3FPTA

The crystal structure of the complex between evasin-1 and ccl3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
b'DLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 16
structure length 88
sequence length 88
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fptA00
3FPRA 3FPUA 3FPTA
chains in the Genus database with same CATH superfamily
3TIWA 2Q1AX 3HU2A 5EQJB 1CZ4A 2QQRA 4KLNA 4RV0A 5FTKA 2LW6A 1I9GA 1ZC1A 1CR5A 3HU1A 5CCXA 2B25A 1E32A 2MM2A 5CD1A 3QWZA 5DYIA 2Q19X 1S3SA 2PWYA 2YUJA 3ZJTA 5B6CA 4CQNA 3FPTA 5DYGA 4FIBA 5EPPA 5C18A 5C1BA 4UC4A 5ERGB 4KO8A 3HU3A 2KY9A 5FTLA 5FTMA 4ARCA 4AS1A 4KDLA 2XDPA 2MM0A 5FTNA 3ZGZA 1R7RA 1QDNA 2YVLA 4KODA 5GLFA 2QQSA 2GF7A 3LHDA 1WLFA 3QQ7A 5FTJA 5D6WA 3LGAA 4KDIA 1O54A 4AQ7A 3MB5A 2Q1DX 3CF2A 5D6YA 1QCSA 2Q1CX 5D6XA 4ARIA 3QC8A 2PJHB 3ZJUA 2JV2A 2Q18X 3ZJVA 3FPUA 3FPRA 2GFAA 5CCBA 1CZ5A 3QQ8A 3BQBA
chains in the Genus database with same CATH topology
3TIWA 2Q1AX 3HU2A 5EQJB 1CZ4A 2QQRA 4KLNA 4RV0A 5FTKA 2LW6A 1I9GA 1ZC1A 1CR5A 3HU1A 5CCXA 2B25A 1E32A 2MM2A 5CD1A 3QWZA 5DYIA 2Q19X 1S3SA 2PWYA 2YUJA 3ZJTA 5B6CA 4CQNA 3FPTA 5DYGA 4FIBA 5EPPA 5C18A 5C1BA 4UC4A 5ERGB 4KO8A 3HU3A 2KY9A 5FTLA 5FTMA 4ARCA 4AS1A 4KDLA 2XDPA 2MM0A 5FTNA 3ZGZA 1R7RA 1QDNA 2YVLA 4KODA 5GLFA 2QQSA 2GF7A 3LHDA 1WLFA 3QQ7A 5FTJA 5D6WA 3LGAA 4KDIA 1O54A 4AQ7A 3MB5A 2Q1DX 3CF2A 5D6YA 1QCSA 2Q1CX 5D6XA 4ARIA 3QC8A 2PJHB 3ZJUA 2JV2A 2Q18X 3ZJVA 3FPUA 3FPRA 2GFAA 5CCBA 1CZ5A 3QQ8A 3BQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPR A;  3FPU A;  3FPT A; 
#chains in the Genus database with same CATH topology
 3TIW A;  2Q1A X;  3HU2 A;  5EQJ B;  1CZ4 A;  2QQR A;  4KLN A;  4RV0 A;  5FTK A;  2LW6 A;  1I9G A;  1ZC1 A;  1CR5 A;  3HU1 A;  5CCX A;  2B25 A;  1E32 A;  2MM2 A;  5CD1 A;  3QWZ A;  5DYI A;  2Q19 X;  1S3S A;  2PWY A;  2YUJ A;  3ZJT A;  5B6C A;  4CQN A;  3FPT A;  5DYG A;  4FIB A;  5EPP A;  5C18 A;  5C1B A;  4UC4 A;  5ERG B;  4KO8 A;  3HU3 A;  2KY9 A;  5FTL A;  5FTM A;  4ARC A;  4AS1 A;  4KDL A;  2XDP A;  2MM0 A;  5FTN A;  3ZGZ A;  1R7R A;  1QDN A;  2YVL A;  4KOD A;  5GLF A;  2QQS A;  2GF7 A;  3LHD A;  1WLF A;  3QQ7 A;  5FTJ A;  5D6W A;  3LGA A;  4KDI A;  1O54 A;  4AQ7 A;  3MB5 A;  2Q1D X;  3CF2 A;  5D6Y A;  1QCS A;  2Q1C X;  5D6X A;  4ARI A;  3QC8 A;  2PJH B;  3ZJU A;  2JV2 A;  2Q18 X;  3ZJV A;  3FPU A;  3FPR A;  2GFA A;  5CCB A;  1CZ5 A;  3QQ8 A;  3BQB A; 
#chains in the Genus database with same CATH homology
 3TIW A;  2Q1A X;  3HU2 A;  5EQJ B;  1CZ4 A;  2QQR A;  4KLN A;  4RV0 A;  5FTK A;  2LW6 A;  1I9G A;  1ZC1 A;  1CR5 A;  3HU1 A;  5CCX A;  2B25 A;  1E32 A;  2MM2 A;  5CD1 A;  3QWZ A;  5DYI A;  2Q19 X;  1S3S A;  2PWY A;  2YUJ A;  3ZJT A;  5B6C A;  4CQN A;  3FPT A;  5DYG A;  4FIB A;  5EPP A;  5C18 A;  5C1B A;  4UC4 A;  5ERG B;  4KO8 A;  3HU3 A;  2KY9 A;  5FTL A;  5FTM A;  4ARC A;  4AS1 A;  4KDL A;  2XDP A;  2MM0 A;  5FTN A;  3ZGZ A;  1R7R A;  1QDN A;  2YVL A;  4KOD A;  5GLF A;  2QQS A;  2GF7 A;  3LHD A;  1WLF A;  3QQ7 A;  5FTJ A;  5D6W A;  3LGA A;  4KDI A;  1O54 A;  4AQ7 A;  3MB5 A;  2Q1D X;  3CF2 A;  5D6Y A;  1QCS A;  2Q1C X;  5D6X A;  4ARI A;  3QC8 A;  2PJH B;  3ZJU A;  2JV2 A;  2Q18 X;  3ZJV A;  3FPU A;  3FPR A;  2GFA A;  5CCB A;  1CZ5 A;  3QQ8 A;  3BQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...