4KDIA

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
157
Chain Sequence
b'NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
molecule tags Signaling protein/hydrolase
source organism Homo sapiens
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
total genus 46
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4kdiA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4kdiA02
4AYBA 1SIWA 1TWFA 2JA7A 1PT0A 2V3VA 5C1BA 3GTOA 1TWAA 2WB1A 3O5AA 2IV2X 1Y4ZA 2DMRA 3QQ7A 2JIRA 4C2MA 2JA6A 2Y0SA 1SFOA 1TWHA 1K83A 2R93A 1CZ5A 1E60A 5DYGA 1UHEA 3GTLA 2JIMA 3H0GA 1E18A 3FKIA 3IR7A 5DYIA 2C45A 3GTJA 1PYUB 1PQEA 3CQZA 2JIOA 5FTKA 1PQFA 1TWCA 3GTPA 3HU2A 5FTNA 4AONB 2NYAA 3GTMA 1QCSA 1H0HA 2NAPA 5T5MD 3QC8A 1TMOA 4CRYG 4GA5A 1Y5IA 1Y1WA 1H5NA 2YU9A 4AOKB 3PLXB 1WCMA 4KDIA 4AZDA 4GA6A 2V45A 1TWGA 2KI8A 1YLEA 4RV0A 1Q16A 1G8KA 2R92A 2E2IA 3HU3A 4KDLA 1R27A 2VPYA 1EU1A 1QDNA 1KQGA 1S3SA 2YUJA 1I3QA 5FTLA 1I50A 1VC3B 3IR5A 2PMZA 3DMRA 5EPPA 2JV2A 1UHDA 3TIWA 1OGYA 4CRZA 1R7RA 5T5ID 2JIPA 3CF2A 4D7ZB 2B63A 2NVXA 4DMRA 5C18A 2VUMA 1IW7D 5FTJA 5GLFA 3HU1A 4AAYA 3QWZA 3GTKA 1DMSA 2E2HA 1R9TA 2EEOB 4CS0A 2VPWA 2R7ZA 3QQ8A 1ZC1A 4KO8A 1FDIA 1PT1A 3IR6A 1CZ4A 3ML1A 4KODA 2PJHB 2JIQA 2VPZA 4QIWA 3GTQA 3OUGA 1AW8B 5B6CA 1E5VA 1AA6A 1WLFA 1KQFA 5FTMA 2JA5A 3HKZA 1DMRA 1FDOA 2WAQA 1PYQA 1CR5A 1G8JA 4KLNA 2VPXA 1Y1VA 1PPYA 1E32A 3GTGA 2NVYA 1E61A 3TM7B 1PQHA 2E7ZA
chains in the Genus database with same CATH superfamily
4AYBA 2PICA 1SIWA 1TWFA 3ENGA 4FERA 2JA7A 1PT0A 2V3VA 4ZM7A 5C1BA 4CQNA 3GTOA 1TWAA 2WB1A 3O5AA 1OA9A 2IV2X 1Y4ZA 2LW6A 4ARIA 2DMRA 1N10A 2PWYA 3SUJA 3QQ7A 2JIRA 4C2MA 1OA7A 2JA6A 2Y0SA 1SFOA 1TWHA 1K83A 2R93A 1CZ5A 2B25A 1E60A 5DYGA 1UHEA 3ZJTA 4FIBA 1YNND 4FG4A 3X2NA 2Q1DX 4ARCA 3GTLA 2JIMA 1E18A 3FKIA 3H0GA 4ENGA 2MM2A 3FPRA 3FPTA 3IR7A 4AS1A 2A68D 5DYIA 2C45A 3X2JA 3GTJA 1PYUB 4JJOA 2QQSA 1PQEA 2PNWA 3CQZA 4JP6A 3X2OA 4UC4A 2JIOA 5FTKA 1PQFA 1TWCA 3GTPA 2ENGA 3HU2A 5FTNA 1SMYD 2NYAA 4AONB 3GTMA 3LHDA 2Q18X 1QCSA 1O54A 1L8FA 1H0HA 5H4UA 2NAPA 5CCXA 5T5MD 1ZYRD 5D6XA 3QC8A 1TMOA 4CRYG 4GA5A 1Y5IA 3X2PA 1Y1WA 1H5NA 3M3GA 4AOKB 4AVRA 2YU9A 3PLXB 1WCMA 4KDIA 4AZDA 5D6WA 3X2GA 5D6YA 4L48A 4GA6A 2V45A 1TWGA 