3A 3QG1A 4A53A 3OBYA 5D6YA 4C92G 5FU7C 1X6OA 4M7DG 3CPWA 5EQJB 4XU2A 3DLLA 3A8LB 4Y28E 2ZPHB 5CCXA 2Q1AX 3G4ST 3CCJT 3QDRB 3S6WA 4ZTFA 1YJNA 4RCCA 1NJIU 4V2SA 2P0PA 5LJ5h 5I2SA 3L2WA 2K3XA 2O4XA 5CKDA 1VQLA 3QQ7A 2R5AA 5CQYA 3OYFA 4M77F 2E41A 5B6CA 2PU9B 5LJ5d 1YJWA 3LYIA 4PJOC 3CCQT 3JCMW 3JB9I 3ER0A 2D9TA 4J6XA 3ZEHA 1BI2A 3EFRA 2CZ6B 3VYGA 3OMCA 5GMKi 3CCSA 1YITA 1M1GA 5C0MA 5IAYA 5FRMA 2DTOA 1G3YA 2P0QA 4C0ZA 2HQXA 4FT4A 3V7RA 5KE2A 3META 3JAME 1KD1C 4M7AE 2EWNA 3HRUA 3WXMB 4DOWA 3CF2A 3SB2A 2DJZA 3LHDA 3ZJTA 5A0LA 4QVDA 4LDUA 2FB7A 3MO8A 4RG2A 5DY9A 5GAOm 4ZGDB 3OS0A 3E9GA 3OYEA 2GCXA 2VXEA 5LJ3h 2K5LA 3PT9A 2JV2A 5EG2A 3A8GB 2EFIA 3SWNC 3QWZA 4L6V5 1BI1A 5CKFA 5LJ3d 2QA4T 4KUDK 3L2VA 4M7AD 1U8RA 2DXBA 1N27A 5GMKm 3JCMf 4M7AC 4OMFB 3N5BB 4C92A 5CR2A 3NTIA 2ZPGB 1TH7A 2MMPA 3L2ZA 2OTLT 4M7DA 5CD1A 3OYAA 1YJ9T 4RCBA 3ZFJA 3JB9H 3MEWA 1K73C 2CZ0B 3HU1A 2RHZA 2JUFA 3OSVA 3CCLA 1QVFS 2ZPFB 4C5GA 5GAOp 2XIDA 1LJOA 2XHCA 1WJQA 1ZBXA 3OYBA 2EJFA 1I8FA 1VIFA 2LDMA 2P4TA 2RHUA 3QYGB 1I9GA 3PMTA 4OB1B 3G6ET 4RV0A 2M1HA 4CI0C 4RMOA 3CC7A 2KVQG 3OYCA 3PTAA 3CCMT 4J8OA 4D6WA 5GAOq 2F69A 3L2RA 1KHIA 5J26A 2EQJA 2VGNA 2ZPIB 3OYIA 2PVGB 1Q7YU 4F7UB 2RI2A 4BDZA 4FM4B 3LLRA 3OS2A 1CR5A 5GAMf 4X34A 1D3BA 4FIBA 3TEEA 3OYDA 2B8AA 4BDYA 1KC8C 2DD4A 2KY9A 3GIBA 4ZN1A 3JCMP 2YVLA 3CCVT 4LD6A 3LH0A 1N6AA 3VV0A 2B25A 2L5QA 3SD4A 4BY6B 2LQ8A 3X20B 4MMLA 4B9XA 2K57A 4C92C 2V8JA 1NPPA 4ARIA 4M7DC 4C0DC 1P92A 5KE3A 4IUVA 1QVPA 5A2QE 3A8MB 3HU3A 3G71A 1VQ9T 2LX9A 3C4SA 4XQ3A 4F7UA 3CCUT 1BKBA 4PJOF 2QQBA 3INZA 3RKYA 1Y71A 3CCEA 1Y07A 5FU7B 3NFCA 1YHQA 1NE8A 2JNGA 2ZPEB 3MCAB 3P8HA 4NL2A 4KULA 4HCCA 2V8IA 1M90C 2MWPA 3BFMA 5FTLA 1OI1A 1X75C 1H641 4C8QE 2DXTA 1KQSA 2GF7A 2DXUA 3UDCA 5HK3A 3LX7A 3JCMe 1G5VA 2WSCE 3HFNA 1VQMA 4WF2A 2RH2A 4MZTA 2E5QA 3FLGA 4O5VA 3PMIA 2AHJB 4A4FA 4ELYC 5GAN5 4HT8A 3JB9F 3CCQA 4M75G 2K2VA 1N9RA 4Y91A 2RHXA 4C8QD 4ELZC 2PJHB 2D0QB 2KK4A 4BI3A 2XG8D 4FT2A 1VQOT 4LDXA 3JCMJ 4ARCA 3J81E 5CCAA 3H8ZA 3LGLA 1JJ2A 4BI4A 3X26B 3JB9J 1S72A 1QVGA 4NOYA 1VQ4T 3SWNB 3OB9A 2LTOA 1MGQA 3MB5A 1NJIC 3ZJVA 3L1AA 4FSXA 1EIFA 4XTUA 5DLQE 5KCOA 2DVEA 3LW5E 4E47A 3R6OA 3V7SA 4M7AB 2D6FA 5GAMj 5GAMe 2K5FA 3ZGZA 3OYMA 2QA4A 5J39A 4Q5WA 3OYYA 4BUGA 4NL3A 3M57A 1JBMA 1AHJB 4XTXA 2DXCA 2M9UA 2YLCA 1R7RA 2BKDN 2WSFE 3QJYA 3WVDB 3TU4K 4LDYA 1G3TA 3CC2A 1KQ1A 2QQ9A 3GNGA 1ZC1A 2FVUA 3JCMg 4M7AA 3FRNA 3QHSA 4BE0A 2LNVA 1W2BS 1VQKA 2CKKA 4AS1A 4KBMB 4C92F 4IUPA 3G6EA 2EQMA 4XTWA 1UGQB 4R55A 4M7DF 2JTMA 1VQPT 5DYGA 1E32A 3PGGA 5KCHA 1VIEA 3F70A 3CCMA 1YI2A 2E6ZA 2LC4A 3QC8A 1Y7XA 4ATOA 4KUIA 2QEXA 1K9MU 3CCRA 4IKFA 2PVOB 5CKBA 4DA4A 4C5EA 1CZ4A 4YTLA 1VQ6A 3ASKA 1M5Q1 3TREA 4MZMA 4C92B 4ZGEB 4M7DB 4C0DB 4M77G 3CCVA 4BACA 3OYJA 1OZ2A 3OQ5A 3LGFA 1RL2A 1UGRB 1XNIA 4M75E 2Q1CX 1Q82U 2XKOC 5GAMg 4JLIA 3BDUA 4TVRA 3DKMA 1MHNA 3M58A 5GAN8 3G7ZA 2RHYA 2VC8A 5ERGB 3DLMA 4JS5A 4OB3B 4C8QG 1VQ9A 2MM2A 5D6WA 3CCUA 3FDRA 2FHDA 4HCZA 1Q7YC 2HQEA 4XTZA 3KXTA 4EMGA 3S3OA 3CMEA 3MEVA 5C6SA 1Y96B 4ME7A 3FPUA 2X35A 3MEUA 2DD5A 4M75D 3JCMQ 1O54A 1IZ6A 2QI2A 3J7AF 2KMTA 3LGAA 3UWNA 1BIAA 1KHCA 4JDSA 2XI9A 2BIVA 3GNFB 2M16A 4M78E 4BI8B 4F7UF 5HKCA 1VQ8A 4EMKC 4E7JA 1D3BB 4VUBA 1FWZA 2HNIA 2XDDA 1N8RU 1BI3A 1RI0A 1DJ7B 2RI3A 1Q86U 5GAN3 3X25B 4E7IA 5HY6A 3X28B 3AHUA 4BE1A 3VU3C 2JOYA 2EQUA 2PUOB 4O6JA 4ZTJA 1VQ5T 2ZCFB 3JCMh 4LDWA 2MWOA 4EPCA 3NTKA 1Y96A 3I56T 4JRQA 1WJSA 1YIJT 4N4IA 2L3RA 3PIOA 2QTXA 1UB4A 1V29B 3CBOA 1R8OB 4M78D 3RMSA 4C5IA 3JCMd 4QQDA 1VUBA 3OYNA 1VQOA 1M1KU 4N0AA 5I2MA 3M59A 4HKEA 1QP3A 5D6XA 5CIUA 1YBYA 3GOXA 2Q18X 1VQ7T 2RHIA 4MZPA 2YRVA 1X01A 2ZPBB 4J7FA 5LJ5e 4RG8A 1KQ2A 3GPLA 1BIBA 1XTDA 3SDZA 4C8QA 2JTFA 2LT4A 4PL6A 3OYLA 1U1TA 1YJWT 2WACA 2C06A 1JRIA 5GAMh 4R56A 1VQNA 4KO8A 4A4HA 4JRKA 4M77E 3CCST 1UGSB 5GANg 2XK0A 2HD0A 5CO7A 1FXXA 1PSFA 3KUFA 2Y4YA 2QQRA 3E9FA 5GAMd 1I81A 1NZ9A 4J6YA 4JJNK 2L89A 3BQBA 2LT1A 4IURA 1UGPB 4JUVA 5LL6S 5FROA 2RM4A 4OP0A 2DAQA 3QXEB 3PFSA 4GY5A 2K3YA 5GLFA 3X24B 5C18A 4L5GA 3FC3A 4MDWA 1K8AU 2PWYA 3G4SA 3CBPA 4PLLA 3CCJA 4M77D 5KH6A 3J80E 3KBGA 3C12A 3Q1JA 5GMKj 5AYFA 5GMKe 3C95A 4N0AC 2P0KA 4M77C 1OZ3A 2EIFA 4UC4A 3S3NA 3CPFA 3M53A 3CC4T 3CMAT 1B34B 1WJRA 4OF1A 4P5NA 3ZJUA 2OTJT 1KG1A 2RJDA 3C94A 3LWIA 4ZN3A 2K4YA 4M7AF 1S3SA 3M56A 1O9SA 1M9SA 4C8QC 2DZ9A 3OYGA 1UEBA 4X9CA 3OBWA 3CCLT 1LOJA 1IREB 3QKJA 4KDIA 2YLBA 5LJ5g 5I21A 4N4HA 5L8RE 2A3LA 3RUXA 3OMGA 3V7CA 5CKHA 4E7KA 4E7LA 3JB9G 2E1HA 2LRQA 5GANf 2XICA 3UPUA 1M4ZA 3M9QA 3HSBA 1WPYA 3M55A 1B34A 3MEAA 3FIFA 2X4JA 1I5LA 2HAXA 2XD0A 4RKUE 4M78G 1GXIE 5CCBA 5CK9A 5GAN7 2DTHA 3FPRA 4A4EA 3HRTA 1M1FA 3MP8A 2YUJA 2PVDB 2LCCA 1W2BA 4M75B 1KQSS 2DIGA 2RJCA 2L8DA 1K9MC 4J5YA 4Z02A 4X9DA 4EMKB 2LW6A 2OTLA 4BD3A 1JB0E 2PUKB 2NLUA 3URGA 1YJ9A 1SSFA 3OYHA 1M90U 1ZHIA 3LWHA 3RIRA 2CGHA 2GFUA 3PNWC 4IUTA 3VKIA 3WVEB 4A4KA 4DQ2A 5A0DA 4JLGA 5FLXE 4E7HA 4FU6A 1Q82C 5FRNA 4KDLA 4IUUA 3L2QA 2QXFA 2RA2A 2VXFA 2ZGWA 