1CZ5A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
185
structure length
185
Chain Sequence
MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VCP-LIKE ATPASE
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 23
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz5A02
2E2HA 1PYQA 4KDLA 1E5VA 5FTKA 5C18A 3QQ8A 4KODA 4KO8A 2B63A 3ML1A 1AA6A 1KQGA 1I3QA 1TWFA 4AYBA 2E2IA 1Y1VA 3IR5A 1Y4ZA 2VUMA 1VC3B 1R27A 1PYUB 1R7RA 4CS0A 2R92A 2C45A 2E7ZA 3FKIA 1S3SA 2JA5A 1H0HA 3IR7A 3HKZA 3GTKA 1H5NA 1E60A 2Y0SA 1PT1A 1TMOA 1TWGA 5FTNA 1PQFA 3CQZA 3GTLA 1G8KA 2VPZA 2NVXA 1WCMA 2R7ZA 3QWZA 4AAYA 1Y5IA 5EPPA 2KI8A 3QC8A 1E18A 1AW8B 1UHDA 1KQFA 4KDIA 4GA5A 2JIPA 3GTOA 1FDOA 1CR5A 2WB1A 2R93A 5C1BA 2V45A 1IW7D 1TWAA 3QQ7A 1FDIA 3HU2A 1SIWA 3IR6A 3GTMA 2V3VA 4CRYG 3GTGA 1Q16A 2JA6A 1SFOA 2VPWA 1EU1A 5DYGA 1ZC1A 2JV2A 3OUGA 2NYAA 1PPYA 1WLFA 4KLNA 2JIRA 1TWHA 3CF2A 4RV0A 3TM7B 1E61A 2WAQA 3GTPA 1Y1WA 5T5ID 1PQEA 5FTMA 1CZ4A 1CZ5A 2YU9A 1TWCA 2JA7A 5T5MD 2JIQA 2NAPA 2PJHB 2VPYA 3HU3A 5GLFA 3GTQA 5FTJA 1UHEA 4D7ZB 2DMRA 1I50A 3H0GA 1DMRA 1PQHA 3PLXB 4AOKB 2IV2X 2PMZA 2EEOB 4AZDA 3DMRA 1OGYA 3HU1A 1K83A 5DYIA 4QIWA 4C2MA 5B6CA 2JIMA 1E32A 2NVYA 3TIWA 2VPXA 4AONB 1DMSA 3O5AA 4GA6A 4CRZA 1R9TA 2JIOA 5FTLA 1QCSA 1QDNA 1YLEA 4DMRA 1PT0A 1G8JA 3GTJA 2YUJA
chains in the Genus database with same CATH superfamily
3X2MA 2Q1AX 2YVLA 5D6XA 2E2HA 1PYQA 3CZBA 5CCBA 4FIBA 3ENGA 4KDLA 1BW4A 1E5VA 5FTKA 1YNJD 5C18A 3QQ8A 4KODA 3ZGZA 4KO8A 2B63A 3ML1A 1AA6A 1KQGA 4AVRA 1I3QA 1TWFA 4AYBA 2E2IA 3D30A 1Y1VA 3IR5A 1Y4ZA 2VUMA 3BQBA 1VC3B 1R27A 2PNWA 1WC2A 1PYUB 1R7RA 1OA9A 2A68D 4CS0A 2R92A 2Q1DX 2C45A 2E7ZA 3FKIA 1S3SA 3M3GA 2O5JD 2JA5A 3LGAA 1H0HA 3IR7A 3HKZA 3GTKA 3ZJUA 1H5NA 1E60A 2Y0SA 5GLXA 4ARIA 1PT1A 1TMOA 3MB5A 1TWGA 5GLYA 2PJJA 5FTNA 1PQFA 3CQZA 3SUKA 3GTLA 2MM0A 1G8KA 2VPZA 3SUJA 2NVXA 2B25A 1WCMA 2R7ZA 1N10A 5D6WA 3QWZA 3SULA 4AAYA 4AQ7A 