5GM9A 2KI8A 1YLEA 3SUMA 3X2IA 4RV0A 1I9GA 2Q1CX 1Q16A 1G8KA 4FG2A 2GFAA 2R92A 2E2IA 2KQAA 5CCBA 1YNJD 2PJJA 3HU3A 4KDLA 1R27A 3SUKA 2AE0X 2VPYA 1EU1A 3X2MA 2XDPA 1QDNA 1KQGA 1S3SA 2MM0A 2YUJA 2QQRA 1I3QA 5FTLA 1I50A 1VC3B 3MB5A 3IR5A 2PMZA 3X2LA 4FFTA 3DMRA 3CZBA 5EPPA 4JS7A 1WC2A 2JV2A 1UHDA 3TIWA 1OGYA 3ZJUA 3SULA 2KY9A 4CRZA 3X2HA 2A6ED 1R7RA 5T5ID 2CW0D 2JIPA 3CF2A 2PI8A 4D7ZB 2G6GA 2G5DA 3D30A 4NOHA 5GLYA 2NVXA 4DMRA 2B63A 5C18A 2VUMA 1IW7D 5FTJA 3FPUA 5GLFA 1HD5A 3HU1A 4JP7A 4AAYA 3QWZA 2YVLA 4AQ7A 3GTKA 3ZGZA 1DMSA 2E2HA 4JCWA 1BW4A 2GF7A 2HCZX 2A6HD 2O5JD 1R9TA 3X2KA 2EEOB 1BW3A 3BQBA 5EQJB 5ERGB 5CD1A 4CS0A 2VPWA 2R7ZA 3QQ8A 1ZC1A 4KO8A 1FDIA 1PT1A 3IR6A 1CZ4A 3ML1A 4KODA 3ZJVA 2PJHB 2JIQA 2VPZA 2Q1AX 4QIWA 3GTQA 3OUGA 3LGAA 1AW8B 2BE5D 5GLXA 5B6CA 1E5VA 1AA6A 1WLFA 1KQFA 5FTMA 2JA5A 3HKZA 1DMRA 1FDOA 2GAEA 1PYQA 2BH0A 1CR5A 1G8JA 2WAQA 2VPXA 1Y1VA 1PPYA 1E32A 4KLNA 2NVYA 3GTGA 1E61A 2Q19X 3TM7B 1PQHA 2E7ZA 2A69D
chains in the Genus database with same CATH topology
4AYBA 2PICA 1SIWA 1TWFA 2JA7A 1PT0A 2V3VA 5C1BA 4CQNA 3GTOA 1TWAA 2WB1A 3O5AA 2IV2X 1Y4ZA 2LW6A 4ARIA 2DMRA 2PWYA 3QQ7A 2JIRA 4C2MA 2JA6A 2Y0SA 1SFOA 1TWHA 1K83A 2R93A 1CZ5A 2B25A 1E60A 5DYGA 1UHEA 3ZJTA 4FIBA 1YNND 2Q1DX 4ARCA 3GTLA 2JIMA 1E18A 3FKIA 3H0GA 3FPRA 2MM2A 3FPTA 3IR7A 4AS1A 2A68D 5DYIA 2C45A 3GTJA 1PYUB 2QQSA 1PQEA 2PNWA 3CQZA 4UC4A 2JIOA 5FTKA 1PQFA 1TWCA 3GTPA 3HU2A 5FTNA 1SMYD 2NYAA 4AONB 3GTMA 3LHDA 2Q18X 1QCSA 1O54A 1H0HA 2NAPA 5CCXA 5T5MD 1ZYRD 5D6XA 3QC8A 1TMOA 4CRYG 4GA5A 1Y5IA 1Y1WA 1H5NA 2YU9A 4AOKB 3PLXB 1WCMA 4KDIA 4AZDA 5D6WA 5D6YA 4GA6A 2V45A 1TWGA 2KI8A 1YLEA 4RV0A 1I9GA 2Q1CX 1Q16A 1G8KA 2GFAA 2R92A 2E2IA 5CCBA 1YNJD 2PJJA 3HU3A 4KDLA 1R27A 2AE0X 2VPYA 1EU1A 2XDPA 1QDNA 1KQGA 1S3SA 2MM0A 2YUJA 2QQRA 1I3QA 5FTLA 1I50A 1VC3B 3MB5A 3IR5A 2PMZA 3DMRA 3CZBA 5EPPA 2JV2A 1UHDA 3TIWA 1OGYA 3ZJUA 2KY9A 4CRZA 2A6ED 1R7RA 5T5ID 2CW0D 2JIPA 3CF2A 2PI8A 4D7ZB 2G6GA 2G5DA 4NOHA 2NVXA 2B63A 4DMRA 5C18A 2VUMA 1IW7D 5FTJA 3FPUA 5GLFA 3HU1A 4AAYA 4AQ7A 3QWZA 2YVLA 3ZGZA 3GTKA 1DMSA 2E2HA 2GF7A 2A6HD 2O5JD 1R9TA 2EEOB 3BQBA 5CD1A 5EQJB 4CS0A 2VPWA 2R7ZA 3QQ8A 1ZC1A 4KO8A 1FDIA 1PT1A 3IR6A 1CZ4A 3ML1A 4KODA 3ZJVA 2PJHB 2JIQA 2VPZA 