4N4GA 4M75A 3G71T 1H3ZA 2RO0A 3QYHB 2PQWA 3GLXA 2BUDA 3QPHA 2DEQA 3QUIA 2R57A 5FU6C 5J3BA 4EMKA 5A0GA 2ZZDA 5LJ5f 3I56A 2CZ1B 1YHQT 3CCET 3MP1A 1QW1A 2XDBA 3CD6T 4PJOE 4QVCA 4KT0E 2FL7A 3L2UA 3TCJA 2DKGA 4HCBA 2RB6A 1HXDA 4OB2B 3RKWA 2E70A 2A7YA 1OYXA 2XU8A 4C5HA 5GAOl 3VUBA 1N8RC 1NPRA 1VQ7A 4C0FA 3QZ5B 1Q86C 1WGSA 2YHTA 2X4YA 2HBPA 4M78A 3CXCS 1VQMT 4PJOD 3EFSA 3VYHB 2H3JA 3OW2S 1WNLA 1QVFA 2E64A 4XK8E 3QIIA 5GMKl 3OA6A 1VQ5A 5LJ3f 3CPWS 2Q19X 2RK2A 3P8BB 3QBYA 3QJ6A 2RJFA 2DTIA 4QW2A 1VQKT 1M1KC 5CQXA 3JCMX 4OB0B 1U1SA 3HKSA 2E10A 2OAUA 3QO3A 4BB7A 5GANe 4C8QF 3QZ9B 5GANj 3A8HB 3L42A 2WSEE 1S72T 2DO3A 3HL8A 3HPWA 2EJ9A 4M75C 2RJEA 3ME9A 4A54A 2I2LA 3JCMb 2KSSA 1BYMA 1M8VA 2DZCA 1FX7A 4M77B 4PKCC 1N9SA 4B9WA 4XTVA 3M5AA 4A4GA 3GF5A 3HP9A 4II1A 3H6ZA 4DOVA 3JB9D 2KAFA 5GMKh 4C8QB 4FL6A 3E19A 3CC4A 3CMAA 1HK9A 3CEYA 2MAMA 3JRZA 4HA8A 4F7UG 2OTJA 5FTJA 2EQKA 4QVZA 4M78C 3V8JA 2X4WA 4M77A 4OVAA 4XU3A 2F5KA 2RD1A 2JN0A 4EDUA 2MF2A 1KD1U 3CC2T 3EAEA 3GP8A 1VQ4A 1K8AC 3OSSC 3TIWA 5LJ5j 2DPPB 3M4GA 5CVIA 1YJNT 2CZ7B 3OS5A 1PSEA 1ZQ1A 3DB4A 3M4YA 4JRPA 1VQLT 1QP2A 1O75A 1XOVA 2LCLA 2MM0A 1W4SA 1G3WA 4C92E 1YI2T 2JZ2A 2KDSA 4M7DE 3VUZA 1WQWA 4CQNA 2E65A 2XDPA 3JCMc 1YITT 2RI5A 2QEXT 3CCRT 2G3RA 3FB9A 2DIQA 5C1BA 4LD9K 5GAN6 1VQ6T 3BY7A 4L59A 2CS7A 3HRSA 4KLNA 4QQ6A 4J83A 5DLOA 5IT9E 1K73U 3SFMA 5DM7R 4C92D 3M54A 4EMHA 5LJ3e 4PJOG 2GFAA 5FU6B 5LJ3j 4M7DD 2E12A 4C0GA 3CBMA 2GQVA 3FJPA 2KQWA 2RK1A 2IG0A 5M9OA 1QDNA 1VQPA 1BI0A 2LVMA 3I55A 3BDLA 2QQAA 4CRIA 3CMET 3JCMV 1WQ7A 2E6NA 2EYQA 2F5TX 3VJPA 4NS5A 3BW1A 3CD6A 5GAOn 3UT1A 4JS4A 2QQSA 3HHTB 4GLKA 2EAYA 4LDVA 3V8LA 1VQ8T 3HFOA 5CKEA 4M75F 1KC8U 3FPTA 4OGCA 5DYIA 3FEOA 1Q81C 3T9NA 4PLIA 4XU0A 4PJOB 4JRIA 5GAOr 4XU1A 4HT9A 4F7UE 3A8OB 4XAXB 2EKOA 4MMKA 3CC7T 3S3MA 2Q1DX 2DK3A 1G3SA 4M7AG 3E1SA 5FTKA 2EJGA 5GAN4 5FTNA 5FTMA 5HK0A 2FYKA 4ZGJB 2VYTA 3P8DA 1CZ5A 4J7IA 2QDYB 4IUQA 3RKXA 2R5MA 5IN1A 1LNXA 4KODA 2X4XA 3NTHA 4AQ7A 4BE2A 4M78F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BE1 A;  2EQU A;  4ZTJ A;  1WGS A;  2MWO A;  2X4Y A;  3NTK A;  3P8H A;  1WJS A;  4N4I A;  2L3R A;  4C5I A;  2MWP A;  3QII A;  1OI1 A;  4QQD A;  3OYN A;  3OA6 A;  4QQG A;  3OS1 A;  2GF7 A;  3QBY A;  3QJ6 A;  2RJF A;  3OYK A;  5D6X A;  4QW2 A;  5CIU A;  3OY9 A;  3GOX A;  3LX7 A;  1G5V A;  2RHI A;  2O4X B;  2M0O A;  2YRV A;  3O8V A;  3L42 A;  2E5Q A;  3FLG A;  3PMI A;  2RJE A;  3ME9 A;  2R58 A;  3MP6 A;  4A4F A;  2JTF A;  3DB3 A;  4PL6 A;  3OYL A;  2RHX A;  5D6Y A;  2WAC A;  4B9W A;  4A4G A;  3H8Z A;  3LGL A;  4II1 A;  3H6Z A;  4A4H A;  2XK0 A;  3S6W A;  4ZTF A;  3KUF A;  2QQR A;  3E9F A;  4FL6 A;  3L2W A;  2K3X A;  2L89 A;  2LTO A;  2O4X A;  3CEY A;  2R5A A;  3OB9 A;  4IUR A;  3OYF A;  5FRO A;  2EQK A;  2DAQ A;  3LYI A;  3PFS A;  4GY5 A;  2K3Y A;  4QVZ A;  5KCO A;  2X4W A;  2D9T A;  4OVA A;  3ZEH A;  3FC3 A;  2F5K A;  3OMC A;  4PLL A;  4EDU A;  5KH6 A;  3OYM A;  5C0M A;  3EAE A;  3Q1J A;  4Q5W A;  5IAY A;  5J39 A;  5FRM A;  2HQX A;  2P0K A;  5KE2 A;  1OZ3 A;  3MET A;  4UC4 A;  3S3N A;  3DB4 A;  1WJR A;  2BKD N;  3MO8 A;  4RG2 A;  1H3Z A;  3OS0 A;  2RJD A;  3E9G A;  3OYE A;  2JZ2 A;  3OYG A;  2EFI A;  2XDP A;  4BE0 A;  2RI5 A;  3QKJ A;  2CKK A;  2G3R A;  2DIQ A;  3L2V A;  4IUP A;  2EQM A;  4N4H A;  3OMG A;  4E7K A;  1N27 A;  4L59 A;  4E7L A;  2LRQ A;  5KCH A;  3M9Q A;  3F70 A;  3NTI A;  4QQ6 A;  3OYA A;  3MEA A;  2GFA A;  3MEW A;  2RHZ A;  4A4E A;  4C5G A;  4IKF A;  3MP8 A;  1WJQ A;  3OYB A;  2IG0 A;  2LCC A;  4C5E A;  5M9O A;  2DIG A;  2RJC A;  2L8D A;  2LDM A;  2RHU A;  3ASK A;  4Z02 A;  3PMT A;  2LVM A;  3BDL A;  2M1H A;  4BD3 A;  4CRI A;  1OZ2 A;  2NLU A;  3OQ5 A;  3LGF A;  3OYC A;  3OYJ A;  4BAC A;  1SSF A;  1XNI A;  2E6N A;  4NS5 A;  3OYH A;  3L2R A;  5J26 A;  2EQJ A;  1MHN A;  4IUT A;  2GFU A;  2QQS A;  2RHY A;  3PNW C;  3UT1 A;  3DLM A;  3OYI A;  4E7H A;  4FU6 A;  2RI2 A;  5FRN A;  4BDZ A;  4IUU A;  5D6W A;  3L2Q A;  3FDR A;  2FHD A;  3FEO A;  3LLR A;  2HQE A;  4HCZ A;  3OS2 A;  4X34 A;  4N4G A;  4PLI A;  4BDY A;  3OYD A;  2B8A A;  2RO0 A;  3MEV A;  2PQW A;  5C6S A;  2BUD A;  3S3O A;  2EKO A;  2R57 A;  2X35 A;  3MEU A;  4LD6 A;  3LH0 A;  3S3M A;  3MP1 A;  3SD4 A;  3UWN A;  1KHC A;  4B9X A;  2BIV A;  2M16 A;  2VYT A;  3P8D A;  3L2U A;  4E7J A;  5KE3 A;  4IUV A;  4IUQ A;  2R5M A;  5IN1 A;  1RI0 A;  2RI3 A;  3C4S A;  1OYX A;  4C5H A;  2X4X A;  3NTH A;  4E7I A;  4BE2 A; 
#chains in the Genus database with same CATH topology
