4KDIA

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
157
Chain Sequence
NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4kdiA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4kdiA02
5DYGA 4CS0A 2JIRA 3OUGA 1ZC1A 1SFOA 5GLFA 4CRZA 2R93A 2WB1A 2NVYA 2JA5A 3ML1A 4GA6A 2JIPA 1CR5A 2NYAA 3HU3A 1E18A 5EPPA 2R7ZA 1OGYA 3GTKA 1E32A 1H0HA 5FTKA 1AA6A 3HU2A 1TMOA 4AAYA 1QDNA 3H0GA 1Y5IA 5FTNA 3O5AA 4GA5A 4KODA 1I50A 1G8KA 4CRYG 1QCSA 4AZDA 2NVXA 1FDIA 2YU9A 4KDLA 2WAQA 1AW8B 2E2HA 2VPXA 1WLFA 3GTPA 5FTMA 1KQGA 1PQEA 4KO8A 4AOKB 1CZ5A 2V3VA 3CQZA 1E61A 5C1BA 3GTJA 4AYBA 2PMZA 3TM7B 1WCMA 3DMRA 4DMRA 4D7ZB 3GTLA 1Y1WA 1S3SA 1TWFA 1FDOA 3QQ8A 2NAPA 1Y4ZA 3GTMA 3GTGA 3QQ7A 2E2IA 2JA6A 1E60A 2JIOA 1PT0A 3IR5A 3FKIA 5T5MD 3HKZA 5B6CA 2JA7A 2YUJA 5T5ID 1K83A 2Y0SA 1G8JA 5FTLA 1TWGA 1UHDA 4C2MA 1IW7D 3QC8A 1H5NA 4QIWA 4KDIA 5FTJA 1E5VA 1DMRA 1PPYA 1I3QA 2B63A 1PQFA 1YLEA 2E7ZA 2KI8A 1VC3B 3QWZA 1DMSA 3PLXB 4AONB 1KQFA 2R92A 2V45A 2DMRA 4RV0A 2JIMA 3TIWA 3HU1A 3GTOA 1TWAA 1TWHA 2VPZA 4KLNA 1EU1A 1R9TA 2VPYA 1PYQA 2JIQA 2VUMA 1R7RA 1SIWA 1CZ4A 2EEOB 2IV2X 1PQHA 2C45A 1PYUB 2VPWA 1PT1A 1Q16A 1Y1VA 5C18A 1UHEA 3IR6A 3GTQA 2JV2A 1TWCA 3CF2A 5DYIA 1R27A 2PJHB 3IR7A
chains in the Genus database with same CATH superfamily
5DYGA 3BQBA 2MM2A 2PNWA 4CS0A 1ZC1A 2JIRA 3OUGA 5D6XA 1OA7A 2BH0A 1SFOA 5GLFA 2A69D 4CRZA 2R93A 4AS1A 2WB1A 2NVYA 2JA5A 3ML1A 4GA6A 3X2GA 2JIPA 1BW4A 1CR5A 3SUMA 2NYAA 2MM0A 2A6HD 3HU3A 3LHDA 2A68D 5CD1A 1E18A 2G5DA 5EPPA 2R7ZA 5CCBA 2Q1CX 1OGYA 3GTKA 1E32A 1H0HA 5FTKA 1AA6A 3HU2A 1TMOA 3D30A 1QDNA 4AAYA 3H0GA 2HCZX 1Y5IA 2O5JD 5FTNA 2LW6A 3O5AA 4GA5A 4KODA 1I50A 1G8KA 4CRYG 1QCSA 4AZDA 1I9GA 2Q1AX 2NVXA 1FDIA 2YU9A 4KDLA 2WAQA 1HD5A 1AW8B 3ENGA 2E2HA 2VPXA 4FG2A 4JCWA 1WLFA 5ERGB 3GTPA 5FTMA 1KQGA 1PQEA 4KO8A 4AOKB 1CZ5A 2V3VA 3LGAA 3CQZA 1E61A 1YNJD 2KQAA 4UC4A 5C1BA 3GTJA 4AYBA 2PMZA 3TM7B 3ZJVA 1WCMA 3DMRA 4DMRA 4D7ZB 1YNND 3GTLA 1Y1WA 1S3SA 1TWFA 1FDOA 1OA9A 3X2HA 3QQ8A 3FPTA 4NOHA 4FERA 2NAPA 5GM9A 2QQRA 1Y4ZA 3ZJUA 3GTMA 3FPRA 3GTGA 3QQ7A 2E2IA 2JA6A 1E60A 2JIOA 3X2MA 2ENGA 2G6GA 4CQNA 3X2LA 1PT0A 4JP6A 3SULA 3IR5A 3FKIA 2GF7A 3SUKA 5T5MD 3HKZA 5B6CA 