4KDIA

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
157
Chain Sequence
b'NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 46
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4kdiA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4kdiA02
1WCMA 2NAPA 3GTOA 1CZ5A 5GLFA 1OGYA 5DYGA 4CS0A 2C45A 4AONB 3HU1A 3ML1A 1R27A 4CRZA 1SIWA 3IR6A 2V3VA 1TWAA 1PT0A 4C2MA 4DMRA 2B63A 1UHDA 4GA6A 2R93A 2EEOB 2NVXA 1E60A 5FTNA 2KI8A 2VPYA 5T5ID 1SFOA 1G8KA 3QQ7A 2VUMA 1AW8B 3TM7B 4CRYG 1PT1A 1AA6A 3CF2A 4KDLA 4KLNA 1G8JA 1PQFA 1Y1VA 1TWCA 4GA5A 5C1BA 4AYBA 2VPWA 3QC8A 5FTJA 1TWGA 2Y0SA 2JIPA 1S3SA 1CR5A 3DMRA 2E2HA 1QCSA 3OUGA 4KODA 2IV2X 2JV2A 3CQZA 1I3QA 2VPZA 2WB1A 5FTMA 3TIWA 3GTQA 4RV0A 2YUJA 3HU2A 3HU3A 4KDIA 1KQFA 3O5AA 3H0GA 3GTLA 1E18A 1R9TA 1E5VA 2E7ZA 4AZDA 3GTJA 1EU1A 1UHEA 3FKIA 1PYUB 5T5MD 3IR7A 3IR5A 1DMSA 1TMOA 2JA5A 5DYIA 1ZC1A 2JIMA 4AOKB 1E61A 1I50A 2R92A 1E32A 1Q16A 3GTGA 1DMRA 2JIOA 1PYQA 1TWHA 4AAYA 3GTKA 4QIWA 5FTLA 2E2IA 1H0HA 3GTPA 2PMZA 3HKZA 5C18A 1Y5IA 2PJHB 5EPPA 2R7ZA 2JIRA 1WLFA 1VC3B 3QWZA 3QQ8A 5B6CA 2NYAA 1TWFA 2V45A 2JA7A 3GTMA 1CZ4A 2WAQA 2JIQA 2JA6A 1PQHA 1FDOA 1IW7D 1QDNA 1Y1WA 2YU9A 2DMRA 1K83A 1FDIA 1PQEA 1Y4ZA 4KO8A 3PLXB 5FTKA 2VPXA 4D7ZB 1YLEA 1H5NA 2NVYA 1PPYA 1KQGA 1R7RA
chains in the Genus database with same CATH superfamily
1WCMA 2Q1AX 2NAPA 3GTOA 1CZ5A 1OA9A 1OGYA 5GLFA 3LGAA 5DYGA 4CS0A 2BE5D 4ARCA 2C45A 3FPTA 4FFTA 4AONB 4ZM7A 3HU1A 2O5JD 2HCZX 2Q18X 3ZJUA 3ML1A 1R27A 3SULA 4CRZA 2A6ED 2B25A 1SIWA 5D6YA 3IR6A 2V3VA 1TWAA 1PT0A 2GAEA 4C2MA 4FG2A 4DMRA 2BH0A 2PI8A 2KY9A 2B63A 5D6XA 1UHDA 4GA6A 3SUJA 2EEOB 3X2PA 2R93A 2NVXA 1E60A 2GFAA 4FIBA 2Q1DX 2A6HD 1O54A 5FTNA 2KI8A 2LW6A 2VPYA 4JP6A 5T5ID 1SFOA 3SUKA 1G8KA 3QQ7A 2VUMA 3BQBA 1AW8B 3TM7B 4CRYG 1PT1A 1AA6A 3CF2A 4KDLA 4KLNA 1G8JA 1PQFA 1Y1VA 4NOHA 1TWCA 4GA5A 5GLYA 5C1BA 5ERGB 4AYBA 2VPWA 1ZYRD 5H4UA 2GF7A 4FG4A 1HD5A 4JS7A 3CZBA 3QC8A 3X2GA 2Q1CX 2PICA 1SMYD 5FTJA 1TWGA 2Y0SA 2JIPA 1BW4A 3FPRA 4AQ7A 1S3SA 1CR5A 3X2LA 1YNJD 1WC2A 3DMRA 2E2HA 5D6WA 1QCSA 2ENGA 3OUGA 2PJJA 4KODA 2IV2X 2Q19X 3X2JA 2JV2A 3CQZA 1I3QA 2VPZA 2WB1A 5FTMA 3TIWA 3GTQA 1L8FA 4RV0A 2AE0X 2CW0D 2YUJA 3HU2A 