 2JM9 A;  4PNO A;  2DEU A;  3VS5 A;  2K5I A;  5GAN d;  3VS1 A;  2A36 A;  4J6W A;  4QQG A;  1MMD A;  1TUC A;  1H8K A;  2V1Q A;  1WXU A;  3HU2 A;  3OY9 A;  4OGE A;  1ZSZ C;  2O01 E;  2R58 A;  2VGM A;  3MP6 A;  1TXQ A;  2JMC A;  2DE0 X;  5D6Y A;  1FMK A;  4OMO A;  3CPW A;  4XU2 A;  2NUZ A;  3DLL A;  3A8L B;  4Y28 E;  2ZPH B;  3TVT A;  5CCX A;  3SEM A;  5LJ5 h;  3L2W A;  2M51 A;  2R5A A;  5B6C A;  1NG2 A;  1AT1 B;  1YJW A;  4PJO C;  3JCM W;  3JB9 I;  1WHG A;  2D9T A;  4J6X A;  1ZUU A;  2CZ6 B;  5GMK i;  1MMA A;  1OX9 A;  2OTL Q;  1YJ9 Q;  2HQX A;  3V7R A;  5KE2 A;  4M7A E;  2YWW A;  4FW1 A;  3HRU A;  3WXM B;  3SB2 A;  4LDU A;  4ZGD B;  3OS0 A;  3OYE A;  1PNJ A;  5EG2 A;  3A8G B;  2EFI A;  3QWZ A;  2KYB A;  1BI1 A;  2QA4 T;  1I5O B;  3EFO B;  2DXB A;  3I56 Q;  4KGV B;  1M90 R;  5GMK m;  4M7A C;  3H0F A;  3NTI A;  2OTL T;  5CD1 A;  1YJ9 T;  1K73 C;  3OSV A;  5GAO p;  1K4U S;  1WJQ A;  3OYB A;  1I8F A;  1VIF A;  2RHU A;  3G6E T;  4RUG A;  1OEB A;  2NYS A;  3U23 A;  3MKD A;  2ZPI B;  4LXC A;  4AMC A;  1PHT A;  1Q7Y U;  4F7U B;  4FM4 B;  1GFD A;  3CXC P;  1KC8 C;  2B8A A;  2KY9 A;  6AT1 B;  3LH0 A;  2B25 A;  3VV0 A;  3UA6 A;  4BY6 B;  1B7T A;  4DBH A;  1ZX6 A;  2CP3 A;  2CT4 A;  4IUV A;  3A8M B;  2NUT B;  4XQ3 A;  3CCU T;  3RKY A;  2RQV A;  3CC4 Q;  3CMA Q;  4AFQ C;  1NE8 A;  3P8H A;  2O2O A;  2V8I A;  1OPL A;  1RUW A;  2MWP A;  3BFM A;  1V76 A;  2EYZ A;  3UDC A;  2YUP A;  2WSC E;  4WF2 A;  4MZT A;  2JS2 A;  4O5V A;  4J9B A;  1WHM A;  5GAN 5;  4HT8 A;  2K2V A;  2JW4 A;  4C8Q D;  4ELZ C;  4LDX A;  2XG8 D;  4ARC A;  5CCA A;  3X26 B;  2EGC A;  1QVG A;  3THK A;  2QYZ A;  2LTO A;  1D0Y A;  1AVZ C;  3UF4 A;  1EIF A;  4E47 A;  3V7S A;  1UG1 A;  5GAM j;  3OYY A;  3CD6 Q;  2DXC A;  2M9U A;  1PRM C;  2A08 A;  1VYU A;  3ULR B;  3C0C A;  4LDY A;  4F14 A;  4FYY B;  3JCM g;  4M7A A;  3FRN A;  5KYX B;  4AS1 A;  2LNV A;  2IIM A;  1NLO C;  3M0S A;  1UGQ B;  3I5R A;  2ECZ A;  1VIE A;  1C1A A;  1YI2 A;  4LUD A;  1M8M A;  2JTE A;  2PVO B;  4C5E A;  1X27 A;  1CZ4 A;  4YTL A;  3ASK A;  3TRE A;  3CCV A;  1X43 A;  2CRE A;  3OYJ A;  1OZ2 A;  4BAC A;  4M75 E;  3BDU A;  3DKM A;  1GL5 A;  1IHW A;  2FHD A;  4EMG A;  3S3O A;  3MEV A;  5C6S A;  1Y96 B;  4ME7 A;  2X35 A;  3JCM Q;  2DD5 A;  4J9I A;  1PCX A;  2AIR B;  1FWZ A;  2HNI A;  3MJX A;  5IHK A;  2XDD A;  1BI3 A;  2RI3 A;  1UTI A;  3VS3 A;  2CUB A;  3X28 B;  3VU3 C;  2ZCF B;  4EPC A;  3H41 A;  1YJW Q;  1RAE B;  3PIO A;  2L3R A;  5KYW B;  1Q95 G;  4RTX A;  1BB9 A;  1FMV A;  4HKE A;  1QP3 A;  5D6X A;  1YBY A;  2RHI A;  1WZO A;  1BIB A;  2CH4 A;  3OYL A;  2DNU A;  1YJW T;  1T0J A;  2DLP A;  1RAD B;  1X6B A;  2MYS A;  1VQN A;  5I11 A;  2H8H A;  4HVV A;  3KUF A;  4R0K A;  5KYY A;  2YUQ A;  1KIK A;  4IUR A;  5FRO A;  2SEM A;  4OP0 A;  2CH4 W;  5GLF A;  4GBQ A;  2EKH A;  2EYW A;  3G4S A;  3BE3 A;  2CP7 A;  4AFS C;  2VVK A;  5AYF A;  5GMK j;  1MMG A;  3CPF A;  2X9H A;  1RLQ C;  4KGX B;  1KG1 A;  3C94 A;  2LZ6 B;  4KH0 B;  1UEB A;  1IRE B;  5LJ5 g;  4N4H A;  2A3L A;  4E7L A;  2E1H A;  4F04 B;  3UPU A;  2G6F X;  1BCM A;  2MOX A;  1E6H A;  1Q7Y R;  1WI7 A;  2HAX A;  2KRO A;  5CK9 A;  5GAN 7;  1BK2 A;  2O9V A;  2L8D A;  4J5Y A;  2LQN A;  2KGT A;  2PUK B;  2RMO A;  1WHL A;  1SSF A;  1GCQ C;  2DL7 A;  4IUT A;  3PNW C;  5A0D A;  1Q81 U;  1Q82 C;  5FLX E;  2O9S A;  2JT4 A;  2QXF A;  4M75 A;  1WIE A;  3QUI A;  3GLX A;  5J3B A;  5A0G A;  1S3S A;  1QW1 A;  1RLP C;  1SHF A;  2K6D A;  1K8A R;  2DKG A;  4HCB A;  2RB6 A;  2A7Y A;  1OYX A;  2XU8 A;  5GAO l;  1VQ7 A;  1M27 C;  3SHW A;  2X3W D;  3OW2 S;  1WNL A;  4XK8 E;  1VQ5 A;  1M2V B;  2Q19 X;  2EYY A;  2DTI A;  4CC2 A;  1M1K C;  1PC0 A;  3L42 A;  2WSE E;  2EJ9 A;  2KSS A;  2DZC A;  2FRW A;  1N9S A;  5IXF A;  1KK7 A;  4A4G A;  4JZ4 A;  2DYB A;  1YI2 Q;  2CDT A;  2OTJ A;  4JJB A;  1W2B P;  2X4W A;  4OVA A;  2JN0 A;  2MF2 A;  1KD1 U;  3CCV Q;  3EAE A;  3GP8 A;  3OSS C;  3TIW A;  5LJ5 j;  1EFN A;  2DPP B;  1YJN T;  1SKU B;  1NBE B;  2MCN A;  2P4R A;  1O75 A;  5KYU A;  4C92 E;  1YI2 T;  1EX4 A;  4M7D E;  2LCS A;  1YIT T;  2G3R A;  2D1X A;  2ROL A;  2CS7 A;  2KXD A;  4KLN A;  4J83 A;  3SFM A;  4EMH A;  5FU6 B;  2E12 A;  2VAS A;  2GQV A;  2PNI A;  1VQP A;  1BI0 A;  1TUG B;  3I55 A;  2QQA A;  3REB B;  2KEA A;  3V8L A;  1X2K A;  2ENM A;  2D0N A;  1CSK A;  2IPO B;  3A8O B;  2KI7 A;  3E1S A;  5FTK A;  5FTN A;  4J9E A;  5FTM A;  1WXT A;  4ZGJ B;  1VQN Q;  2QDY B;  2JM8 A;  4HCK A;  4NL2 A;  2X4X A;  3NTH A;  1VQK A;  4M78 F;  2BZX A;  2QGF B;  5GAN h;  3MHX A;  3RES A;  5LJ3 g;  1I4K 1;  4Z8A A;  2Y90 A;  2VV5 A;  2BTT A;  3RER A;  3A5Z B;  4DEX A;  3UA7 A;  3RMQ A;  3OS1 A;  2F2W A;  2NUP B;  4XTY A;  1WLF A;  4MDX A;  1JJ2 S;  1YCY A;  4RV0 A;  4M78 B;  4DBR A;  2KBT A;  1VQN T;  3ZBD A;  2GNC A;  1K73 R;  5EPP A;  3CXC A;  1ARK A;  2X3X D;  5GAN 2;  3SWN A;  1J3T A;  3DB3 A;  3QG1 A;  4C92 G;  1WX6 A;  4M7D G;  5EQJ B;  4FYW B;  1QKW A;  3G4S T;  4D8D A;  1FMW A;  1NJI U;  2DFU A;  1M3C A;  5CKD A;  5CQY A;  3OYF A;  4M77 F;  4JPB W;  3LYI A;  1KC8 R;  2F2V A;  4PFP A;  2E5K A;  3TSZ A;  4X1V A;  3EHR A;  5C0M A;  3EGU A;  1G3Y A;  4AFZ C;  4C0Z A;  1GBQ A;  2FB7 A;  4RG2 A;  5GAO m;  2VXE A;  1VA7 A;  1KQS P;  1K0X A;  5CKF A;  2LMJ A;  3JCM f;  1KSW A;  4OMF B;  3N5B B;  4C92 A;  1Q81 R;  4M7D A;  2MMP A;  1MV3 A;  3OYA A;  4RCB