2JA7A 2YUJA 2A6ED 5T5ID 1K83A 2Y0SA 1G8JA 5FTLA 1TWGA 1UHDA 3X2OA 1IW7D 4C2MA 2PICA 3QC8A 4FFTA 1H5NA 1SMYD 2AE0X 4KDIA 4QIWA 5FTJA 2QQSA 1E5VA 1DMRA 1PPYA 1I3QA 2B63A 1PQFA 1YLEA 4FG4A 2KY9A 2E7ZA 2KI8A 1VC3B 3QWZA 4AVRA 2GFAA 1DMSA 3PLXB 4AONB 2Q1DX 3M3GA 3X2NA 1KQFA 2R92A 2PI8A 1BW3A 2GAEA 4JP7A 2V45A 2DMRA 4RV0A 2Q18X 2JIMA 2B25A 1ZYRD 4ARCA 3TIWA 3HU1A 3X2IA 3CZBA 2CW0D 3MB5A 3GTOA 3FPUA 2YVLA 1WC2A 1TWAA 1TWHA 2BE5D 1EU1A 2VPZA 2PJJA 2VPYA 4KLNA 1PYQA 1R9TA 2JIQA 2XDPA 5GLXA 2VUMA 5CCXA 4AQ7A 1R7RA 1SIWA 1CZ4A 2EEOB 2IV2X 1PQHA 3SUJA 1N10A 2C45A 4JS7A 4L48A 2PWYA 4JJOA 3X2JA 4FIBA 3ZJTA 1PYUB 2VPWA 3ZGZA 1PT1A 1Q16A 1Y1VA 5C18A 4ARIA 1UHEA 3IR6A 4ZM7A 5D6WA 1L8FA 4ENGA 5H4UA 3GTQA 1O54A 2JV2A 2Q19X 3X2KA 3X2PA 5EQJB 5D6YA 1TWCA 5GLYA 3CF2A 5DYIA 1R27A 2PJHB 3IR7A
chains in the Genus database with same CATH topology
5DYGA 3BQBA 2MM2A 2PNWA 4CS0A 1ZC1A 2JIRA 3OUGA 5D6XA 1SFOA 5GLFA 2A69D 4CRZA 2R93A 4AS1A 2WB1A 2NVYA 2JA5A 3ML1A 4GA6A 2JIPA 1CR5A 2NYAA 2MM0A 2A6HD 3HU3A 3LHDA 2A68D 5CD1A 1E18A 2G5DA 5EPPA 2R7ZA 5CCBA 2Q1CX 1OGYA 3GTKA 1E32A 1H0HA 5FTKA 1AA6A 3HU2A 1TMOA 4AAYA 1QDNA 3H0GA 2O5JD 1Y5IA 2LW6A 5FTNA 3O5AA 4GA5A 4KODA 1I50A 1G8KA 4CRYG 1QCSA 4AZDA 1I9GA 2Q1AX 2NVXA 1FDIA 2YU9A 4KDLA 2WAQA 1AW8B 2E2HA 2VPXA 5ERGB 1WLFA 3GTPA 5FTMA 1KQGA 1PQEA 4KO8A 4AOKB 1CZ5A 2V3VA 3LGAA 3CQZA 1E61A 1YNJD 4UC4A 5C1BA 3GTJA 4AYBA 2PMZA 3TM7B 3ZJVA 1WCMA 3DMRA 4DMRA 4D7ZB 1YNND 3GTLA 1Y1WA 1S3SA 1TWFA 1FDOA 3QQ8A 3FPTA 4NOHA 2NAPA 2QQRA 1Y4ZA 3ZJUA 3GTMA 3FPRA 3GTGA 3QQ7A 2E2IA 2JA6A 1E60A 2JIOA 2G6GA 4CQNA 1PT0A 2GF7A 3IR5A 3FKIA 5T5MD 3HKZA 5B6CA 2JA7A 2YUJA 2A6ED 5T5ID 1K83A 2Y0SA 1G8JA 5FTLA 1TWGA 1UHDA 4C2MA 1IW7D 4ARIA 2PICA 3QC8A 1H5NA 1SMYD 2AE0X 4KDIA 4QIWA 5FTJA 2QQSA 1E5VA 1DMRA 1PPYA 1I3QA 2B63A 1PQFA 1YLEA 2KY9A 2E7ZA 2KI8A 1VC3B 3QWZA 2GFAA 1DMSA 3PLXB 4AONB 2Q1DX 1KQFA 2R92A 2PI8A 2GAEA 2V45A 2DMRA 4RV0A 2Q18X 2JIMA 2B25A 1ZYRD 4ARCA 3TIWA 3HU1A 3CZBA 2CW0D 3MB5A 3GTOA 3FPUA 2YVLA 1TWAA 1TWHA 2VPZA 2BE5D 1EU1A 4KLNA 2PJJA 2VPYA 1R9TA 1PYQA 2JIQA 2XDPA 2VUMA 5CCXA 4AQ7A 1R7RA 1SIWA 1CZ4A 2EEOB 2IV2X 1PQHA 2C45A 2PWYA 3ZJTA 4FIBA 1PYUB 2VPWA 3ZGZA 1PT1A 1Q16A 