4KDIA

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
157
Chain Sequence
NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 46
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4kdiA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4kdiA02
3HU3A 3CF2A 1KQFA 4GA6A 5C18A 1UHDA 2JA6A 4KODA 1Y5IA 2VPXA 2V3VA 2YU9A 1WCMA 3HU1A 1FDIA 1CR5A 4AONB 2JIPA 5FTKA 3OUGA 5FTNA 3GTPA 1EU1A 3GTJA 2VPWA 3QWZA 1E61A 1Y4ZA 2VUMA 5T5MD 1SFOA 3CQZA 2KI8A 5DYIA 2NVXA 4KLNA 2PMZA 4KDLA 2EEOB 4DMRA 1CZ5A 1G8KA 5EPPA 3GTQA 2NAPA 2C45A 1E60A 4QIWA 1OGYA 2JIOA 4CRZA 2R93A 5FTJA 1CZ4A 2B63A 5FTLA 1TWHA 1R27A 3HU2A 2NYAA 4C2MA 4GA5A 4CS0A 2WAQA 2V45A 1E18A 1QCSA 5T5ID 1DMSA 3QQ7A 2E2IA 1H5NA 3TM7B 1IW7D 1TMOA 3IR6A 5FTMA 1PQFA 1TWGA 1AW8B 2JIQA 1Y1WA 1ZC1A 1PT0A 1DMRA 1QDNA 1Q16A 5GLFA 2JV2A 2VPYA 1I50A 2WB1A 4AZDA 1UHEA 1PQEA 3QQ8A 4CRYG 2YUJA 2Y0SA 5B6CA 3H0GA 1PPYA 3HKZA 2IV2X 5C1BA 1WLFA 1K83A 1E5VA 4AOKB 2PJHB 3IR5A 1AA6A 4AAYA 3FKIA 3QC8A 1E32A 3GTKA 3ML1A 3GTLA 3TIWA 2JA7A 1H0HA 5DYGA 3GTOA 3GTMA 1KQGA 1Y1VA 4AYBA 1SIWA 4D7ZB 4RV0A 1R7RA 3DMRA 1PYUB 3GTGA 1YLEA 1FDOA 2E7ZA 1R9TA 1S3SA 4KO8A 4KDIA 1VC3B 2VPZA 1TWCA 1G8JA 1PYQA 1PT1A 2JA5A 1TWAA 3O5AA 2R7ZA 2DMRA 1I3QA 1PQHA 2JIRA 3IR7A 2R92A 2JIMA 3PLXB 2NVYA 1TWFA 2E2HA
chains in the Genus database with same CATH superfamily
3HU3A 3CF2A 1KQFA 4GA6A 2AE0X 2HCZX 5C18A 1UHDA 3X2KA 3X2JA 2PJJA 2LW6A 2JA6A 2KQAA 3ZJUA 4KODA 1Y5IA 1YNND 4FERA 2VPXA 2V3VA 2PICA 4JP6A 1WCMA 3HU1A 2YU9A 1BW3A 5GLYA 2Q19X 1FDIA 1HD5A 1CR5A 4AONB 2JIPA 5FTKA 3OUGA 5FTNA 3GTPA 5D6YA 1EU1A 1L8FA 4JP7A 3ENGA 3GTJA 1YNJD 2VPWA 2KY9A 3QWZA 1E61A 1Y4ZA 4ARCA 2VUMA 5T5MD 1SFOA 3CQZA 2KI8A 5DYIA 2NVXA 4KLNA 2PMZA 4KDLA 2EEOB 3LHDA 2BE5D 4DMRA 2YVLA 1CZ5A 1G8KA 5EPPA 3GTQA 2ENGA 2NAPA 2C45A 3SULA 1E60A 4QIWA 3X2GA 1OGYA 2A68D 2JIOA 4CRZA 2R93A 3LGAA 2MM0A 4ZM7A 2G6GA 5FTJA 1CZ4A 2B63A 5FTLA 1TWHA 1R27A 3HU2A 2NYAA 3X2OA 4C2MA 1BW4A 2CW0D 5H4UA 4GA5A 3X2PA 4CS0A 1OA7A 2V45A 1E18A 2WAQA 1QCSA 4CQNA 4ENGA 3M3GA 5T5ID 5CCBA 1DMSA 3QQ7A 2E2IA 1H5NA 3TM7B 1IW7D 1TMOA 5CCXA 3IR6A 5FTMA 5D6XA 1PQFA 1TWGA 1AW8B 1ZC1A 2JIQA 1Y1WA 3BQBA 5CD1A 1PT0A 1I9GA 1DMRA 1QDNA 1Q16A 5GLFA 