A;  1RAF B;  2ZPF B;  1LJO A;  1VQ7 Q;  2EJF A;  2P4T A;  1I9G A;  3QYG B;  2M1H A;  4RMO A;  3CC7 A;  1T3L A;  3OYC A;  3CCM T;  1VQ5 Q;  2PZ1 A;  3M0U A;  4Z89 A;  3L2R A;  5J26 A;  2AZS A;  3OYI A;  4J9G A;  2RI2 A;  4X34 A;  1D3B A;  4FIB A;  2RPN A;  2Z0W A;  2DD4 A;  1MND A;  4ZN1 A;  2XMF A;  2CSQ A;  4KGZ B;  1N6A A;  3SD4 A;  2LQ8 A;  1P92 A;  5KE3 A;  1QVP A;  3HU3 A;  1VQ9 T;  1VQ5 T;  2LX9 A;  2PTK A;  4PJO F;  3INZ A;  1Y07 A;  5EC7 A;  1ZBJ A;  2OTJ Q;  2ZPE B;  3MCA B;  3LH5 A;  4KUL A;  2LQW A;  2ED1 A;  2YUN A;  4C8Q E;  1TG0 A;  2DXU A;  3JCM e;  1G5V A;  3H0I A;  3HFN A;  1VQM A;  3NHN A;  2RH2 A;  3FLG A;  1WHK A;  3PMI A;  4LUE A;  5IHN A;  2DF6 A;  3CCQ A;  4Y91 A;  1KD1 R;  4BI3 A;  2ZAE A;  1M2O A;  3JCM J;  3H8Z A;  4BI4 A;  3JB9 J;  3MB5 A;  1MGQ A;  3ZJV A;  4FSX A;  4XTU A;  5DLQ E;  4M7A B;  4IIM A;  2F2X A;  2D6F A;  1VQP Q;  2LJ3 A;  2DJQ A;  3I55 Q;  3OYM A;  1Y0M A;  4KRT A;  4BUG A;  2WSF E;  1D09 B;  4B6M A;  3WVD B;  1G3T A;  1KQ1 A;  2LJ0 A;  2L3P A;  2CKK A;  1SPK A;  1VQP T;  3F70 A;  1Y7X A;  4ATO A;  1ZA1 B;  1VQK Q;  3CCR A;  4DA4 A;  1NYG A;  2COW A;  2ED0 A;  1S72 Q;  2B86 A;  2K79 A;  1G2B A;  4M77 G;  2KRM A;  2Q1C X;  5GAM g;  4TVR A;  3M0R A;  1T3S A;  4JS5 A;  4OB3 B;  4C8Q G;  4KH1 B;  4PJN A;  2A37 A;  1O54 A;  1UHF A;  1QWE A;  2XI9 A;  1ZUY A;  4AT1 B;  4F7U F;  1AWW A;  1N8R U;  1DJ7 B;  1MNE A;  1Q86 U;  4E7I A;  5HY6 A;  2JOY A;  2YUO A;  3I56 T;  1AWX A;  1WJS A;  2HKN A;  4N4I A;  2DVJ A;  1UB4 A;  4M78 D;  1V29 B;  2J06 A;  3CBO A;  3JCM d;  2QEX Q;  4QQD A;  1VUB A;  1VQO A;  1PD0 A;  1NJI R;  2C0O A;  5I2M A;  4MZP A;  1X01 A;  2ZPB B;  5LJ5 e;  5D7U A;  1XTD A;  4C8Q A;  2CP6 A;  4F17 A;  1SG5 A;  2FO0 A;  1UGS B;  5GAN g;  2HD0 A;  4D8K A;  1VYT A;  3E9F A;  3BQB A;  1Q82 R;  2LT1 A;  1UGP B;  2OX7 A;  1VQ8 Q;  2DAQ A;  3PFS A;  2K3Y A;  5C18 A;  1K8A U;  4M77 D;  3C12 A;  3CC7 Q;  3Q1J A;  4UC4 A;  3S3N A;  3CC4 T;  3TQ7 P;  3CMA T;  4OF1 A;  1OV3 A;  1ABO A;  2RJD A;  3OYG A;  2DZ9 A;  5GJV B;  3OBW A;  1LOJ A;  3QKJ A;  5I21 A;  1RI9 A;  3RUX A;  3OMG A;  1U06 A;  5CKH A;  1W1F A;  4J9H A;  1NEG A;  3EGX A;  2BE9 B;  1WPY A;  1B34 A;  3VS6 A;  2X4J A;  1GXI E;  4RKU E;  1M1K R;  3HRT A;  1BCO A;  2PVD B;  2LCC A;  1W2B A;  4M75 B;  2RJC A;  1K9M C;  2DL3 A;  4K11 A;  3I5S A;  4BD3 A;  2RQR A;  3URG A;  3EGD A;  4CC4 B;  2M0Y A;  2SRC A;  3RIR A;  2CGH A;  4A4K A;  4E7H A;  1PD1 A;  4FU6 A;  1NYF A;  1VQM Q;  2RA2 A;  4N4G A;  1H3Z A;  2DEQ A;  2R57 A;  3CCQ Q;  2CZ1 B;  1X69 A;  3MP1 A;  3CD6 T;  2W0Z A;  2FL7 A;  4M4Z A;  3L2U A;  1AOJ A;  2DRK A;  3TCJ A;  4OB2 B;  2E70 A;  4C5H A;  1NPR A;  3QZ5 B;  3VS4 A;  2X4Y A;  1MUZ A;  1VQM T;  4PJO D;  1I1J A;  1QVF A;  1UHC A;  5LJ3 f;  3CPW S;  1TU0 B;  1QCF A;  4RTY A;  2AK5 A;  2ROT A;  4AG2 C;  1U1S A;  3HKS A;  5GAN j;  3QO3 A;  4BB7 A;  2DO3 A;  4M75 C;  3ME9 A;  1UE9 A;  1HYO A;  2JMA A;  1BYM A;  2ABL A;  4PKC C;  4LE9 A;  4XTV A;  2AT1 B;  3I9Q A;  2CP5 A;  3GF5 A;  3HP9 A;  4DOV A;  3H6Z A;  2KAF A;  1FYN A;  2DMO A;  1GBR A;  5KYU B;  2MAM A;  4F7U G;  4HA8 A;  3QWY A;  2FPD A;  3EG9 A;  4QVZ A;  3MPU B;  2VKN A;  3V8J A;  3CCR Q;  2RF0 A;  1PG5 B;  2RD1 A;  3G1J A;  1TUD A;  1VQ4 A;  5CVI A;  1LPL A;  1PSE A;  1ZQ1 A;  3EFO A;  1XOV A;  1W4S A;  1G3W A;  2OI3 A;  1WQW A;  2E65 A;  2XDP A;  1UUE A;  2RI5 A;  3CCR T;  4FYV B;  3EHQ A;  4QT7 A;  5C1B A;  1WHH A;  1K73 U;  5DLO A;  4CC3 A;  5LJ3 e;  3FJP A;  3EH2 A;  2DM1 A;  4A63 B;  1T0H A;  2E3H A;  1UJ0 A;  3QDF A;  1I0C A;  4FCY A;  3JCM V;  1WQ7 A;  3M0P A;  3VJP A;  2MK5 A;  1N8R R;  1VQO Q;  1TTH B;  2GBQ A;  3EH1 A;  3UT1 A;  1Q86 R;  2QQS A;  2DET A;  4GLK A;  1KC8 U;  1WYX A;  2HL5 C;  4PLI A;  2NUT A;  4XAX B;  2Q1D X;  1G3S A;  2EYX A;  4WCI A;  2FYK A;  3P8D A;  1D1B A;  3EG2 A;  1ACM B;  3RKX A;  2R5M A;  2LJ1 A;  1EZZ B;  4OMN A;  3NGP A;  1YFN A;  2YRD A;  1Y57 A;  3JSC A;  2MI6 A;  1PKT A;  3E2U A;  2GGR A;  1YP5 A;  3QSU A;  3OYK A;  3RNJ A;  2IVW A;  2VUB A;  1SF9 A;  1XQH A;  1QVG S;  3O8V A;  2JVV A;  2YSQ A;  4HVU A;  5FU7 C;  1X6O A;  2H3E B;  3VRZ A;  1E7O A;  2COZ A;  3QDR B;  3S6W A;  4ZTF A;  4RCC A;  4V2S A;  1K0S A;  1OU9 A;  1D0Z A;  2K3X A;  2O4X A;  1VQL A;  3QQ7 A;  3REA B;  2E41 A;  2PU9 B;  2K7A A;  1JXM A;  3ER0 A;  3ZEH A;  1BI2 A;  7AT1 B;  3VYG A;  2AKL A;  3OMC A;  1M1G A;  1CKB A;  4LNP A;  3JAM E;  3MET A;  4DOW A;  3LHD A;  1CKA A;  2DJZ A;  1K9A A;  5A0L A;  5DY9 A;  3RR6 A;  3E9G A;  1PM3 A;  3SWN C;  5LJ3 d;  2FEI A;  3L2V A;  2OAW A;  1TH7 A;  2A28 A;  3I35 A;  3JB9 H;  3MEW A;  2CZ0 B;  2RHZ A;  3CCL A;  3H9N A;  1QVF S;  2LX7 A;  2XID A;  2XHC A;  1LCK A;  2LDM A;  1BBZ A;  1RAI B;  4DEY A;  2HEQ A;  1V1C A;  2DIL A;  3A1P A;  2VGN A;  2MPX C;  3LLR A;  5GAM f;  2C0T A;  2E3I A;  3TEE A;  3OYD A;  4PJL A;  2YVL A;  4RTW A;  3CCV T;  3OW2 