1Y1VA 5C18A 1UHEA 3IR6A 5D6WA 3GTQA 1O54A 2JV2A 2Q19X 5EQJB 5D6YA 1TWCA 3CF2A 5DYIA 1R27A 2PJHB 3IR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYG A;  4CS0 A;  2JIR A;  3OUG A;  1ZC1 A;  1SFO A;  5GLF A;  4CRZ A;  2R93 A;  2WB1 A;  2NVY A;  2JA5 A;  3ML1 A;  4GA6 A;  2JIP A;  1CR5 A;  2NYA A;  3HU3 A;  1E18 A;  5EPP A;  2R7Z A;  1OGY A;  3GTK A;  1E32 A;  1H0H A;  5FTK A;  1AA6 A;  3HU2 A;  1TMO A;  4AAY A;  1QDN A;  3H0G A;  1Y5I A;  5FTN A;  3O5A A;  4GA5 A;  4KOD A;  1I50 A;  1G8K A;  4CRY G;  1QCS A;  4AZD A;  2NVX A;  1FDI A;  2YU9 A;  4KDL A;  2WAQ A;  1AW8 B;  2E2H A;  2VPX A;  1WLF A;  3GTP A;  5FTM A;  1KQG A;  1PQE A;  4KO8 A;  4AOK B;  1CZ5 A;  2V3V A;  3CQZ A;  1E61 A;  5C1B A;  3GTJ A;  4AYB A;  2PMZ A;  3TM7 B;  1WCM A;  3DMR A;  4DMR A;  4D7Z B;  3GTL A;  1Y1W A;  1S3S A;  1TWF A;  1FDO A;  3QQ8 A;  2NAP A;  1Y4Z A;  3GTM A;  3GTG A;  3QQ7 A;  2E2I A;  2JA6 A;  1E60 A;  2JIO A;  1PT0 A;  3IR5 A;  3FKI A;  5T5M D;  3HKZ A;  5B6C A;  2JA7 A;  2YUJ A;  5T5I D;  1K83 A;  2Y0S A;  1G8J A;  5FTL A;  1TWG A;  1UHD A;  4C2M A;  1IW7 D;  3QC8 A;  1H5N A;  4QIW A;  4KDI A;  5FTJ A;  1E5V A;  1DMR A;  1PPY A;  1I3Q A;  2B63 A;  1PQF A;  1YLE A;  2E7Z A;  2KI8 A;  1VC3 B;  3QWZ A;  1DMS A;  3PLX B;  4AON B;  1KQF A;  2R92 A;  2V45 A;  2DMR A;  4RV0 A;  2JIM A;  3TIW A;  3HU1 A;  3GTO A;  1TWA A;  1TWH A;  2VPZ A;  4KLN A;  1EU1 A;  1R9T A;  2VPY A;  1PYQ A;  2JIQ A;  2VUM A;  1R7R A;  1SIW A;  1CZ4 A;  2EEO B;  2IV2 X;  1PQH A;  2C45 A;  1PYU B;  2VPW A;  1PT1 A;  1Q16 A;  1Y1V A;  5C18 A;  1UHE A;  3IR6 A;  3GTQ A;  2JV2 A;  1TWC A;  3CF2 A;  5DYI A;  1R27 A;  2PJH B;  3IR7 A; 
#chains in the Genus database with same CATH topology
 5DYG A;  3BQB A;  2MM2 A;  2PNW A;  4CS0 A;  1ZC1 A;  2JIR A;  3OUG A;  5D6X A;  1OA7 A;  2BH0 A;  1SFO A;  5GLF A;  2A69 D;  4CRZ A;  2R93 A;  4AS1 A;  2WB1 A;  2NVY A;  2JA5 A;  3ML1 A;  4GA6 A;  3X2G A;  2JIP A;  1BW4 A;  1CR5 A;  3SUM A;  2NYA A;  2MM0 A;  2A6H D;  3HU3 A;  3LHD A;  2A68 D;  5CD1 A;  1E18 A;  2G5D A;  5EPP A;  2R7Z A;  5CCB A;  2Q1C X;  1OGY A;  3GTK A;  1E32 A;  1H0H A;  5FTK A;  1AA6 A;  3HU2 A;  1TMO A;  