1Y5IA 5EPPA 2KI8A 4JCWA 1O54A 3QC8A 2GF7A 3FPTA 5EQJB 1E18A 4JJOA 2G6GA 3ZJTA 1AW8B 1UHDA 1I9GA 1KQFA 4KDIA 4GA5A 2JIPA 3X2NA 1FDOA 1CR5A 1ZYRD 2GAEA 2WB1A 3X2LA 3X2JA 4ENGA 5C1BA 2KQAA 2V45A 1IW7D 3X2KA 2QQSA 3X2OA 1TWAA 3QQ7A 4ZM7A 1FDIA 3HU2A 1SIWA 2PICA 2PWYA 3IR6A 5GM9A 2V3VA 3GTMA 4CRYG 3GTGA 3X2PA 1Q16A 2A6HD 3LHDA 4UC4A 2A6ED 2Q19X 2JA6A 1SFOA 2VPWA 1EU1A 1ZC1A 5DYGA 2JV2A 2PI8A 3ZJVA 3OUGA 3X2GA 4L48A 2NYAA 4NOHA 1PPYA 1WLFA 4KLNA 2QQRA 5CD1A 2JIRA 1TWHA 3CF2A 3FPRA 4RV0A 3TM7B 1E61A 2WAQA 3GTPA 1OA7A 1Y1WA 5T5ID 1PQEA 2AE0X 5FTMA 2BE5D 2ENGA 3X2HA 1CZ4A 1L8FA 2HCZX 1CZ5A 1SMYD 2YU9A 1TWCA 5H4UA 2JA7A 3FPUA 5T5MD 2JIQA 2NAPA 2PJHB 5CCXA 2VPYA 3HU3A 5GLFA 4JP7A 3GTQA 2BH0A 2A69D 5FTJA 1UHEA 4D7ZB 2DMRA 1I50A 3H0GA 1DMRA 4FG4A 5D6YA 1PQHA 2R93A 2CW0D 3PLXB 2IV2X 3SUMA 4AOKB 4AS1A 2PMZA 2EEOB 4AZDA 3GTOA 3DMRA 2KY9A 1OGYA 4ARCA 3HU1A 1K83A 2Q1CX 2MM2A 5DYIA 4QIWA 4C2MA 5B6CA 2JIMA 1E32A 2NVYA 2LW6A 4CQNA 2G5DA 4JP6A 3TIWA 2VPXA 4AONB 1DMSA 3O5AA 4FG2A 4GA6A 1YNND 4CRZA 3X2IA 1R9TA 2GFAA 5ERGB 2JIOA 4FFTA 1BW3A 5FTLA 2XDPA 1QCSA 1HD5A 1QDNA 1YLEA 4JS7A 4FERA 4DMRA 1PT0A 1G8JA 3GTJA 2Q18X 2YUJA
chains in the Genus database with same CATH topology
2Q1AX 2YVLA 5D6XA 2E2HA 1PYQA 3CZBA 5CCBA 4FIBA 4KDLA 1E5VA 5FTKA 1YNJD 5C18A 3QQ8A 4KODA 3ZGZA 4KO8A 2B63A 3ML1A 1AA6A 1KQGA 1I3QA 1TWFA 4AYBA 2E2IA 1Y1VA 3IR5A 1Y4ZA 2VUMA 3BQBA 1VC3B 1R27A 2PNWA 1PYUB 1R7RA 4CS0A 2A68D 2Q1DX 2R92A 2C45A 2E7ZA 3FKIA 1S3SA 2O5JD 2JA5A 3LGAA 1H0HA 3IR7A 3HKZA 3GTKA 3ZJUA 1H5NA 1E60A 2Y0SA 4ARIA 1PT1A 1TMOA 3MB5A 1TWGA 2PJJA 5FTNA 1PQFA 3CQZA 2MM0A 3GTLA 1G8KA 2VPZA 2NVXA 2B25A 1WCMA 2R7ZA 5D6WA 3QWZA 4AAYA 4AQ7A 1Y5IA 5EPPA 2KI8A 1O54A 3FPTA 3QC8A 2GF7A 5EQJB 1E18A 2G6GA 3ZJTA 1AW8B 1UHDA 1I9GA 1KQFA 4KDIA 4GA5A 2JIPA 3GTOA 1FDOA 1CR5A 1ZYRD 2GAEA 2WB1A 5C1BA 2V45A 2QQSA 1IW7D 1TWAA 3QQ7A 1FDIA 3HU2A 1SIWA 2PICA 2PWYA 3IR6A 3GTMA 2V3VA 4CRYG 