P;  1K76 A;  4LD6 A;  4AG1 C;  2L5Q A;  3NPF A;  1R0B G;  3R6N A;  1QWF A;  3TSW A;  1QLY A;  1TSF A;  4MML A;  2HBW A;  4C92 C;  2V8J A;  3D7S B;  4ARI A;  1OPK A;  4M7D C;  4C0D C;  5A2Q E;  3G71 A;  3C4S A;  1YHQ A;  1X6G A;  3NFC A;  2KT8 A;  5AT1 B;  5FTL A;  1OI1 A;  1X75 C;  2FZC B;  1VQ4 Q;  2FZG B;  3LX7 A;  3QWX X;  1WDX A;  2E5Q A;  1Z9Z A;  2M02 A;  2AHJ B;  4A4F A;  4ELY C;  3JB9 F;  2YDL A;  1UJY A;  1N9R A;  2RHX A;  2GQI A;  2PJH B;  2D0Q B;  4FT2 A;  3LGL A;  1S72 A;  3JV3 A;  1VQ4 T;  3OB9 A;  1IXD A;  2BZY A;  4DBF A;  5KCO A;  2DVE A;  1OX8 A;  3LW5 E;  3VS7 A;  3R6O A;  1RAC B;  5GAM e;  3PVQ A;  2K5F A;  3ZGZ A;  2QA4 A;  1LVK A;  1AD5 A;  4Q5W A;  1OOT A;  3M57 A;  4J9F A;  1AHJ B;  1R7R A;  2QK0 A;  3TU4 K;  5FW9 A;  1WXB A;  3GNG A;  1ZC1 A;  2FVU A;  3QHS A;  4BE0 A;  2EVR A;  1JEG A;  1M3A A;  3G6E A;  2EQM A;  4XTW A;  2JTM A;  1NEB A;  1KJW A;  2RN8 A;  3PGG A;  5KCH A;  2E6Z A;  1SRM A;  2LC4 A;  3QC8 A;  4KUI A;  1JQQ A;  2QEX A;  4IKF A;  4PJJ A;  4JZ3 A;  3EG1 A;  1VQ6 A;  2HMA A;  4FSS A;  3OQ5 A;  3LGF A;  1ZLM A;  1UGR B;  1IB8 A;  1Q82 U;  4PK4 A;  5GAN 8;  2RHY A;  5IH2 A;  2MM2 A;  3CCU A;  2ESW A;  3FDR A;  4HCZ A;  1Q7Y C;  1AWO A;  4ANJ A;  3FPU A;  3MEU A;  2QI2 A;  4DBQ A;  3J7A F;  1IHV A;  2QGG A;  4BI8 B;  2BIV A;  4M78 E;  2M16 A;  1JJ2 P;  1VQ8 A;  4EMK C;  4VUB A;  2L3Q A;  1S1N A;  2RNA A;  5GAN 3;  1M2V A;  4BE1 A;  1VQL Q;  2EQU A;  2PUO B;  4O6J A;  4ZTJ A;  3JCM h;  4LDW A;  4JRQ A;  1JO8 A;  2W10 A;  1R8O B;  4JJC A;  3RMS A;  1M1K U;  4N0A A;  1RAB B;  1AWJ A;  1VOM A;  1VQ7 T;  2YRV A;  4J7F A;  3O5Z A;  3GPL A;  3SDZ A;  2JTF A;  2LT4 A;  1WFW A;  1K9M R;  2DBK A;  1IRX A;  1XJW B;  4R56 A;  4OMQ A;  4A4H A;  4M77 E;  2XK0 A;  2EW3 A;  5CO7 A;  1FXX A;  1PSF A;  1YNZ A;  2RQU A;  2QQR A;  2LP5 A;  3UAT A;  5GAM d;  4J6Y A;  2KYM A;  3CCL Q;  2RM4 A;  3QXE B;  4GY5 A;  1ABQ A;  4FW2 A;  3X24 B;  3FC3 A;  4FYX B;  3CCJ A;  3J80 E;  3KBG A;  5GMK e;  3C95 A;  4M77 C;  1OZ3 A;  2JS0 A;  3M53 A;  1B34 B;  4P5N A;  9ATC B;  5L23 A;  2OTJ T;  4PFZ A;  4M7A F;  1O9S A;  4C8Q C;  4X9C A;  3CCL T;  2ATC B;  2P84 A;  4GLM A;  3FJ5 A;  4E7K A;  3JB9 G;  2LRQ A;  1BU1 A;  3HSB A;  2E4H A;  2KRN A;  3MEA A;  2XD0 A;  5CCB A;  4M78 G;  3G71 Q;  3FPR A;  4A4E A;  1YHQ Q;  2LW6 A;  3RDV A;  1JB0 E;  2K3B A;  2EQI A;  1D1C A;  3OYH A;  2GFU A;  3VKI A;  3WVE B;  4DQ2 A;  2O31 A;  4JJN K;  4JLG A;  3L2Q A;  1JU5 C;  2ZGW A;  3G71 T;  3VRY A;  3I55 T;  3QPH A;  4EMK A;  1SRL A;  5LJ5 f;  2ZZD A;  1YHQ T;  2XDB A;  4PJO E;  4QVC A;  1HXD A;  2KE9 A;  2NWM A;  2NUP A;  2EPD A;  5HCK A;  4M78 A;  3CXC S;  2H3J A;  2E64 A;  1YN8 A;  3QII A;  4OMM A;  2QA4 Q;  2K9G A;  3QJ6 A;  1E6G A;  4QW2 A;  1VQK T;  2DRM A;  3JCM X;  2E10 A;  2OAU A;  1D0X A;  3QZ9 B;  1S72 T;  1SSH A;  1UDL A;  3HPW A;  3EG9 B;  2I2L A;  4ESR A;  1M8V A;  1ZA2 B;  1SEM A;  4B9W A;  3M5A A;  3G6E Q;  2CUD A;  4II1 A;  3JB9 D;  1QMC A;  4FL6 A;  3E19 A;  1IGU A;  2I0N A;  1HK9 A;  3CEY A;  4F16 A;  1JXO A;  2CP0 A;  2JJ9 A;  4M77 A;  4XU3 A;  1VQ6 Q;  4EDU A;  5KYY B;  3OS5 A;  1QP2 A;  2YRC A;  2MM0 A;  3CCU Q;  3VUZ A;  4CQN A;  2QEX T;  5GAN 6;  1VQ6 T;  3BY7 A;  3HRS A;  3GBQ A;  4QQ6 A;  2DYI A;  4E2F B;  4PJO G;  2RK1 A;  2QAZ A;  2IG0 A;  4HXJ A;  3CQT A;  4CRI A;  2V1R A;  1VYV A;  2E6N A;  2EYQ A;  2F5T X;  3BW1 A;  4JS4 A;  3HHT B;  1TWB A;  4LDV A;  4CC7 A;  1VQ8 T;  3HFO A;  1PRL C;  4M75 F;  4QKU A;  3FPT A;  4OGC A;  3FEO A;  1Q81 C;  1ZSZ A;  2COY A;  3T9N A;  4XU0 A;  4XU1 A;  4F7U E;  1M30 A;  2EKO A;  3A98 A;  3EG0 A;  2KNB B;  4MMK A;  3CC7 T;  2DK3 A;  4M7A G;  2EJG A;  1U3O A;  2CP2 A;  4J7I A;  2L2P A;  4IUQ A;  5IN1 A;  4AQ7 A;  1PWT A;  3V8K A;  4PJO A;  2DL8 A;  2LQK A;  3PIP A;  5CAI A;  2CYZ B;  3CCJ Q;  4Z88 A;  1QCS A;  3QQ8 A;  8ATC B;  1AEY A;  4E7S A;  2V8K A;  4BY6 C;  1IO6 A;  2O4X B;  2M0O A;  1YIJ A;  1OU8 A;  2GTO A;  3M0Q A;  4Y92 A;  3OW2 A;  2Y4X A;  4A53 A;  3OBY A;  2MIO A;  1D1A A;  3KFV A;  2Q1A X;  2FPF A;  3CCJ T;  1YCS B;  1YJN A;  1GCP A;  2P0P A;  5I2S A;  4OMP A;  5LJ5 d;  3CCQ T;  1NM7 A;  3EFR A;  3CCS A;  1YIT A;  5IAY A;  5FRM A;  2DTO A;  2P0Q A;  4FT4 A;  1KD1 C;  2K2M A;  2EWN A;  2X51 A;  3CF2 A;  3ZJT A;  2J6F A;  4QVD A;  3MO8 A;  2GCX A;  5LJ3 h;  2K5L A;  3PT9 A;  3VS0 A;  2JV2 A;  4L6V 5;  5I22 A;  4KUD K;  4M7A D;  1U8R A;  5KYN A;  2KXC A;  1AZE A;  1N27 A;  5CR2 A;  1K1Z A;  2ZPG B;  2QTV A;  3L2Z A;  4J9C A;  3ZFJ A;  1H3H A;  2KT1 A;  3HU1 A;  1NLP C;  2JUF A;  4C5G A;  1ZBX A;  3H0H A;  3PMT A;  4OB1 B;  4CI0 C;  2KVQ G;  1W70 A;  3PTA A;  4J8O A;  4D6W A;  5GAO q;  2F69 A;  1KHI A;  2EQJ A;  2PVG B;  1UEC A;  4BDZ A;  1C0M A;  3OS2 A;  1CR5 A;  1H92 A;  4BDY A;  3GIB A;  1QCO A;  2C0I A;  3JCM P;  1HSQ A;  2CSI A;  1AZG B;  1SHG A;  2KRS A;  3CPW P;  3VS2 A;  3X20 B;  1MMN A;  4B9X