3D30 A;  1QDN A;  4AAY A;  3H0G A;  2HCZ X;  1Y5I A;  2O5J D;  5FTN A;  2LW6 A;  3O5A A;  4GA5 A;  4KOD A;  1I50 A;  1G8K A;  4CRY G;  1QCS A;  4AZD A;  1I9G A;  2Q1A X;  2NVX A;  1FDI A;  2YU9 A;  4KDL A;  2WAQ A;  1HD5 A;  1AW8 B;  3ENG A;  2E2H A;  2VPX A;  4FG2 A;  4JCW A;  1WLF A;  5ERG B;  3GTP A;  5FTM A;  1KQG A;  1PQE A;  4KO8 A;  4AOK B;  1CZ5 A;  2V3V A;  3LGA A;  3CQZ A;  1E61 A;  1YNJ D;  2KQA A;  4UC4 A;  5C1B A;  3GTJ A;  4AYB A;  2PMZ A;  3TM7 B;  3ZJV A;  1WCM A;  3DMR A;  4DMR A;  4D7Z B;  1YNN D;  3GTL A;  1Y1W A;  1S3S A;  1TWF A;  1FDO A;  1OA9 A;  3X2H A;  3QQ8 A;  3FPT A;  4NOH A;  4FER A;  2NAP A;  5GM9 A;  2QQR A;  1Y4Z A;  3ZJU A;  3GTM A;  3FPR A;  3GTG A;  3QQ7 A;  2E2I A;  2JA6 A;  1E60 A;  2JIO A;  3X2M A;  2ENG A;  2G6G A;  4CQN A;  3X2L A;  1PT0 A;  4JP6 A;  3SUL A;  3IR5 A;  3FKI A;  2GF7 A;  3SUK A;  5T5M D;  3HKZ A;  5B6C A;  2JA7 A;  2YUJ A;  2A6E D;  5T5I D;  1K83 A;  2Y0S A;  1G8J A;  5FTL A;  1TWG A;  1UHD A;  3X2O A;  1IW7 D;  4C2M A;  2PIC A;  3QC8 A;  4FFT A;  1H5N A;  1SMY D;  2AE0 X;  4KDI A;  4QIW A;  5FTJ A;  2QQS A;  1E5V A;  1DMR A;  1PPY A;  1I3Q A;  2B63 A;  1PQF A;  1YLE A;  4FG4 A;  2KY9 A;  2E7Z A;  2KI8 A;  1VC3 B;  3QWZ A;  4AVR A;  2GFA A;  1DMS A;  3PLX B;  4AON B;  2Q1D X;  3M3G A;  3X2N A;  1KQF A;  2R92 A;  2PI8 A;  1BW3 A;  2GAE A;  4JP7 A;  2V45 A;  2DMR A;  4RV0 A;  2Q18 X;  2JIM A;  2B25 A;  1ZYR D;  4ARC A;  3TIW A;  3HU1 A;  3X2I A;  3CZB A;  2CW0 D;  3MB5 A;  3GTO A;  3FPU A;  2YVL A;  1WC2 A;  1TWA A;  1TWH A;  2BE5 D;  1EU1 A;  2VPZ A;  2PJJ A;  2VPY A;  4KLN A;  1PYQ A;  1R9T A;  2JIQ A;  2XDP A;  5GLX A;  2VUM A;  5CCX A;  4AQ7 A;  1R7R A;  1SIW A;  1CZ4 A;  2EEO B;  2IV2 X;  1PQH A;  3SUJ A;  1N10 A;  2C45 A;  4JS7 A;  4L48 A;  2PWY A;  4JJO A;  3X2J A;  4FIB A;  3ZJT A;  1PYU B;  2VPW A;  3ZGZ A;  1PT1 A;  1Q16 A;  1Y1V A;  5C18 A;  4ARI A;  1UHE A;  3IR6 A;  4ZM7 A;  5D6W A;  1L8F A;  4ENG A;  5H4U A;  3GTQ A;  1O54 A;  2JV2 A;  2Q19 X;  3X2K A;  3X2P A;  5EQJ B;  5D6Y A;  1TWC A;  5GLY A;  3CF2 A;  5DYI A;  1R27 A;  2PJH B;  3IR7 A; 
#chains in the Genus database with same CATH homology