2Q1AX 4QIWA 3GTQA 3OUGA 3LGAA 1AW8B 2BE5D 5B6CA 1E5VA 1AA6A 1WLFA 1KQFA 5FTMA 2JA5A 3HKZA 1DMRA 1FDOA 2GAEA 1PYQA 2WAQA 1CR5A 1G8JA 4KLNA 2VPXA 1Y1VA 1PPYA 1E32A 3GTGA 2NVYA 5ERGB 1E61A 2Q19X 3TM7B 1PQHA 2E7ZA 2A69D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB A;  1SIW A;  1TWF A;  2JA7 A;  1PT0 A;  2V3V A;  5C1B A;  3GTO A;  1TWA A;  2WB1 A;  3O5A A;  2IV2 X;  1Y4Z A;  2DMR A;  3QQ7 A;  2JIR A;  4C2M A;  2JA6 A;  2Y0S A;  1SFO A;  1TWH A;  1K83 A;  2R93 A;  1CZ5 A;  1E60 A;  5DYG A;  1UHE A;  3GTL A;  2JIM A;  3H0G A;  1E18 A;  3FKI A;  3IR7 A;  5DYI A;  2C45 A;  3GTJ A;  1PYU B;  1PQE A;  3CQZ A;  2JIO A;  5FTK A;  1PQF A;  1TWC A;  3GTP A;  3HU2 A;  5FTN A;  4AON B;  2NYA A;  3GTM A;  1QCS A;  1H0H A;  2NAP A;  5T5M D;  3QC8 A;  1TMO A;  4CRY G;  4GA5 A;  1Y5I A;  1Y1W A;  1H5N A;  2YU9 A;  4AOK B;  3PLX B;  1WCM A;  4KDI A;  4AZD A;  4GA6 A;  2V45 A;  1TWG A;  2KI8 A;  1YLE A;  4RV0 A;  1Q16 A;  1G8K A;  2R92 A;  2E2I A;  3HU3 A;  4KDL A;  1R27 A;  2VPY A;  1EU1 A;  1QDN A;  1KQG A;  1S3S A;  2YUJ A;  1I3Q A;  5FTL A;  1I50 A;  1VC3 B;  3IR5 A;  2PMZ A;  3DMR A;  5EPP A;  2JV2 A;  1UHD A;  3TIW A;  1OGY A;  4CRZ A;  1R7R A;  5T5I D;  2JIP A;  3CF2 A;  4D7Z B;  2B63 A;  2NVX A;  4DMR A;  5C18 A;  2VUM A;  1IW7 D;  5FTJ A;  5GLF A;  3HU1 A;  4AAY A;  3QWZ A;  3GTK A;  1DMS A;  2E2H A;  1R9T A;  2EEO B;  4CS0 A;  2VPW A;  2R7Z A;  3QQ8 A;  1ZC1 A;  4KO8 A;  1FDI A;  1PT1 A;  3IR6 A;  1CZ4 A;  3ML1 A;  4KOD A;  2PJH B;  2JIQ A;  2VPZ A;  4QIW A;  3GTQ A;  3OUG A;  1AW8 B;  5B6C A;  1E5V A;  1AA6 A;  1WLF A;  1KQF A;  5FTM A;  2JA5 A;  3HKZ A;  1DMR A;  1FDO A;  2WAQ A;  1PYQ A;  1CR5 A;  1G8J A;  4KLN A;  2VPX A;  1Y1V A;  1PPY A;  1E32 A;  3GTG A;  2NVY A;  1E61 A;  3TM7 B;  1PQH A;  2E7Z A; 
#chains in the Genus database with same CATH topology
 4AYB A;  2PIC A;  1SIW A;  1TWF A;  3ENG A;  4FER A;  2JA7 A;  1PT0 A;  2V3V A;  4ZM7 A;  5C1B A;  4CQN A;  3GTO A;  1TWA A;  2WB1 A;  3O5A A;  1OA9 A;  2IV2 X;  1Y4Z A;  2LW6 A;  4ARI A;  2DMR A;  1N10 A;  2PWY A;  3SUJ A;  3QQ7 A;  2JIR A;  4C2M A;  1OA7 A;  2JA6 A;  2Y0S A;  1SFO A;  1TWH A;  1K83 A;  2R93 A;  1CZ5 A;  2B25 A;  1E60 A;  5DYG A;  1UHE