A;  2K57 A;  1NPP A;  4PFO A;  4F7U A;  1BKB A;  2QQB A;  1Y71 A;  4RTV A;  3CCE A;  5FU7 B;  2JNG A;  3HTR A;  2QG9 B;  4HCC A;  1M90 C;  1H64 1;  1B3Q A;  2DXT A;  1KQS A;  2EGA A;  2GF7 A;  1RAG B;  2HKQ B;  2D8H A;  1GRI A;  5HK3 A;  1M3B A;  1TS9 A;  4M75 G;  1RAH B;  2FG0 A;  4KDI A;  2KK4 A;  5FWC A;  1VQO T;  3J81 E;  5FWB A;  1JJ2 A;  2HDA A;  3M0T A;  4NOY A;  1TOV A;  3SWN B;  2D8J A;  1B07 A;  1OUL A;  1NJI C;  2EBP A;  3L1A A;  2HCK A;  3ZL7 C;  5J39 A;  4NL3 A;  1JBM A;  4XTX A;  2YLC A;  2BKD N;  3QJY A;  1ZSG A;  2FZK B;  3CC2 A;  2QQ9 A;  1W2B S;  4KBM B;  4C92 F;  4IUP A;  1G8X A;  4M7D F;  4R55 A;  4E6R A;  2HQH A;  5DYG A;  1E32 A;  3CCM A;  1F1B B;  1A0N B;  8AT1 B;  4EIK A;  1K9M U;  5CKB A;  4HVW A;  2J6K A;  5KYX A;  1M5Q 1;  4C92 B;  4MZM A;  4ZGE B;  4M7D B;  4C0D B;  1RL2 A;  1I07 A;  1XNI A;  4ORZ A;  2J7I A;  2XKO C;  4JLI A;  1MHN A;  3M58 A;  3G7Z A;  5ERG B;  2VC8 A;  3DLM A;  4PJM A;  2HL3 A;  1VQ9 A;  5D6W A;  1RAA B;  2HQE A;  4XTZ A;  1YIJ Q;  3KXT A;  3CME A;  2RQT A;  4M75 D;  2YT6 A;  1IZ6 A;  2KMT A;  3LGA A;  3UWN A;  1BIA A;  1KHC A;  4JDS A;  3GNF B;  5HKC A;  4E7J A;  1D3B B;  1QVG P;  2L3S A;  1RI0 A;  1YJN Q;  4RTZ A;  3X25 B;  3AHU A;  2DL5 A;  1WHJ A;  2MWO A;  3NTK A;  1Y96 A;  3AT1 B;  1YIJ T;  2QTX A;  2HSP A;  4LN2 A;  5ECA A;  4C5I A;  2DBM A;  3CCS Q;  2YXY A;  1YIT Q;  3OYN A;  3M59 A;  2OJ2 A;  5CIU A;  3GOX A;  2Q18 X;  2LNH B;  1YWO A;  4RG8 A;  1KQ2 A;  2DL4 A;  2AKK A;  3PVL A;  4PL6 A;  5KYW A;  1U1T A;  1IGQ A;  2DX1 A;  2WAC A;  2C06 A;  1JRI A;  5GAM h;  4KO8 A;  4JRK A;  3CCS T;  2Y4Y A;  1I81 A;  1NZ9 A;  2L89 A;  4IIO A;  4JUV A;  5LL6 S;  2RQW A;  4L5G A;  4MDW A;  2PWY A;  3CBP A;  4PLL A;  2L0A A;  5KH6 A;  4N0A C;  2P0K A;  4WTO B;  2EIF A;  1GCQ A;  1UFF A;  3ZJU A;  1WJR A;  1QVF P;  1Z9Q A;  4JJD A;  2VB6 A;  4ZN3 A;  2K4Y A;  3LWI A;  3M56 A;  1C6V X;  1PKS A;  1M9S A;  1KFZ A;  1QKX A;  2CT3 A;  4J9D A;  2YLB A;  5L8R E;  3V7C A;  5GAN f;  2XIC A;  2VWF A;  1M4Z A;  1X2Q A;  3M9Q A;  3M55 A;  1I5L A;  2BE7 D;  3FIF A;  2DTH A;  1M1F A;  3MP8 A;  2YUJ A;  2HSE B;  3CCE Q;  1KQS S;  2DIG A;  2J05 A;  4Z02 A;  2FRY A;  4X9D A;  4EMK B;  2OTL A;  2NLU A;  1YJ9 A;  1UGV A;  2DER A;  1M90 U;  1ZHI A;  3LWH A;  3G4S Q;  5FRN A;  4KDL A;  4IUU A;  5GJW B;  2VXF A;  2AZV A;  2RO0 A;  3QYH B;  2PQW A;  5FU6 C;  2BUD A;  4E7Z A;  3I56 A;  3CCE T;  2JXB A;  4KT0 E;  2KR3 A;  1HD3 A;  3RKW A;  2V26 A;  3VUB A;  1N8R C;  2A0F B;  4C0F A;  1Q86 C;  1WGS A;  2YHT A;  2HBP A;  1QCN A;  3EFS A;  3VYH B;  4RTT A;  2O88 A;  3OA6 A;  5GMK l;  2RK2 A;  3P8B B;  1OQK A;  3QBY A;  2RJF A;  3PE0 A;  5CQX A;  4OB0 B;  1HJD A;  5GAN e;  2EGE A;  4C8Q F;  3A8H B;  3HL8 A;  2RJE A;  4OML A;  4A54 A;  3JCM b;  2BZ8 A;  3CC2 Q;  4M77 B;  1FX7 A;  1R0C B;  1GFC A;  1G83 A;  2FPE A;  1WLP B;  3CCM Q;  5GMK h;  4ZNX A;  4C8Q B;  1W6X A;  2QAS A;  3CMA A;  3CC4 A;  2F1L A;  3JRZ A;  5FTJ A;  2EQK A;  4M78 C;  4RTU A;  2F5K A;  3IQL A;  1QQJ A;  3CC2 T;  1K8A C;  3M4G A;  1WA7 A;  2CZ7 B;  3DB4 A;  4AFU C;  3M4Y A;  4JRP A;  1VQL T;  1R77 A;  2LCL A;  5IHI A;  1VQ9 Q;  2JZ2 A;  2KDS A;  3JCM c;  3CME Q;  3FB9 A;  2DIQ A;  2HZY A;  4LD9 K;  4L59 A;  3RBB B;  5IT9 E;  2J6O A;  5DM7 R;  4C92 D;  3M54 A;  5LJ3 j;  2GFA A;  4M7D D;  5IXB A;  4C0G A;  3CBM A;  1ZUK A;  2KQW A;  1ZSZ B;  2GTJ A;  5M9O A;  3NMZ C;  1QDN A;  3EGX B;  2LVM A;  3BDL A;  3CME T;  1U5S A;  3CD6 A;  4NS5 A;  1MV0 B;  5GAO n;  2EAY A;  5CKE A;  5DYI A;  1YWP A;  3EGD B;  1N5Z A;  4PJO B;  4JRI A;  5GAO r;  4HT9 A;  3S3M A;  5GAN 4;  5HK0 A;  3EG3 A;  2DA9 A;  2VYT A;  1CZ5 A;  2QDL A;  1LNX A;  4KOD A;  4BE2 A; 
#chains in the Genus database with same CATH homology
 3V8K A;  5GAN h;  4PJO A;  3MHX A;  3RES A;  5LJ3 g;  3JSC A;  2LQK A;  1I4K 1;  4PNO A;  2MI6 A;  2Y90 A;  3PIP A;  2K5I A;  2VV5 A;  5GAN d;  5CAI A;  2CYZ B;  3A5Z B;  3RER A;  1QCS A;  3QQ8 A;  4J6W A;  1Q81 U;  4QQG A;  3RMQ A;  3OS1 A;  4XTY A;  1WLF A;  3QSU A;  3OYK A;  1JJ2 S;  1YCY A;  2V8K A;  4MDX A;  2IVW A;  2VUB A;  3OY9 A;  3HU2 A;  4M78 B;  1XQH A;  4BY6 C;  1VQN T;  3ZBD A;  1QVG S;  2O4X B;  2M0O A;  1YIJ A;  3O8V A;  4OGE A;  5EPP A;  2O01 E;  3CXC A;  2JVV A;  3I55 T;  2R58 A;  2VGM A;  3MP6 A;  5GAN 2;  3OW2 A;  2Y4X A;  3SWN A;  3DB3 A;  3QG1 A;  4A53 A;  3OBY A;  5D6Y A;  4C92 G;  5FU7 C;  1X6O A;  4M7D G;  3CPW A;  5EQJ B;  4XU2 A;  3DLL A;  3A8L B;  4Y28 E;  2ZPH B;  5CCX A;  2Q1A X;  3G4S T;  3CCJ T;  3QDR B;  3S6W A;  4ZTF A;  1YJN A;  4RCC A;  1NJI U;  4V2S A;  2P0P A;  5LJ5 h;  5I2S A;  3L2W A;  2K3X A;  2O4X A;  5CKD A;  1VQL A;  3QQ7 A;  2R5A A;  5CQY A;  3OYF A;  4M77 F;  2E41 A;  5B6C A;  2PU9 B;  5LJ5 d;  1YJW A;  3LYI A;  4PJO C;  3CCQ T;  3JCM W;  3JB9 I;  3ER0 A;  2D9T A;  4J6X A;  3ZEH A;  1BI2 A;  3EFR A;  2CZ6 B;  3VYG A;  3OMC A;  5GMK i;  3CCS