3FPTA

The crystal structure of the complex between evasin-1 and ccl3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
DLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 16
structure length 88
sequence length 88
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fptA00
3FPUA 3FPRA 3FPTA
chains in the Genus database with same CATH superfamily
3BQBA 5DYIA 3HU3A 2Q19X 4ARCA 5D6XA 3FPTA 3ZJVA 1WLFA 2Q18X 5D6YA 5FTLA 5CD1A 2JV2A 1E32A 5CCBA 1CZ4A 3ZJUA 1O54A 5FTJA 3QQ8A 3HU2A 3LGAA 4CQNA 5EQJB 2YVLA 3HU1A 5ERGB 3QC8A 3TIWA 3CF2A 3QWZA 5FTNA 5FTKA 1CZ5A 5D6WA 3FPUA 2GF7A 2QQRA 4KO8A 4UC4A 1CR5A 2GFAA 3ZGZA 2XDPA 3ZJTA 1QCSA 2Q1CX 4KDIA 5DYGA 2B25A 3LHDA 3FPRA 2PWYA 4ARIA 4AS1A 3QQ7A 2LW6A 5EPPA 3MB5A 2PJHB 4KODA 5GLFA 5C18A 4KDLA 4FIBA 5FTMA 5CCXA 1I9GA 1R7RA 2YUJA 2MM2A 2Q1AX 2KY9A 1ZC1A 4RV0A 1QDNA 4AQ7A 2QQSA 2Q1DX 5C1BA 1S3SA 5B6CA 4KLNA 2MM0A
chains in the Genus database with same CATH topology
3BQBA 5DYIA 3HU3A 2Q19X 4ARCA 5D6XA 3FPTA 3ZJVA 1WLFA 2Q18X 5D6YA 5FTLA 5CD1A 2JV2A 1E32A 5CCBA 1CZ4A 3ZJUA 1O54A 5FTJA 3QQ8A 3HU2A 3LGAA 4CQNA 5EQJB 2YVLA 3HU1A 5ERGB 3QC8A 3TIWA 3CF2A 3QWZA 5FTNA 5FTKA 1CZ5A 5D6WA 3FPUA 2GF7A 2QQRA 4KO8A 4UC4A 1CR5A 2GFAA 3ZGZA 2XDPA 3ZJTA 1QCSA 2Q1CX 4KDIA 5DYGA 2B25A 3LHDA 3FPRA 2PWYA 4ARIA 4AS1A 3QQ7A 2LW6A 5EPPA 3MB5A 2PJHB 4KODA 5GLFA 5C18A 4KDLA 4FIBA 5FTMA 5CCXA 1I9GA 1R7RA 2YUJA 2MM2A 2Q1AX 2KY9A 1ZC1A 4RV0A 1QDNA 4AQ7A 2QQSA 2Q1DX 5C1BA 1S3SA 5B6CA 4KLNA 2MM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPU A;  3FPR A;  3FPT A; 
#chains in the Genus database with same CATH topology
 3BQB A;  5DYI A;  3HU3 A;  2Q19 X;  4ARC A;  5D6X A;  3FPT A;  3ZJV A;  1WLF A;  2Q18 X;  5D6Y A;  5FTL A;  5CD1 A;  2JV2 A;  1E32 A;  5CCB A;  1CZ4 A;  3ZJU A;  1O54 A;  5FTJ A;  3QQ8 A;  3HU2 A;  3LGA A;  4CQN A;  5EQJ B;  2YVL A;  3HU1 A;  5ERG B;  3QC8 A;  3TIW A;  3CF2 A;  3QWZ A;  5FTN A;  5FTK A;  1CZ5 A;  5D6W A;  3FPU A;  2GF7 A;  2QQR A;  4KO8 A;  4UC4 A;  1CR5 A;  2GFA A;  3ZGZ A;  2XDP A;  3ZJT A;  1QCS A;  2Q1C X;  4KDI A;  5DYG A;  2B25 A;  3LHD A;  3FPR A;  2PWY A;  4ARI A;  4AS1 A;  3QQ7 A;  2LW6 A;  5EPP A;  3MB5 A;  2PJH B;  4KOD A;  5GLF A;  5C18 A;  4KDL A;  4FIB A;  5FTM A;  5CCX A;  1I9G A;  1R7R A;  2YUJ A;  2MM2 A;  2Q1A X;  2KY9 A;  1ZC1 A;  4RV0 A;  1QDN A;  4AQ7 A;  2QQS A;  2Q1D X;  5C1B A;  1S3S A;  5B6C A;  4KLN A;  2MM0 A; 
#chains in the Genus database with same CATH homology
 3BQB A;  5DYI A;  3HU3 A;  2Q19 X;  4ARC A;  5D6X A;  3FPT A;  3ZJV A;  1WLF A;  2Q18 X;  5D6Y A;  5FTL A;  5CD1 A;  2JV2 A;  1E32 A;  5CCB A;  1CZ4 A;  3ZJU A;  1O54 A;  5FTJ A;  3QQ8 A;  3HU2 A;  3LGA A;  4CQN A;  5EQJ B;  2YVL A;  3HU1 A;  5ERG B;  3QC8 A;  3TIW A;  3CF2 A;  3QWZ A;  5FTN A;  5FTK A;  1CZ5 A;  5D6W A;  3FPU A;  2GF7 A;  2QQR A;  4KO8 A;  4UC4 A;  1CR5 A;  2GFA A;  3ZGZ A;  2XDP A;  3ZJT A;  1QCS A;  2Q1C X;  4KDI A;  5DYG A;  2B25 A;  3LHD A;  3FPR A;  2PWY A;  4ARI A;  4AS1 A;  3QQ7 A;  2LW6 A;  5EPP A;  3MB5 A;  2PJH B;  4KOD A;  5GLF A;  5C18 A;  4KDL A;  4FIB A;  5FTM A;  5CCX A;  1I9G A;  1R7R A;  2YUJ A;  2MM2 A;  2Q1A X;  2KY9 A;  1ZC1 A;  4RV0 A;  1QDN A;  4AQ7 A;  2QQS A;  2Q1D X;  5C1B A;  1S3S A;  5B6C A;  4KLN A;  2MM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...