A;  3ZJT A;  4FIB A;  1YNN D;  4FG4 A;  3X2N A;  2Q1D X;  4ARC A;  3GTL A;  2JIM A;  1E18 A;  3FKI A;  3H0G A;  4ENG A;  2MM2 A;  3FPR A;  3FPT A;  3IR7 A;  4AS1 A;  2A68 D;  5DYI A;  2C45 A;  3X2J A;  3GTJ A;  1PYU B;  4JJO A;  2QQS A;  1PQE A;  2PNW A;  3CQZ A;  4JP6 A;  3X2O A;  4UC4 A;  2JIO A;  5FTK A;  1PQF A;  1TWC A;  3GTP A;  2ENG A;  3HU2 A;  5FTN A;  1SMY D;  2NYA A;  4AON B;  3GTM A;  3LHD A;  2Q18 X;  1QCS A;  1O54 A;  1L8F A;  1H0H A;  5H4U A;  2NAP A;  5CCX A;  5T5M D;  1ZYR D;  5D6X A;  3QC8 A;  1TMO A;  4CRY G;  4GA5 A;  1Y5I A;  3X2P A;  1Y1W A;  1H5N A;  3M3G A;  4AOK B;  4AVR A;  2YU9 A;  3PLX B;  1WCM A;  4KDI A;  4AZD A;  5D6W A;  3X2G A;  5D6Y A;  4L48 A;  4GA6 A;  2V45 A;  1TWG A;  5GM9 A;  2KI8 A;  1YLE A;  3SUM A;  3X2I A;  4RV0 A;  1I9G A;  2Q1C X;  1Q16 A;  1G8K A;  4FG2 A;  2GFA A;  2R92 A;  2E2I A;  2KQA A;  5CCB A;  1YNJ D;  2PJJ A;  3HU3 A;  4KDL A;  1R27 A;  3SUK A;  2AE0 X;  2VPY A;  1EU1 A;  3X2M A;  2XDP A;  1QDN A;  1KQG A;  1S3S A;  2MM0 A;  2YUJ A;  2QQR A;  1I3Q A;  5FTL A;  1I50 A;  1VC3 B;  3MB5 A;  3IR5 A;  2PMZ A;  3X2L A;  4FFT A;  3DMR A;  3CZB A;  5EPP A;  4JS7 A;  1WC2 A;  2JV2 A;  1UHD A;  3TIW A;  1OGY A;  3ZJU A;  3SUL A;  2KY9 A;  4CRZ A;  3X2H A;  2A6E D;  1R7R A;  5T5I D;  2CW0 D;  2JIP A;  3CF2 A;  2PI8 A;  4D7Z B;  2G6G A;  2G5D A;  3D30 A;  4NOH A;  5GLY A;  2NVX A;  4DMR A;  2B63 A;  5C18 A;  2VUM A;  1IW7 D;  5FTJ A;  3FPU A;  5GLF A;  1HD5 A;  3HU1 A;  4JP7 A;  4AAY A;  3QWZ A;  2YVL A;  4AQ7 A;  3GTK A;  3ZGZ A;  1DMS A;  2E2H A;  4JCW A;  1BW4 A;  2GF7 A;  2HCZ X;  2A6H D;  2O5J D;  1R9T A;  3X2K A;  2EEO B;  1BW3 A;  3BQB A;  5EQJ B;  5ERG B;  5CD1 A;  4CS0 A;  2VPW A;  2R7Z A;  3QQ8 A;  1ZC1 A;  4KO8 A;  1FDI A;  1PT1 A;  3IR6 A;  1CZ4 A;  3ML1 A;  4KOD A;  3ZJV A;  2PJH B;  2JIQ A;  2VPZ A;  2Q1A X;  4QIW A;  3GTQ A;  3OUG A;  3LGA A;  1AW8 B;  2BE5 D;  5GLX A;  5B6C A;  1E5V A;  1AA6 A;  1WLF A;  1KQF A;  5FTM A;  2JA5 A;  3HKZ A;  1DMR A;  1FDO A;  2GAE A;  1PYQ A;  2BH0 A;  1CR5 A;  1G8J A;  2WAQ A;  2VPX A;  1Y1V A;  1PPY A;  1E32 A;  4KLN A;  2NVY A;  3GTG A;  1E61 A;  2Q19 X;  3TM7 B;  1PQH A;  2E7Z A;  2A69 D; 