3GTGA 3LHDA 1Q16A 2A6HD 4UC4A 2A6ED 2Q19X 2JA6A 1SFOA 2VPWA 1EU1A 1ZC1A 5DYGA 2JV2A 2PI8A 3ZJVA 3OUGA 2NYAA 4NOHA 1PPYA 1WLFA 4KLNA 2QQRA 5CD1A 2JIRA 1TWHA 3CF2A 3FPRA 4RV0A 3TM7B 1E61A 2WAQA 3GTPA 1Y1WA 5T5ID 1PQEA 2AE0X 5FTMA 2BE5D 1CZ4A 1CZ5A 1SMYD 2YU9A 1TWCA 2JA7A 3FPUA 5T5MD 2JIQA 2NAPA 2PJHB 5CCXA 2VPYA 3HU3A 5GLFA 3GTQA 2A69D 5FTJA 1UHEA 4D7ZB 2DMRA 1I50A 3H0GA 1DMRA 5D6YA 1PQHA 2R93A 2CW0D 3PLXB 2IV2X 4AOKB 4AS1A 2PMZA 2EEOB 4AZDA 3DMRA 2KY9A 1OGYA 4ARCA 3HU1A 1K83A 2Q1CX 2MM2A 5DYIA 4QIWA 4C2MA 5B6CA 2JIMA 1E32A 2NVYA 2LW6A 4CQNA 2G5DA 3TIWA 2VPXA 4AONB 1DMSA 3O5AA 4GA6A 1YNND 4CRZA 1R9TA 2GFAA 5ERGB 2JIOA 5FTLA 2XDPA 1QCSA 1QDNA 1YLEA 4DMRA 1PT0A 1G8JA 3GTJA 2Q18X 2YUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H A;  1PYQ A;  4KDL A;  1E5V A;  5FTK A;  5C18 A;  3QQ8 A;  4KOD A;  4KO8 A;  2B63 A;  3ML1 A;  1AA6 A;  1KQG A;  1I3Q A;  1TWF A;  4AYB A;  2E2I A;  1Y1V A;  3IR5 A;  1Y4Z A;  2VUM A;  1VC3 B;  1R27 A;  1PYU B;  1R7R A;  4CS0 A;  2R92 A;  2C45 A;  2E7Z A;  3FKI A;  1S3S A;  2JA5 A;  1H0H A;  3IR7 A;  3HKZ A;  3GTK A;  1H5N A;  1E60 A;  2Y0S A;  1PT1 A;  1TMO A;  1TWG A;  5FTN A;  1PQF A;  3CQZ A;  3GTL A;  1G8K A;  2VPZ A;  2NVX A;  1WCM A;  2R7Z A;  3QWZ A;  4AAY A;  1Y5I A;  5EPP A;  2KI8 A;  3QC8 A;  1E18 A;  1AW8 B;  1UHD A;  1KQF A;  4KDI A;  4GA5 A;  2JIP A;  3GTO A;  1FDO A;  1CR5 A;  2WB1 A;  2R93 A;  5C1B A;  2V45 A;  1IW7 D;  1TWA A;  3QQ7 A;  1FDI A;  3HU2 A;  1SIW A;  3IR6 A;  3GTM A;  2V3V A;  4CRY G;  3GTG A;  1Q16 A;  2JA6 A;  1SFO A;  2VPW A;  1EU1 A;  5DYG A;  1ZC1 A;  2JV2 A;  3OUG A;  2NYA A;  1PPY A;  1WLF A;  4KLN A;  2JIR A;  1TWH A;  3CF2 A;  4RV0 A;  3TM7 B;  1E61 A;  2WAQ A;  3GTP A;  1Y1W A;  5T5I D;  1PQE A;  5FTM A;  1CZ4 A;  1CZ5 A;  2YU9 A;  1TWC A;  2JA7 A;  5T5M D;  2JIQ A;  2NAP A;  2PJH B;  2VPY A;  3HU3 A;  5GLF A;  3GTQ A;  5FTJ A;  1UHE A;  4D7Z B;  2DMR A;  