3HU3A 4UC4A 3X2KA 4ARIA 1I9GA 4KDIA 4AVRA 1KQFA 3O5AA 3H0GA 3GTLA 1E18A 1R9TA 5EQJB 1E5VA 2E7ZA 5CCXA 1N10A 2KQAA 2MM2A 4AZDA 3GTJA 3MB5A 1EU1A 1UHEA 3FKIA 1PYUB 4JCWA 5T5MD 4AS1A 3IR7A 3IR5A 1DMSA 1TMOA 2JA5A 5DYIA 1ZC1A 2JIMA 4AOKB 1E61A 1I50A 2R92A 1E32A 1Q16A 3GTGA 3D30A 1DMRA 2JIOA 1PYQA 1TWHA 4JJOA 4L48A 4AAYA 3GTKA 3FPUA 4JP7A 4QIWA 3ZJTA 2PNWA 5FTLA 2G5DA 2E2IA 1H0HA 3GTPA 2PMZA 3HKZA 5C18A 1OA7A 3X2MA 3ZJVA 1Y5IA 3ZGZA 2PJHB 5EPPA 2R7ZA 2JIRA 1WLFA 1VC3B 4FERA 3QWZA 3QQ8A 5GM9A 5GLXA 5B6CA 2NYAA 2QQSA 1TWFA 2A68D 2V45A 2JA7A 1YNND 3GTMA 1CZ4A 2WAQA 2JIQA 2JA6A 1BW3A 4CQNA 2G6GA 3X2IA 4ENGA 2A69D 1PQHA 1FDOA 1IW7D 1QDNA 3X2OA 1Y1WA 3LHDA 2YU9A 2DMRA 2MM0A 3ENGA 3SUMA 1K83A 1FDIA 1PQEA 1Y4ZA 4KO8A 3M3GA 3PLXB 5FTKA 5CCBA 2VPXA 4D7ZB 2XDPA 2QQRA 1YLEA 2YVLA 5CD1A 1H5NA 2NVYA 3X2NA 1PPYA 1KQGA 2PWYA 3X2HA 1R7RA
chains in the Genus database with same CATH topology
1WCMA 2Q1AX 2NAPA 3GTOA 1CZ5A 5GLFA 1OGYA 3LGAA 5DYGA 4CS0A 2BE5D 4ARCA 2C45A 3FPTA 4AONB 2Q18X 2O5JD 3HU1A 3ZJUA 3ML1A 1R27A 4CRZA 2A6ED 2B25A 1SIWA 5D6YA 3IR6A 2V3VA 1TWAA 1PT0A 2GAEA 4C2MA 4DMRA 2PI8A 2KY9A 2B63A 5D6XA 1UHDA 4GA6A 2R93A 2EEOB 2NVXA 1E60A 2GFAA 4FIBA 2Q1DX 2A6HD 1O54A 5FTNA 2KI8A 2LW6A 2VPYA 5T5ID 1SFOA 1G8KA 3QQ7A 2VUMA 3BQBA 1AW8B 3TM7B 4CRYG 1PT1A 1AA6A 3CF2A 4KDLA 4KLNA 1G8JA 1PQFA 1Y1VA 4NOHA 1TWCA 4GA5A 5C1BA 5ERGB 4AYBA 2VPWA 1ZYRD 2GF7A 3CZBA 3QC8A 2Q1CX 2PICA 1SMYD 5FTJA 1TWGA 2Y0SA 2JIPA 4AQ7A 3FPRA 1S3SA 1CR5A 1YNJD 3DMRA 2E2HA 5D6WA 1QCSA 3OUGA 2PJJA 4KODA 2IV2X 2Q19X 2JV2A 3CQZA 1I3QA 2VPZA 2WB1A 5FTMA 3TIWA 3GTQA 4RV0A 2AE0X 2CW0D 2YUJA 3HU2A 3HU3A 4UC4A 4ARIA 1I9GA 4KDIA 1KQFA 3O5AA 3H0GA 3GTLA 1E18A 1R9TA 5EQJB 1E5VA 2E7ZA 5CCXA 2MM2A 4AZDA 3GTJA 3MB5A 1EU1A 1UHEA 3FKIA 1PYUB 5T5MD 4AS1A 3IR7A 3IR5A 1DMSA 1TMOA 2JA5A 5DYIA 1ZC1A 2JIMA 4AOKB 1E61A 1I50A 2R92A 1E32A 1Q16A 3GTGA 1DMRA 2JIOA 1PYQA 1TWHA 4AAYA 3FPUA 3GTKA 3ZJTA 4QIWA 2PNWA 5FTLA 2G5DA 2E2IA 1H0HA 3GTPA 2PMZA 3HKZA 5C18A 3ZJVA 1Y5IA 3ZGZA 2PJHB 5EPPA 2R7ZA 2JIRA 1WLFA 1VC3B 3QWZA 3QQ8A 5B6CA 2QQSA 2NYAA 1TWFA 2A68D 2V45A 2JA7A 1YNND 3GTMA 1CZ4A 2WAQA 2JIQA 2JA6A 4CQNA 2G6GA 2A69D 1PQHA 1FDOA 1IW7D 1QDNA 1Y1WA 3LHDA 2YU9A 