A;  1YIT A;  1M1G A;  5C0M A;  5IAY A;  5FRM A;  2DTO A;  1G3Y A;  2P0Q A;  4C0Z A;  2HQX A;  4FT4 A;  3V7R A;  5KE2 A;  3MET A;  3JAM E;  1KD1 C;  4M7A E;  2EWN A;  3HRU A;  3WXM B;  4DOW A;  3CF2 A;  3SB2 A;  2DJZ A;  3LHD A;  3ZJT A;  5A0L A;  4QVD A;  4LDU A;  2FB7 A;  3MO8 A;  4RG2 A;  5DY9 A;  5GAO m;  4ZGD B;  3OS0 A;  3E9G A;  3OYE A;  2GCX A;  2VXE A;  5LJ3 h;  2K5L A;  3PT9 A;  2JV2 A;  5EG2 A;  3A8G B;  2EFI A;  3SWN C;  3QWZ A;  4L6V 5;  1BI1 A;  5CKF A;  5LJ3 d;  2QA4 T;  4KUD K;  3L2V A;  4M7A D;  1U8R A;  2DXB A;  1N27 A;  5GMK m;  3JCM f;  4M7A C;  4OMF B;  3N5B B;  4C92 A;  5CR2 A;  3NTI A;  2ZPG B;  1TH7 A;  2MMP A;  3L2Z A;  2OTL T;  4M7D A;  5CD1 A;  3OYA A;  1YJ9 T;  4RCB A;  3ZFJ A;  3JB9 H;  3MEW A;  1K73 C;  2CZ0 B;  3HU1 A;  2RHZ A;  2JUF A;  3OSV A;  3CCL A;  1QVF S;  2ZPF B;  4C5G A;  5GAO p;  2XID A;  1LJO A;  2XHC A;  1WJQ A;  1ZBX A;  3OYB A;  2EJF A;  1I8F A;  1VIF A;  2LDM A;  2P4T A;  2RHU A;  3QYG B;  1I9G A;  3PMT A;  4OB1 B;  3G6E T;  4RV0 A;  2M1H A;  4CI0 C;  4RMO A;  3CC7 A;  2KVQ G;  3OYC A;  3PTA A;  3CCM T;  4J8O A;  4D6W A;  5GAO q;  2F69 A;  3L2R A;  1KHI A;  5J26 A;  2EQJ A;  2VGN A;  2ZPI B;  3OYI A;  2PVG B;  1Q7Y U;  4F7U B;  2RI2 A;  4BDZ A;  4FM4 B;  3LLR A;  3OS2 A;  1CR5 A;  5GAM f;  4X34 A;  1D3B A;  4FIB A;  3TEE A;  3OYD A;  2B8A A;  4BDY A;  1KC8 C;  2DD4 A;  2KY9 A;  3GIB A;  4ZN1 A;  3JCM P;  2YVL A;  3CCV T;  4LD6 A;  3LH0 A;  1N6A A;  3VV0 A;  2B25 A;  2L5Q A;  3SD4 A;  4BY6 B;  2LQ8 A;  3X20 B;  4MML A;  4B9X A;  2K57 A;  4C92 C;  2V8J A;  1NPP A;  4ARI A;  4M7D C;  4C0D C;  1P92 A;  5KE3 A;  4IUV A;  1QVP A;  5A2Q E;  3A8M B;  3HU3 A;  3G71 A;  1VQ9 T;  2LX9 A;  3C4S A;  4XQ3 A;  4F7U A;  3CCU T;  1BKB A;  4PJO F;  2QQB A;  3INZ A;  3RKY A;  1Y71 A;  3CCE A;  1Y07 A;  5FU7 B;  3NFC A;  1YHQ A;  1NE8 A;  2JNG A;  2ZPE B;  3MCA B;  3P8H A;  4NL2 A;  4KUL A;  4HCC A;  2V8I A;  1M90 C;  2MWP A;  3BFM A;  5FTL A;  1OI1 A;  1X75 C;  1H64 1;  4C8Q E;  2DXT A;  1KQS A;  2GF7 A;  2DXU A;  3UDC A;  5HK3 A;  3LX7 A;  3JCM e;  1G5V A;  2WSC E;  3HFN A;  1VQM A;  4WF2 A;  2RH2 A;  4MZT A;  2E5Q A;  3FLG A;  4O5V A;  3PMI A;  2AHJ B;  4A4F A;  4ELY C;  5GAN 5;  4HT8 A;  3JB9 F;  3CCQ A;  4M75 G;  2K2V A;  1N9R A;  4Y91 A;  2RHX A;  4C8Q D;  4ELZ C;  2PJH B;  2D0Q B;  2KK4 A;  4BI3 A;  2XG8 D;  4FT2 A;  1VQO T;  4LDX A;  3JCM J;  4ARC A;  3J81 E;  5CCA A;  3H8Z A;  3LGL A;  1JJ2 A;  4BI4 A;  3X26 B;  3JB9 J;  1S72 A;  1QVG A;  4NOY A;  1VQ4 T;  3SWN B;  3OB9 A;  2LTO A;  1MGQ A;  3MB5 A;  1NJI C;  3ZJV A;  3L1A A;  4FSX A;  1EIF A;  4XTU A;  5DLQ E;  5KCO A;  2DVE A;  3LW5 E;  4E47 A;  3R6O A;  3V7S A;  4M7A B;  2D6F A;  5GAM j;  5GAM e;  2K5F A;  3ZGZ A;  3OYM A;  2QA4 A;  5J39 A;  4Q5W A;  3OYY A;  4BUG A;  4NL3 A;  3M57 A;  1JBM A;  1AHJ B;  4XTX A;  2DXC A;  2M9U A;  2YLC A;  1R7R A;  2BKD N;  2WSF E;  3QJY A;  3WVD B;  3TU4 K;  4LDY A;  1G3T A;  3CC2 A;  1KQ1 A;  2QQ9 A;  3GNG A;  1ZC1 A;  2FVU A;  3JCM g;  4M7A A;  3FRN A;  3QHS A;  4BE0 A;  2LNV A;  1W2B S;  1VQK A;  2CKK A;  4AS1 A;  4KBM B;  4C92 F;  4IUP A;  3G6E A;  2EQM A;  4XTW A;  1UGQ B;  4R55 A;  4M7D F;  2JTM A;  1VQP T;  5DYG A;  1E32 A;  3PGG A;  5KCH A;  1VIE A;  3F70 A;  3CCM A;  1YI2 A;  2E6Z A;  2LC4 A;  3QC8 A;  1Y7X A;  4ATO A;  4KUI A;  2QEX A;  1K9M U;  3CCR A;  4IKF A;  2PVO B;  5CKB A;  4DA4 A;  4C5E A;  1CZ4 A;  4YTL A;  1VQ6 A;  3ASK A;  1M5Q 1;  3TRE A;  4MZM A;  4C92 B;  4ZGE B;  4M7D B;  4C0D B;  4M77 G;  3CCV A;  4BAC A;  3OYJ A;  1OZ2 A;  3OQ5 A;  3LGF A;  1RL2 A;  1UGR B;  1XNI A;  4M75 E;  2Q1C X;  1Q82 U;  2XKO C;  5GAM g;  4JLI A;  3BDU A;  4TVR A;  3DKM A;  1MHN A;  3M58 A;  5GAN 8;  3G7Z A;  2RHY A;  2VC8 A;  5ERG B;  3DLM A;  4JS5 A;  4OB3 B;  4C8Q G;  1VQ9 A;  2MM2 A;  5D6W A;  3CCU A;  3FDR A;  2FHD A;  4HCZ A;  1Q7Y C;  2HQE A;  4XTZ A;  3KXT A;  4EMG A;  3S3O A;  3CME A;  3MEV A;  5C6S A;  1Y96 B;  4ME7 A;  3FPU A;  2X35 A;  3MEU A;  2DD5 A;  4M75 D;  3JCM Q;  1O54 A;  1IZ6 A;  2QI2 A;  3J7A F;  2KMT A;  3LGA A;  3UWN A;  1BIA A;  1KHC A;  4JDS A;  2XI9 A;  2BIV A;  3GNF B;  2M16 A;  4M78 E;  4BI8 B;  4F7U F;  5HKC A;  1VQ8 A;  4EMK C;  4E7J A;  1D3B B;  4VUB A;  1FWZ A;  2HNI A;  2XDD A;  1N8R U;  1BI3 A;  1RI0 A;  1DJ7 B;  2RI3 A;  1Q86 U;  5GAN 3;  3X25 B;  4E7I A;  5HY6 A;  3X28 B;  3AHU A;  4BE1 A;  3VU3 C;  2JOY A;  2EQU A;  2PUO B;  4O6J A;  4ZTJ A;  1VQ5 T;  2ZCF B;  3JCM h;  4LDW A;  2MWO A;  4EPC A;  3NTK A;  1Y96 A;  3I56 T;  4JRQ A;  1WJS A;  1YIJ T;  4N4I A;  2L3R A;  3PIO A;  2QTX A;  1UB4 A;  1V29 B;  3CBO A;  1R8O B;  4M78 D;  3RMS A;  4C5I A;  3JCM d;  4QQD A;  1VUB A;  3OYN A;  1VQO A;  1M1K U;  4N0A A;  5I2M A;  3M59 A;  4HKE A;  1QP3 A;  5D6X A;  5CIU A;  1YBY A;  3GOX A;  2Q18 X;  1VQ7 T;  2RHI A;  4MZP A;  2YRV A;  1X01 A;  2ZPB B;  4J7F A;  5LJ5 e;  4RG8 A;  1KQ2 A;  3GPL A;  1BIB A;  1XTD