1I50 A;  3H0G A;  1DMR A;  1PQH A;  3PLX B;  4AOK B;  2IV2 X;  2PMZ A;  2EEO B;  4AZD A;  3DMR A;  1OGY A;  3HU1 A;  1K83 A;  5DYI A;  4QIW A;  4C2M A;  5B6C A;  2JIM A;  1E32 A;  2NVY A;  3TIW A;  2VPX A;  4AON B;  1DMS A;  3O5A A;  4GA6 A;  4CRZ A;  1R9T A;  2JIO A;  5FTL A;  1QCS A;  1QDN A;  1YLE A;  4DMR A;  1PT0 A;  1G8J A;  3GTJ A;  2YUJ A; 
#chains in the Genus database with same CATH topology
 3X2M A;  2Q1A X;  2YVL A;  5D6X A;  2E2H A;  1PYQ A;  3CZB A;  5CCB A;  4FIB A;  3ENG A;  4KDL A;  1BW4 A;  1E5V A;  5FTK A;  1YNJ D;  5C18 A;  3QQ8 A;  4KOD A;  3ZGZ A;  4KO8 A;  2B63 A;  3ML1 A;  1AA6 A;  1KQG A;  4AVR A;  1I3Q A;  1TWF A;  4AYB A;  2E2I A;  3D30 A;  1Y1V A;  3IR5 A;  1Y4Z A;  2VUM A;  3BQB A;  1VC3 B;  1R27 A;  2PNW A;  1WC2 A;  1PYU B;  1R7R A;  1OA9 A;  2A68 D;  4CS0 A;  2R92 A;  2Q1D X;  2C45 A;  2E7Z A;  3FKI A;  1S3S A;  3M3G A;  2O5J D;  2JA5 A;  3LGA A;  1H0H A;  3IR7 A;  3HKZ A;  3GTK A;  3ZJU A;  1H5N A;  1E60 A;  2Y0S A;  5GLX A;  4ARI A;  1PT1 A;  1TMO A;  3MB5 A;  1TWG A;  5GLY A;  2PJJ A;  5FTN A;  1PQF A;  3CQZ A;  3SUK A;  3GTL A;  2MM0 A;  1G8K A;  2VPZ A;  3SUJ A;  2NVX A;  2B25 A;  1WCM A;  2R7Z A;  1N10 A;  5D6W A;  3QWZ A;  3SUL A;  4AAY A;  4AQ7 A;  1Y5I A;  5EPP A;  2KI8 A;  4JCW A;  1O54 A;  3QC8 A;  2GF7 A;  3FPT A;  5EQJ B;  1E18 A;  4JJO A;  2G6G A;  3ZJT A;  1AW8 B;  1UHD A;  1I9G A;  1KQF A;  4KDI A;  4GA5 A;  2JIP A;  3X2N A;  1FDO A;  1CR5 A;  1ZYR D;  2GAE A;  2WB1 A;  3X2L A;  3X2J A;  4ENG A;  5C1B A;  2KQA A;  2V45 A;  1IW7 D;  3X2K A;  2QQS A;  3X2O A;  1TWA A;  3QQ7 A;  4ZM7 A;  1FDI A;  3HU2 A;  1SIW A;  2PIC A;  2PWY A;  3IR6 A;  5GM9 A;  2V3V A;  3GTM A;  4CRY G;  3GTG A;  3X2P A;  1Q16 A;  2A6H D;  3LHD A;  4UC4 A;  2A6E D;  2Q19 X;  2JA6 A;  1SFO A;  2VPW A;  1EU1 A;  1ZC1 A;  5DYG A;  2JV2 A;  2PI8 A;  3ZJV A;  3OUG A;  3X2G A;  4L48 A;  2NYA A;  4NOH A;  1PPY