2DMRA 2MM0A 1K83A 1FDIA 1PQEA 1Y4ZA 4KO8A 3PLXB 5FTKA 5CCBA 2VPXA 4D7ZB 2XDPA 2QQRA 1YLEA 2YVLA 5CD1A 1H5NA 2NVYA 1PPYA 1KQGA 2PWYA 1R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM A;  2NAP A;  3GTO A;  1CZ5 A;  5GLF A;  1OGY A;  5DYG A;  4CS0 A;  2C45 A;  4AON B;  3HU1 A;  3ML1 A;  1R27 A;  4CRZ A;  1SIW A;  3IR6 A;  2V3V A;  1TWA A;  1PT0 A;  4C2M A;  4DMR A;  2B63 A;  1UHD A;  4GA6 A;  2R93 A;  2EEO B;  2NVX A;  1E60 A;  5FTN A;  2KI8 A;  2VPY A;  5T5I D;  1SFO A;  1G8K A;  3QQ7 A;  2VUM A;  1AW8 B;  3TM7 B;  4CRY G;  1PT1 A;  1AA6 A;  3CF2 A;  4KDL A;  4KLN A;  1G8J A;  1PQF A;  1Y1V A;  1TWC A;  4GA5 A;  5C1B A;  4AYB A;  2VPW A;  3QC8 A;  5FTJ A;  1TWG A;  2Y0S A;  2JIP A;  1S3S A;  1CR5 A;  3DMR A;  2E2H A;  1QCS A;  3OUG A;  4KOD A;  2IV2 X;  2JV2 A;  3CQZ A;  1I3Q A;  2VPZ A;  2WB1 A;  5FTM A;  3TIW A;  3GTQ A;  4RV0 A;  2YUJ A;  3HU2 A;  3HU3 A;  4KDI A;  1KQF A;  3O5A A;  3H0G A;  3GTL A;  1E18 A;  1R9T A;  1E5V A;  2E7Z A;  4AZD A;  3GTJ A;  1EU1 A;  1UHE A;  3FKI A;  1PYU B;  5T5M D;  3IR7 A;  3IR5 A;  1DMS A;  1TMO A;  2JA5 A;  5DYI A;  1ZC1 A;  2JIM A;  4AOK B;  1E61 A;  1I50 A;  2R92 A;  1E32 A;  1Q16 A;  3GTG A;  1DMR A;  2JIO A;  1PYQ A;  1TWH A;  4AAY A;  3GTK A;  4QIW A;  5FTL A;  2E2I A;  1H0H A;  3GTP A;  2PMZ A;  3HKZ A;  5C18 A;  1Y5I A;  2PJH B;  5EPP A;  2R7Z A;  2JIR A;  1WLF A;  1VC3 B;  3QWZ A;  3QQ8 A;  5B6C A;  2NYA A;  1TWF A;  2V45 A;  2JA7 A;  3GTM A;  1CZ4 A;  2WAQ A;  2JIQ A;  2JA6 A;  1PQH A;  1FDO A;  1IW7 D;  1QDN A;  1Y1W A;  2YU9 A;  2DMR A;  1K83 A;  1FDI A;  1PQE A;  1Y4Z A;  4KO8 A;  3PLX B;  5FTK A;  2VPX A;  4D7Z B;  1YLE A;  1H5N A;  2NVY A;  1PPY A;  1KQG A;  1R7R A; 
#chains in the Genus database with same CATH topology
 1WCM A;  2Q1A X;  2NAP A;  3GTO A;  1CZ5 A;  1OA9 A;  1OGY A;  5GLF A;  3LGA A;  5DYG A;  4CS0 A;  2BE5 D;  4ARC A;  2C45 A;  3FPT A;  4FFT A;  4AON B;  4ZM7 A;  3HU1 A;  2O5J D;  2HCZ X;  2Q18 X;  3ZJU A;  3ML1 A;  1R27 A;  3SUL A;  4CRZ A;  2A6E D;  2B25 A;  1SIW A;  5D6Y A;  3IR6 A;  2V3V A;  1TWA A;  1PT0 A;  2GAE A;  4C2M A;  4FG2 A;  4DMR A;  2BH0 A;  2PI8 A;  2KY9 A;  2B63 A;  5D6X A;  1UHD A;  4GA6 