A;  3SDZ A;  4C8Q A;  2JTF A;  2LT4 A;  4PL6 A;  3OYL A;  1U1T A;  1YJW T;  2WAC A;  2C06 A;  1JRI A;  5GAM h;  4R56 A;  1VQN A;  4KO8 A;  4A4H A;  4JRK A;  4M77 E;  3CCS T;  1UGS B;  5GAN g;  2XK0 A;  2HD0 A;  5CO7 A;  1FXX A;  1PSF A;  3KUF A;  2Y4Y A;  2QQR A;  3E9F A;  5GAM d;  1I81 A;  1NZ9 A;  4J6Y A;  4JJN K;  2L89 A;  3BQB A;  2LT1 A;  4IUR A;  1UGP B;  4JUV A;  5LL6 S;  5FRO A;  2RM4 A;  4OP0 A;  2DAQ A;  3QXE B;  3PFS A;  4GY5 A;  2K3Y A;  5GLF A;  3X24 B;  5C18 A;  4L5G A;  3FC3 A;  4MDW A;  1K8A U;  2PWY A;  3G4S A;  3CBP A;  4PLL A;  3CCJ A;  4M77 D;  5KH6 A;  3J80 E;  3KBG A;  3C12 A;  3Q1J A;  5GMK j;  5AYF A;  5GMK e;  3C95 A;  4N0A C;  2P0K A;  4M77 C;  1OZ3 A;  2EIF A;  4UC4 A;  3S3N A;  3CPF A;  3M53 A;  3CC4 T;  3CMA T;  1B34 B;  1WJR A;  4OF1 A;  4P5N A;  3ZJU A;  2OTJ T;  1KG1 A;  2RJD A;  3C94 A;  3LWI A;  4ZN3 A;  2K4Y A;  4M7A F;  1S3S A;  3M56 A;  1O9S A;  1M9S A;  4C8Q C;  2DZ9 A;  3OYG A;  1UEB A;  4X9C A;  3OBW A;  3CCL T;  1LOJ A;  1IRE B;  3QKJ A;  4KDI A;  2YLB A;  5LJ5 g;  5I21 A;  4N4H A;  5L8R E;  2A3L A;  3RUX A;  3OMG A;  3V7C A;  5CKH A;  4E7K A;  4E7L A;  3JB9 G;  2E1H A;  2LRQ A;  5GAN f;  2XIC A;  3UPU A;  1M4Z A;  3M9Q A;  3HSB A;  1WPY A;  3M55 A;  1B34 A;  3MEA A;  3FIF A;  2X4J A;  1I5L A;  2HAX A;  2XD0 A;  4RKU E;  4M78 G;  1GXI E;  5CCB A;  5CK9 A;  5GAN 7;  2DTH A;  3FPR A;  4A4E A;  3HRT A;  1M1F A;  3MP8 A;  2YUJ A;  2PVD B;  2LCC A;  1W2B A;  4M75 B;  1KQS S;  2DIG A;  2RJC A;  2L8D A;  1K9M C;  4J5Y A;  4Z02 A;  4X9D A;  4EMK B;  2LW6 A;  2OTL A;  4BD3 A;  1JB0 E;  2PUK B;  2NLU A;  3URG A;  1YJ9 A;  1SSF A;  3OYH A;  1M90 U;  1ZHI A;  3LWH A;  3RIR A;  2CGH A;  2GFU A;  3PNW C;  4IUT A;  3VKI A;  3WVE B;  4A4K A;  4DQ2 A;  5A0D A;  4JLG A;  5FLX E;  4E7H A;  4FU6 A;  1Q82 C;  5FRN A;  4KDL A;  4IUU A;  3L2Q A;  2QXF A;  2RA2 A;  2VXF A;  2ZGW A;  4N4G A;  4M75 A;  3G71 T;  1H3Z A;  2RO0 A;  3QYH B;  2PQW A;  3GLX A;  2BUD A;  3QPH A;  2DEQ A;  3QUI A;  2R57 A;  5FU6 C;  5J3B A;  4EMK A;  5A0G A;  2ZZD A;  5LJ5 f;  3I56 A;  2CZ1 B;  1YHQ T;  3CCE T;  3MP1 A;  1QW1 A;  2XDB A;  3CD6 T;  4PJO E;  4QVC A;  4KT0 E;  2FL7 A;  3L2U A;  3TCJ A;  2DKG A;  4HCB A;  2RB6 A;  1HXD A;  4OB2 B;  3RKW A;  2E70 A;  2A7Y A;  1OYX A;  2XU8 A;  4C5H A;  5GAO l;  3VUB A;  1N8R C;  1NPR A;  1VQ7 A;  4C0F A;  3QZ5 B;  1Q86 C;  1WGS A;  2YHT A;  2X4Y A;  2HBP A;  4M78 A;  3CXC S;  1VQM T;  4PJO D;  3EFS A;  3VYH B;  2H3J A;  3OW2 S;  1WNL A;  1QVF A;  2E64 A;  4XK8 E;  3QII A;  5GMK l;  3OA6 A;  1VQ5 A;  5LJ3 f;  3CPW S;  2Q19 X;  2RK2 A;  3P8B B;  3QBY A;  3QJ6 A;  2RJF A;  2DTI A;  4QW2 A;  1VQK T;  1M1K C;  5CQX A;  3JCM X;  4OB0 B;  1U1S A;  3HKS A;  2E10 A;  2OAU A;  3QO3 A;  4BB7 A;  5GAN e;  4C8Q F;  3QZ9 B;  5GAN j;  3A8H B;  3L42 A;  2WSE E;  1S72 T;  2DO3 A;  3HL8 A;  3HPW A;  2EJ9 A;  4M75 C;  2RJE A;  3ME9 A;  4A54 A;  2I2L A;  3JCM b;  2KSS A;  1BYM A;  1M8V A;  2DZC A;  1FX7 A;  4M77 B;  4PKC C;  1N9S A;  4B9W A;  4XTV A;  3M5A A;  4A4G A;  3GF5 A;  3HP9 A;  4II1 A;  3H6Z A;  4DOV A;  3JB9 D;  2KAF A;  5GMK h;  4C8Q B;  4FL6 A;  3E19 A;  3CC4 A;  3CMA A;  1HK9 A;  3CEY A;  2MAM A;  3JRZ A;  4HA8 A;  4F7U G;  2OTJ A;  5FTJ A;  2EQK A;  4QVZ A;  4M78 C;  3V8J A;  2X4W A;  4M77 A;  4OVA A;  4XU3 A;  2F5K A;  2RD1 A;  2JN0 A;  4EDU A;  2MF2 A;  1KD1 U;  3CC2 T;  3EAE A;  3GP8 A;  1VQ4 A;  1K8A C;  3OSS C;  3TIW A;  5LJ5 j;  2DPP B;  3M4G A;  5CVI A;  1YJN T;  2CZ7 B;  3OS5 A;  1PSE A;  1ZQ1 A;  3DB4 A;  3M4Y A;  4JRP A;  1VQL T;  1QP2 A;  1O75 A;  1XOV A;  2LCL A;  2MM0 A;  1W4S A;  1G3W A;  4C92 E;  1YI2 T;  2JZ2 A;  2KDS A;  4M7D E;  3VUZ A;  1WQW A;  4CQN A;  2E65 A;  2XDP A;  3JCM c;  1YIT T;  2RI5 A;  2QEX T;  3CCR T;  2G3R A;  3FB9 A;  2DIQ A;  5C1B A;  4LD9 K;  5GAN 6;  1VQ6 T;  3BY7 A;  4L59 A;  2CS7 A;  3HRS A;  4KLN A;  4QQ6 A;  4J83 A;  5DLO A;  5IT9 E;  1K73 U;  3SFM A;  5DM7 R;  4C92 D;  3M54 A;  4EMH A;  5LJ3 e;  4PJO G;  2GFA A;  5FU6 B;  5LJ3 j;  4M7D D;  2E12 A;  4C0G A;  3CBM A;  2GQV A;  3FJP A;  2KQW A;  2RK1 A;  2IG0 A;  5M9O A;  1QDN A;  1VQP A;  1BI0 A;  2LVM A;  3I55 A;  3BDL A;  2QQA A;  4CRI A;  3CME T;  3JCM V;  1WQ7 A;  2E6N A;  2EYQ A;  2F5T X;  3VJP A;  4NS5 A;  3BW1 A;  3CD6 A;  5GAO n;  3UT1 A;  4JS4 A;  2QQS A;  3HHT B;  4GLK A;  2EAY A;  4LDV A;  3V8L A;  1VQ8 T;  3HFO A;  5CKE A;  4M75 F;  1KC8 U;  3FPT A;  4OGC A;  5DYI A;  3FEO A;  1Q81 C;  3T9N A;  4PLI A;  4XU0 A;  4PJO B;  4JRI A;  5GAO r;  4XU1 A;  4HT9 A;  4F7U E;  3A8O B;  4XAX B;  2EKO A;  4MMK A;  3CC7 T;  3S3M A;  2Q1D X;  2DK3 A;  1G3S A;  4M7A G;  3E1S A;  5FTK A;  2EJG A;  5GAN 4;  5FTN A;  5FTM A;  5HK0 A;  2FYK A;  4ZGJ B;  2VYT A;  3P8D A;  1CZ5 A;  4J7I A;  2QDY B;  4IUQ A;  3RKX A;  2R5M A;  5IN1 A;  1LNX A;  4KOD A;  2X4X A;  3NTH A;  4AQ7 A;  4BE2 A;  4M78 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...