2JV2A 2A6HD 2VPYA 2WB1A 4L48A 4AZDA 1I50A 1UHEA 3X2NA 4AQ7A 1PQEA 2YUJA 3QQ8A 4CRYG 4NOHA 3ZJTA 5ERGB 3X2IA 2O5JD 2Y0SA 1OA9A 1N10A 5B6CA 4UC4A 2A6ED 3H0GA 1PPYA 2A69D 3HKZA 2MM2A 2IV2X 5C1BA 1WLFA 4JS7A 1K83A 1E5VA 3SUKA 4AOKB 1O54A 2PJHB 4FIBA 3IR5A 1AA6A 4JJOA 3FPUA 4AAYA 2Q18X 3MB5A 3FKIA 3FPRA 3QC8A 1E32A 3GTKA 2GFAA 3ML1A 3GTLA 3TIWA 2JA7A 2QQSA 1H0HA 5DYGA 3GTOA 3GTMA 1KQGA 2PNWA 1Y1VA 4AYBA 1SIWA 4D7ZB 1SMYD 2XDPA 4RV0A 4FG2A 1R7RA 5GM9A 5GLXA 3CZBA 3ZGZA 3DMRA 3FPTA 2QQRA 2GF7A 1ZYRD 2G5DA 2Q1DX 1PYUB 3GTGA 2BH0A 1YLEA 1FDOA 3X2HA 2E7ZA 1WC2A 2PI8A 3SUJA 1R9TA 3ZJVA 1S3SA 4KO8A 3SUMA 2GAEA 4KDIA 3X2LA 1VC3B 2Q1AX 2VPZA 1TWCA 2B25A 2Q1CX 1G8JA 1PYQA 4FG4A 4AS1A 1PT1A 2JA5A 1TWAA 3O5AA 4AVRA 2R7ZA 2DMRA 1I3QA 4JCWA 1PQHA 2JIRA 3IR7A 2R92A 3X2MA 4ARIA 3D30A 5D6WA 2JIMA 3PLXB 2NVYA 1TWFA 4FFTA 5EQJB 2PWYA 2E2HA
chains in the Genus database with same CATH topology
3HU3A 3CF2A 1KQFA 4GA6A 2AE0X 5C18A 1UHDA 2LW6A 2PJJA 2JA6A 3ZJUA 4KODA 1Y5IA 1YNND 2B25A 2VPXA 2V3VA 2PICA 2YU9A 1WCMA 3HU1A 2Q19X 1FDIA 1CR5A 4AONB 2JIPA 5FTKA 3OUGA 5FTNA 3GTPA 5D6YA 1EU1A 3GTJA 1YNJD 2VPWA 2KY9A 3QWZA 1E61A 1Y4ZA 4ARCA 2VUMA 5T5MD 1SFOA 3CQZA 2KI8A 5DYIA 2NVXA 4KLNA 2PMZA 4KDLA 2EEOB 3LHDA 2BE5D 4DMRA 2YVLA 1CZ5A 1G8KA 5EPPA 3GTQA 2NAPA 2C45A 1E60A 4QIWA 1OGYA 2A68D 2JIOA 4CRZA 2R93A 3LGAA 2MM0A 2G6GA 5FTJA 1CZ4A 2B63A 5FTLA 1TWHA 1R27A 3HU2A 2NYAA 4C2MA 2CW0D 4GA5A 4CS0A 2WAQA 2V45A 1E18A 1QCSA 4CQNA 5T5ID 5CCBA 1DMSA 3QQ7A 2E2IA 1H5NA 3TM7B 1IW7D 1TMOA 5CCXA 3IR6A 5FTMA 5D6XA 1PQFA 1TWGA 1AW8B 1ZC1A 2JIQA 1Y1WA 3BQBA 5CD1A 1PT0A 1I9GA 1DMRA 1QDNA 1Q16A 5GLFA 2JV2A 2A6HD 2VPYA 2WB1A 4AZDA 1I50A 1UHEA 4AQ7A 1PQEA 2YUJA 3QQ8A 4CRYG 4NOHA 3ZJTA 5ERGB 2O5JD 2Y0SA 5B6CA 4UC4A 2A6ED 3H0GA 1PPYA 2A69D 3HKZA 2MM2A 2IV2X 5C1BA 1WLFA 1K83A 1E5VA 4AOKB 1O54A 2PJHB 4FIBA 3IR5A 1AA6A 3FPUA 4AAYA 2Q18X 3MB5A 3FKIA 3FPRA 3QC8A 1E32A 3GTKA 2GFAA 3ML1A 3GTLA 3TIWA 2JA7A 2QQSA 1H0HA 5DYGA 3GTOA 3GTMA 1KQGA 2PNWA 1Y1VA 4AYBA 1SIWA 4D7ZB 1SMYD 2XDPA 4RV0A 3ZGZA 1R7RA 3CZBA 3DMRA 3FPTA 2QQRA 2GF7A 1ZYRD 2G5DA 2Q1DX 1PYUB 3GTGA 1YLEA 1FDOA 2E7ZA 1R9TA 2PI8A 3ZJVA 1S3SA 4KO8A 2GAEA 4KDIA 1VC3B 2Q1AX 2VPZA 1TWCA 2Q1CX 