#chains in the Genus database with same CATH homology
 4AYB A;  2PIC A;  1SIW A;  1TWF A;  2JA7 A;  1PT0 A;  2V3V A;  5C1B A;  4CQN A;  3GTO A;  1TWA A;  2WB1 A;  3O5A A;  2IV2 X;  1Y4Z A;  2LW6 A;  4ARI A;  2DMR A;  2PWY A;  3QQ7 A;  2JIR A;  4C2M A;  2JA6 A;  2Y0S A;  1SFO A;  1TWH A;  1K83 A;  2R93 A;  1CZ5 A;  2B25 A;  1E60 A;  5DYG A;  1UHE A;  3ZJT A;  4FIB A;  1YNN D;  2Q1D X;  4ARC A;  3GTL A;  2JIM A;  1E18 A;  3FKI A;  3H0G A;  3FPR A;  2MM2 A;  3FPT A;  3IR7 A;  4AS1 A;  2A68 D;  5DYI A;  2C45 A;  3GTJ A;  1PYU B;  2QQS A;  1PQE A;  2PNW A;  3CQZ A;  4UC4 A;  2JIO A;  5FTK A;  1PQF A;  1TWC A;  3GTP A;  3HU2 A;  5FTN A;  1SMY D;  2NYA A;  4AON B;  3GTM A;  3LHD A;  2Q18 X;  1QCS A;  1O54 A;  1H0H A;  2NAP A;  5CCX A;  5T5M D;  1ZYR D;  5D6X A;  3QC8 A;  1TMO A;  4CRY G;  4GA5 A;  1Y5I A;  1Y1W A;  1H5N A;  2YU9 A;  4AOK B;  3PLX B;  1WCM A;  4KDI A;  4AZD A;  5D6W A;  5D6Y A;  4GA6 A;  2V45 A;  1TWG A;  2KI8 A;  1YLE A;  4RV0 A;  1I9G A;  2Q1C X;  1Q16 A;  1G8K A;  2GFA A;  2R92 A;  2E2I A;  5CCB A;  1YNJ D;  2PJJ A;  3HU3 A;  4KDL A;  1R27 A;  2AE0 X;  2VPY A;  1EU1 A;  2XDP A;  1QDN A;  1KQG A;  1S3S A;  2MM0 A;  2YUJ A;  2QQR A;  1I3Q A;  5FTL A;  1I50 A;  1VC3 B;  3MB5 A;  3IR5 A;  2PMZ A;  3DMR A;  3CZB A;  5EPP A;  2JV2 A;  1UHD A;  3TIW A;  1OGY A;  3ZJU A;  2KY9 A;  4CRZ A;  2A6E D;  1R7R A;  5T5I D;  2CW0 D;  2JIP A;  3CF2 A;  2PI8 A;  4D7Z B;  2G6G A;  2G5D A;  4NOH A;  2NVX A;  2B63 A;  4DMR A;  5C18 A;  2VUM A;  1IW7 D;  5FTJ A;  3FPU A;  5GLF A;  3HU1 A;  4AAY A;  4AQ7 A;  3QWZ A;  2YVL A;  3ZGZ A;  3GTK A;  1DMS A;  2E2H A;  2GF7 A;  2A6H D;  2O5J D;  1R9T A;  2EEO B;  3BQB A;  5CD1 A;  5EQJ B;  4CS0 A;  2VPW A;  2R7Z A;  3QQ8 A;  1ZC1 A;  4KO8 A;  1FDI A;  1PT1 A;  3IR6 A;  1CZ4 A;  3ML1 A;  4KOD A;  3ZJV A;  2PJH B;  2JIQ A;  2VPZ A;  2Q1A X;  4QIW A;  3GTQ A;  3OUG A;  3LGA A;  1AW8 B;  2BE5 D;  5B6C A;  1E5V A;  1AA6 A;  1WLF A;  1KQF A;  5FTM A;  2JA5 A;  3HKZ A;  1DMR A;  1FDO A;  2GAE A;  1PYQ A;  2WAQ A;  1CR5 A;  1G8J A;  4KLN A;  2VPX A;  1Y1V A;  1PPY A;  1E32 A;  3GTG A;  2NVY A;  5ERG B;  1E61 A;  2Q19 X;  3TM7 B;  1PQH A;  2E7Z A;  2A69 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...