A;  3SUJ A;  2EEO B;  3X2P A;  2R93 A;  2NVX A;  1E60 A;  2GFA A;  4FIB A;  2Q1D X;  2A6H D;  1O54 A;  5FTN A;  2KI8 A;  2LW6 A;  2VPY A;  4JP6 A;  5T5I D;  1SFO A;  3SUK A;  1G8K A;  3QQ7 A;  2VUM A;  3BQB A;  1AW8 B;  3TM7 B;  4CRY G;  1PT1 A;  1AA6 A;  3CF2 A;  4KDL A;  4KLN A;  1G8J A;  1PQF A;  1Y1V A;  4NOH A;  1TWC A;  4GA5 A;  5GLY A;  5C1B A;  5ERG B;  4AYB A;  2VPW A;  1ZYR D;  5H4U A;  2GF7 A;  4FG4 A;  1HD5 A;  4JS7 A;  3CZB A;  3QC8 A;  3X2G A;  2Q1C X;  2PIC A;  1SMY D;  5FTJ A;  1TWG A;  2Y0S A;  2JIP A;  1BW4 A;  3FPR A;  4AQ7 A;  1S3S A;  1CR5 A;  3X2L A;  1YNJ D;  1WC2 A;  3DMR A;  2E2H A;  5D6W A;  1QCS A;  2ENG A;  3OUG A;  2PJJ A;  4KOD A;  2IV2 X;  2Q19 X;  3X2J A;  2JV2 A;  3CQZ A;  1I3Q A;  2VPZ A;  2WB1 A;  5FTM A;  3TIW A;  3GTQ A;  1L8F A;  4RV0 A;  2AE0 X;  2CW0 D;  2YUJ A;  3HU2 A;  3HU3 A;  4UC4 A;  3X2K A;  4ARI A;  1I9G A;  4KDI A;  4AVR A;  1KQF A;  3O5A A;  3H0G A;  3GTL A;  1E18 A;  1R9T A;  5EQJ B;  1E5V A;  2E7Z A;  5CCX A;  1N10 A;  2KQA A;  2MM2 A;  4AZD A;  3GTJ A;  3MB5 A;  1EU1 A;  1UHE A;  3FKI A;  1PYU B;  4JCW A;  5T5M D;  4AS1 A;  3IR7 A;  3IR5 A;  1DMS A;  1TMO A;  2JA5 A;  5DYI A;  1ZC1 A;  2JIM A;  4AOK B;  1E61 A;  1I50 A;  2R92 A;  1E32 A;  1Q16 A;  3GTG A;  3D30 A;  1DMR A;  2JIO A;  1PYQ A;  1TWH A;  4JJO A;  4L48 A;  4AAY A;  3GTK A;  3FPU A;  4JP7 A;  4QIW A;  3ZJT A;  2PNW A;  5FTL A;  2G5D A;  2E2I A;  1H0H A;  3GTP A;  2PMZ A;  3HKZ A;  5C18 A;  1OA7 A;  3X2M A;  3ZJV A;  1Y5I A;  3ZGZ A;  2PJH B;  5EPP A;  2R7Z A;  2JIR A;  1WLF A;  1VC3 B;  4FER A;  3QWZ A;  3QQ8 A;  5GM9 A;  5GLX A;  5B6C A;  2NYA A;  2QQS A;  1TWF A;  2A68 D;  2V45 A;  2JA7 A;  1YNN D;  3GTM A;  1CZ4 A;  2WAQ A;  2JIQ A;  2JA6 A;  1BW3 A;  4CQN A;  2G6G A;  3X2I A;  4ENG A;  2A69 D;  1PQH A;  1FDO A;  1IW7 D;  1QDN A;  3X2O A;  1Y1W A;  3LHD A;  2YU9 A;  2DMR A;  2MM0 A;  3ENG A;  3SUM A;  1K83 A;  1FDI A;  1PQE A;  1Y4Z A;  4KO8 A;  3M3G A;  3PLX B;  5FTK A;  5CCB A;  2VPX A;  4D7Z B;  2XDP A;  2QQR A;  1YLE A;  2YVL A;  5CD1 A;  1H5N A;  2NVY A;  3X2N A;  1PPY A;  1KQG A;  2PWY A;  3X2H A;  1R7R A; 
#chains in the Genus database with same CATH homology