1G8JA 1PYQA 4AS1A 1PT1A 2JA5A 1TWAA 3O5AA 2R7ZA 2DMRA 1I3QA 1PQHA 2JIRA 3IR7A 2R92A 4ARIA 5D6WA 2JIMA 3PLXB 2NVYA 1TWFA 5EQJB 2PWYA 2E2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HU3 A;  3CF2 A;  1KQF A;  4GA6 A;  5C18 A;  1UHD A;  2JA6 A;  4KOD A;  1Y5I A;  2VPX A;  2V3V A;  2YU9 A;  1WCM A;  3HU1 A;  1FDI A;  1CR5 A;  4AON B;  2JIP A;  5FTK A;  3OUG A;  5FTN A;  3GTP A;  1EU1 A;  3GTJ A;  2VPW A;  3QWZ A;  1E61 A;  1Y4Z A;  2VUM A;  5T5M D;  1SFO A;  3CQZ A;  2KI8 A;  5DYI A;  2NVX A;  4KLN A;  2PMZ A;  4KDL A;  2EEO B;  4DMR A;  1CZ5 A;  1G8K A;  5EPP A;  3GTQ A;  2NAP A;  2C45 A;  1E60 A;  4QIW A;  1OGY A;  2JIO A;  4CRZ A;  2R93 A;  5FTJ A;  1CZ4 A;  2B63 A;  5FTL A;  1TWH A;  1R27 A;  3HU2 A;  2NYA A;  4C2M A;  4GA5 A;  4CS0 A;  2WAQ A;  2V45 A;  1E18 A;  1QCS A;  5T5I D;  1DMS A;  3QQ7 A;  2E2I A;  1H5N A;  3TM7 B;  1IW7 D;  1TMO A;  3IR6 A;  5FTM A;  1PQF A;  1TWG A;  1AW8 B;  2JIQ A;  1Y1W A;  1ZC1 A;  1PT0 A;  1DMR A;  1QDN A;  1Q16 A;  5GLF A;  2JV2 A;  2VPY A;  1I50 A;  2WB1 A;  4AZD A;  1UHE A;  1PQE A;  3QQ8 A;  4CRY G;  2YUJ A;  2Y0S A;  5B6C A;  3H0G A;  1PPY A;  3HKZ A;  2IV2 X;  5C1B A;  1WLF A;  1K83 A;  1E5V A;  4AOK B;  2PJH B;  3IR5 A;  1AA6 A;  4AAY A;  3FKI A;  3QC8 A;  1E32 A;  3GTK A;  3ML1 A;  3GTL A;  3TIW A;  2JA7 A;  1H0H A;  5DYG A;  3GTO A;  3GTM A;  1KQG A;  1Y1V A;  4AYB A;  1SIW A;  4D7Z B;  4RV0 A;  1R7R A;  3DMR A;  1PYU B;  3GTG A;  1YLE A;  1FDO A;  2E7Z A;  1R9T A;  1S3S A;  4KO8 A;  4KDI A;  1VC3 B;  2VPZ A;  1TWC A;  1G8J A;  1PYQ A;  1PT1 A;  2JA5 A;  1TWA A;  3O5A A;  2R7Z A;  2DMR A;  1I3Q A;  1PQH A;  2JIR A;  3IR7 A;  2R92 A;  2JIM A;  3PLX B;  2NVY A;  1TWF A;  2E2H A; 
#chains in the Genus database with same CATH topology
 3HU3 A;  3CF2 A;  1KQF A;  4GA6 A;  2AE0 X;  2HCZ X;  5C18 A;  1UHD A;  3X2K A;  3X2J A;  2PJJ A;  2LW6 A;  2JA6 A;  2KQA A;  3ZJU A;  4KOD A;  1Y5I A;  1YNN D;  4FER A;  2VPX A;  2V3V A;  2PIC A;  4JP6 A;  1WCM A;  3HU1 A;  2YU9 A;  1BW3 A;  5GLY A;  2Q19 X;  1FDI A;  1HD5 A;  1CR5 A;  4AON B;  2JIP A;  5FTK A;  3OUG A;  5FTN A;  3GTP A;  5D6Y A;  1EU1 A;  1L8F A;  4JP7 A;  3ENG A;  3GTJ A;  1YNJ D;  2VPW