 5DYG A;  3BQB A;  2MM2 A;  2PNW A;  4CS0 A;  1ZC1 A;  2JIR A;  3OUG A;  5D6X A;  1SFO A;  5GLF A;  2A69 D;  4CRZ A;  2R93 A;  4AS1 A;  2WB1 A;  2NVY A;  2JA5 A;  3ML1 A;  4GA6 A;  2JIP A;  1CR5 A;  2NYA A;  2MM0 A;  2A6H D;  3HU3 A;  3LHD A;  2A68 D;  5CD1 A;  1E18 A;  2G5D A;  5EPP A;  2R7Z A;  5CCB A;  2Q1C X;  1OGY A;  3GTK A;  1E32 A;  1H0H A;  5FTK A;  1AA6 A;  3HU2 A;  1TMO A;  4AAY A;  1QDN A;  3H0G A;  2O5J D;  1Y5I A;  2LW6 A;  5FTN A;  3O5A A;  4GA5 A;  4KOD A;  1I50 A;  1G8K A;  4CRY G;  1QCS A;  4AZD A;  1I9G A;  2Q1A X;  2NVX A;  1FDI A;  2YU9 A;  4KDL A;  2WAQ A;  1AW8 B;  2E2H A;  2VPX A;  5ERG B;  1WLF A;  3GTP A;  5FTM A;  1KQG A;  1PQE A;  4KO8 A;  4AOK B;  1CZ5 A;  2V3V A;  3LGA A;  3CQZ A;  1E61 A;  1YNJ D;  4UC4 A;  5C1B A;  3GTJ A;  4AYB A;  2PMZ A;  3TM7 B;  3ZJV A;  1WCM A;  3DMR A;  4DMR A;  4D7Z B;  1YNN D;  3GTL A;  1Y1W A;  1S3S A;  1TWF A;  1FDO A;  3QQ8 A;  3FPT A;  4NOH A;  2NAP A;  2QQR A;  1Y4Z A;  3ZJU A;  3GTM A;  3FPR A;  3GTG A;  3QQ7 A;  2E2I A;  2JA6 A;  1E60 A;  2JIO A;  2G6G A;  4CQN A;  1PT0 A;  2GF7 A;  3IR5 A;  3FKI A;  5T5M D;  3HKZ A;  5B6C A;  2JA7 A;  2YUJ A;  2A6E D;  5T5I D;  1K83 A;  2Y0S A;  1G8J A;  5FTL A;  1TWG A;  1UHD A;  4C2M A;  1IW7 D;  4ARI A;  2PIC A;  3QC8 A;  1H5N A;  1SMY D;  2AE0 X;  4KDI A;  4QIW A;  5FTJ A;  2QQS A;  1E5V A;  1DMR A;  1PPY A;  1I3Q A;  2B63 A;  1PQF A;  1YLE A;  2KY9 A;  2E7Z A;  2KI8 A;  1VC3 B;  3QWZ A;  2GFA A;  1DMS A;  3PLX B;  4AON B;  2Q1D X;  1KQF A;  2R92 A;  2PI8 A;  2GAE A;  2V45 A;  2DMR A;  4RV0 A;  2Q18 X;  2JIM A;  2B25 A;  1ZYR D;  4ARC A;  3TIW A;  3HU1 A;  3CZB A;  2CW0 D;  3MB5 A;  3GTO A;  3FPU A;  2YVL A;  1TWA A;  1TWH A;  2VPZ A;  2BE5 D;  1EU1 A;  4KLN A;  2PJJ A;  2VPY A;  1R9T A;  1PYQ A;  2JIQ A;  2XDP A;  2VUM A;  5CCX A;  4AQ7 A;  1R7R A;  1SIW A;  1CZ4 A;  2EEO B;  2IV2 X;  1PQH A;  2C45 A;  2PWY A;  3ZJT A;  4FIB A;  1PYU B;  2VPW A;  3ZGZ A;  1PT1 A;  1Q16 A;  1Y1V A;  5C18 A;  1UHE A;  3IR6 A;  5D6W A;  3GTQ A;  1O54 A;  2JV2 A;  2Q19 X;  5EQJ B;  5D6Y A;  1TWC A;  3CF2 A;  5DYI A;  1R27 A;  2PJH B;  3IR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...