 1WCM A;  2Q1A X;  2NAP A;  3GTO A;  1CZ5 A;  5GLF A;  1OGY A;  3LGA A;  5DYG A;  4CS0 A;  2BE5 D;  4ARC A;  2C45 A;  3FPT A;  4AON B;  2Q18 X;  2O5J D;  3HU1 A;  3ZJU A;  3ML1 A;  1R27 A;  4CRZ A;  2A6E D;  2B25 A;  1SIW A;  5D6Y A;  3IR6 A;  2V3V A;  1TWA A;  1PT0 A;  2GAE A;  4C2M A;  4DMR A;  2PI8 A;  2KY9 A;  2B63 A;  5D6X A;  1UHD A;  4GA6 A;  2R93 A;  2EEO B;  2NVX A;  1E60 A;  2GFA A;  4FIB A;  2Q1D X;  2A6H D;  1O54 A;  5FTN A;  2KI8 A;  2LW6 A;  2VPY A;  5T5I D;  1SFO A;  1G8K A;  3QQ7 A;  2VUM A;  3BQB A;  1AW8 B;  3TM7 B;  4CRY G;  1PT1 A;  1AA6 A;  3CF2 A;  4KDL A;  4KLN A;  1G8J A;  1PQF A;  1Y1V A;  4NOH A;  1TWC A;  4GA5 A;  5C1B A;  5ERG B;  4AYB A;  2VPW A;  1ZYR D;  2GF7 A;  3CZB A;  3QC8 A;  2Q1C X;  2PIC A;  1SMY D;  5FTJ A;  1TWG A;  2Y0S A;  2JIP A;  4AQ7 A;  3FPR A;  1S3S A;  1CR5 A;  1YNJ D;  3DMR A;  2E2H A;  5D6W A;  1QCS A;  3OUG A;  2PJJ A;  4KOD A;  2IV2 X;  2Q19 X;  2JV2 A;  3CQZ A;  1I3Q A;  2VPZ A;  2WB1 A;  5FTM A;  3TIW A;  3GTQ A;  4RV0 A;  2AE0 X;  2CW0 D;  2YUJ A;  3HU2 A;  3HU3 A;  4UC4 A;  4ARI A;  1I9G A;  4KDI A;  1KQF A;  3O5A A;  3H0G A;  3GTL A;  1E18 A;  1R9T A;  5EQJ B;  1E5V A;  2E7Z A;  5CCX A;  2MM2 A;  4AZD A;  3GTJ A;  3MB5 A;  1EU1 A;  1UHE A;  3FKI A;  1PYU B;  5T5M D;  4AS1 A;  3IR7 A;  3IR5 A;  1DMS A;  1TMO A;  2JA5 A;  5DYI A;  1ZC1 A;  2JIM A;  4AOK B;  1E61 A;  1I50 A;  2R92 A;  1E32 A;  1Q16 A;  3GTG A;  1DMR A;  2JIO A;  1PYQ A;  1TWH A;  4AAY A;  3FPU A;  3GTK A;  3ZJT A;  4QIW A;  2PNW A;  5FTL A;  2G5D A;  2E2I A;  1H0H A;  3GTP A;  2PMZ A;  3HKZ A;  5C18 A;  3ZJV A;  1Y5I A;  3ZGZ A;  2PJH B;  5EPP A;  2R7Z A;  2JIR A;  1WLF A;  1VC3 B;  3QWZ A;  3QQ8 A;  5B6C A;  2QQS A;  2NYA A;  1TWF A;  2A68 D;  2V45 A;  2JA7 A;  1YNN D;  3GTM A;  1CZ4 A;  2WAQ A;  2JIQ A;  2JA6 A;  4CQN A;  2G6G A;  2A69 D;  1PQH A;  1FDO A;  1IW7 D;  1QDN A;  1Y1W A;  3LHD A;  2YU9 A;  2DMR A;  2MM0 A;  1K83 A;  1FDI A;  1PQE A;  1Y4Z A;  4KO8 A;  3PLX B;  5FTK A;  5CCB A;  2VPX A;  4D7Z B;  2XDP A;  2QQR A;  1YLE A;  2YVL A;  5CD1 A;  1H5N A;  2NVY A;  1PPY A;  1KQG A;  2PWY A;  1R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...