A;  2KY9 A;  3QWZ A;  1E61 A;  1Y4Z A;  4ARC A;  2VUM A;  5T5M D;  1SFO A;  3CQZ A;  2KI8 A;  5DYI A;  2NVX A;  4KLN A;  2PMZ A;  4KDL A;  2EEO B;  3LHD A;  2BE5 D;  4DMR A;  2YVL A;  1CZ5 A;  1G8K A;  5EPP A;  3GTQ A;  2ENG A;  2NAP A;  2C45 A;  3SUL A;  1E60 A;  4QIW A;  3X2G A;  1OGY A;  2A68 D;  2JIO A;  4CRZ A;  2R93 A;  3LGA A;  2MM0 A;  4ZM7 A;  2G6G A;  5FTJ A;  1CZ4 A;  2B63 A;  5FTL A;  1TWH A;  1R27 A;  3HU2 A;  2NYA A;  3X2O A;  4C2M A;  1BW4 A;  2CW0 D;  5H4U A;  4GA5 A;  3X2P A;  4CS0 A;  1OA7 A;  2V45 A;  1E18 A;  2WAQ A;  1QCS A;  4CQN A;  4ENG A;  3M3G A;  5T5I D;  5CCB A;  1DMS A;  3QQ7 A;  2E2I A;  1H5N A;  3TM7 B;  1IW7 D;  1TMO A;  5CCX A;  3IR6 A;  5FTM A;  5D6X A;  1PQF A;  1TWG A;  1AW8 B;  1ZC1 A;  2JIQ A;  1Y1W A;  3BQB A;  5CD1 A;  1PT0 A;  1I9G A;  1DMR A;  1QDN A;  1Q16 A;  5GLF A;  2JV2 A;  2A6H D;  2VPY A;  2WB1 A;  4L48 A;  4AZD A;  1I50 A;  1UHE A;  3X2N A;  4AQ7 A;  1PQE A;  2YUJ A;  3QQ8 A;  4CRY G;  4NOH A;  3ZJT A;  5ERG B;  3X2I A;  2O5J D;  2Y0S A;  1OA9 A;  1N10 A;  5B6C A;  4UC4 A;  2A6E D;  3H0G A;  1PPY A;  2A69 D;  3HKZ A;  2MM2 A;  2IV2 X;  5C1B A;  1WLF A;  4JS7 A;  1K83 A;  1E5V A;  3SUK A;  4AOK B;  1O54 A;  2PJH B;  4FIB A;  3IR5 A;  1AA6 A;  4JJO A;  3FPU A;  4AAY A;  2Q18 X;  3MB5 A;  3FKI A;  3FPR A;  3QC8 A;  1E32 A;  3GTK A;  2GFA A;  3ML1 A;  3GTL A;  3TIW A;  2JA7 A;  2QQS A;  1H0H A;  5DYG A;  3GTO A;  3GTM A;  1KQG A;  2PNW A;  1Y1V A;  4AYB A;  1SIW A;  4D7Z B;  1SMY D;  2XDP A;  4RV0 A;  4FG2 A;  1R7R A;  5GM9 A;  5GLX A;  3CZB A;  3ZGZ A;  3DMR A;  3FPT A;  2QQR A;  2GF7 A;  1ZYR D;  2G5D A;  2Q1D X;  1PYU B;  3GTG A;  2BH0 A;  1YLE A;  1FDO A;  3X2H A;  2E7Z A;  1WC2 A;  2PI8 A;  3SUJ A;  1R9T A;  3ZJV A;  1S3S A;  4KO8 A;  3SUM A;  2GAE A;  4KDI A;  3X2L A;  1VC3 B;  2Q1A X;  2VPZ A;  1TWC A;  2B25 A;  2Q1C X;  1G8J A;  1PYQ A;  4FG4 A;  4AS1 A;  1PT1 A;  2JA5 A;  1TWA A;  3O5A A;  4AVR A;  2R7Z A;  2DMR A;  1I3Q A;  4JCW A;  1PQH A;  2JIR A;  3IR7 A;  2R92 A;  3X2M A;  4ARI A;  3D30 A;  5D6W A;  2JIM A;  3PLX B;  2NVY A;  1TWF A;  4FFT A;  5EQJ B;  2PWY A;  2E2H A; 
#chains in the Genus database with same CATH homology
 3HU3 A;  3CF2 A;  1KQF A;  4GA6 A;  2AE0 X;  5C18 A;  1UHD A;  2LW6 A;  2PJJ A;  2JA6 A;  3ZJU A;  4KOD A;  1Y5I A;  1YNN D;  2B25 A;  2VPX A;  2V3V A;  2PIC A;  2YU9 A;  1WCM A;  3HU1 A;  2Q19 X;  1FDI A;  1CR5 A;  4AON B;  2JIP A;  5FTK A;  3OUG A;  5FTN A;  3GTP A;  5D6Y A;  1EU1 A;  3GTJ A;  1YNJ D;  2VPW A;  2KY9 A;  3QWZ A;  1E61 A;  1Y4Z A;  4ARC A;  2VUM A;  5T5M D;  1SFO A;  3CQZ A;  2KI8 A;  5DYI A;  2NVX A;  4KLN A;  2PMZ A;  4KDL A;  2EEO B;  3LHD A;  2BE5 D;  4DMR A;  2YVL A;  1CZ5 A;  1G8K A;  5EPP A;  3GTQ A;  2NAP A;  2C45 A;  1E60 A;  4QIW A;  1OGY A;  2A68 D;  2JIO A;  4CRZ A;  2R93 A;  3LGA A;  2MM0 A;  2G6G A;  5FTJ A;  1CZ4 A;  2B63 A;  5FTL A;  1TWH A;  1R27 A;  3HU2 A;  2NYA A;  4C2M A;  2CW0 D;  4GA5 A;  4CS0 A;  2WAQ A;  2V45 A;  1E18 A;  1QCS A;  4CQN A;  5T5I D;  5CCB A;  1DMS A;  3QQ7 A;  2E2I A;  1H5N A;  3TM7 B;  1IW7 D;  1TMO A;  5CCX A;  3IR6 A;  5FTM A;  5D6X A;  1PQF A;  1TWG A;  1AW8 B;  1ZC1 A;  2JIQ A;  1Y1W A;  3BQB A;  5CD1 A;  1PT0 A;  1I9G A;  1DMR A;  1QDN A;  1Q16 A;  5GLF A;  2JV2 A;  2A6H D;  2VPY A;  2WB1 A;  4AZD A;  1I50 A;  1UHE A;  4AQ7 A;  1PQE A;  2YUJ A;  3QQ8 A;  4CRY G;  4NOH A;  3ZJT A;  5ERG B;  2O5J D;  2Y0S A;  5B6C A;  4UC4 A;  2A6E D;  3H0G A;  1PPY A;  2A69 D;  3HKZ A;  2MM2 A;  2IV2 X;  5C1B A;  1WLF A;  1K83 A;  1E5V A;  4AOK B;  1O54 A;  2PJH B;  4FIB A;  3IR5 A;  1AA6 A;  3FPU A;  4AAY A;  2Q18 X;  3MB5 A;  3FKI A;  3FPR A;  3QC8 A;  1E32 A;  3GTK A;  2GFA A;  3ML1 A;  3GTL A;  3TIW A;  2JA7 A;  2QQS A;  1H0H A;  5DYG A;  3GTO A;  3GTM A;  1KQG A;  2PNW A;  1Y1V A;  4AYB A;  1SIW A;  4D7Z B;  1SMY D;  2XDP A;  4RV0 A;  3ZGZ A;  1R7R A;  3CZB A;  3DMR A;  3FPT A;  2QQR A;  2GF7 A;  1ZYR D;  2G5D A;  2Q1D X;  1PYU B;  3GTG A;  1YLE A;  1FDO A;  2E7Z A;  1R9T A;  2PI8 A;  3ZJV A;  1S3S A;  4KO8 A;  2GAE A;  4KDI A;  1VC3 B;  2Q1A X;  2VPZ A;  1TWC A;  2Q1C X;  1G8J A;  1PYQ A;  4AS1 A;  1PT1 A;  2JA5 A;  1TWA A;  3O5A A;  2R7Z A;  2DMR A;  1I3Q A;  1PQH A;  2JIR A;  3IR7 A;  2R92 A;  4ARI A;  5D6W A;  2JIM A;  3PLX B;  2NVY A;  1TWF A;  5EQJ B;  2PWY A;  2E2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...