A;  1WLF A;  4KLN A;  2QQR A;  5CD1 A;  2JIR A;  1TWH A;  3CF2 A;  3FPR A;  4RV0 A;  3TM7 B;  1E61 A;  2WAQ A;  3GTP A;  1OA7 A;  1Y1W A;  5T5I D;  1PQE A;  2AE0 X;  5FTM A;  2BE5 D;  2ENG A;  3X2H A;  1CZ4 A;  1L8F A;  2HCZ X;  1CZ5 A;  1SMY D;  2YU9 A;  1TWC A;  5H4U A;  2JA7 A;  3FPU A;  5T5M D;  2JIQ A;  2NAP A;  2PJH B;  5CCX A;  2VPY A;  3HU3 A;  5GLF A;  4JP7 A;  3GTQ A;  2BH0 A;  2A69 D;  5FTJ A;  1UHE A;  4D7Z B;  2DMR A;  1I50 A;  3H0G A;  1DMR A;  4FG4 A;  5D6Y A;  1PQH A;  2R93 A;  2CW0 D;  3PLX B;  2IV2 X;  3SUM A;  4AOK B;  4AS1 A;  2PMZ A;  2EEO B;  4AZD A;  3GTO A;  3DMR A;  2KY9 A;  1OGY A;  4ARC A;  3HU1 A;  1K83 A;  2Q1C X;  2MM2 A;  5DYI A;  4QIW A;  4C2M A;  5B6C A;  2JIM A;  1E32 A;  2NVY A;  2LW6 A;  4CQN A;  2G5D A;  4JP6 A;  3TIW A;  2VPX A;  4AON B;  1DMS A;  3O5A A;  4FG2 A;  4GA6 A;  1YNN D;  4CRZ A;  3X2I A;  1R9T A;  2GFA A;  5ERG B;  2JIO A;  4FFT A;  1BW3 A;  5FTL A;  2XDP A;  1QCS A;  1HD5 A;  1QDN A;  1YLE A;  4JS7 A;  4FER A;  4DMR A;  1PT0 A;  1G8J A;  3GTJ A;  2Q18 X;  2YUJ A; 
#chains in the Genus database with same CATH homology
 2Q1A X;  2YVL A;  5D6X A;  2E2H A;  1PYQ A;  3CZB A;  5CCB A;  4FIB A;  4KDL A;  1E5V A;  5FTK A;  1YNJ D;  5C18 A;  3QQ8 A;  4KOD A;  3ZGZ A;  4KO8 A;  2B63 A;  3ML1 A;  1AA6 A;  1KQG A;  1I3Q A;  1TWF A;  4AYB A;  2E2I A;  1Y1V A;  3IR5 A;  1Y4Z A;  2VUM A;  3BQB A;  1VC3 B;  1R27 A;  2PNW A;  1PYU B;  1R7R A;  4CS0 A;  2A68 D;  2Q1D X;  2R92 A;  2C45 A;  2E7Z A;  3FKI A;  1S3S A;  2O5J D;  2JA5 A;  3LGA A;  1H0H A;  3IR7 A;  3HKZ A;  3GTK A;  3ZJU A;  1H5N A;  1E60 A;  2Y0S A;  4ARI A;  1PT1 A;  1TMO A;  3MB5 A;  1TWG A;  2PJJ A;  5FTN A;  1PQF A;  3CQZ A;  2MM0 A;  3GTL A;  1G8K A;  2VPZ A;  2NVX A;  2B25 A;  1WCM A;  2R7Z A;  5D6W A;  3QWZ A;  4AAY A;  4AQ7 A;  1Y5I A;  5EPP A;  2KI8 A;  1O54 A;  3FPT A;  3QC8 A;  2GF7 A;  5EQJ B;  1E18 A;  2G6G A;  3ZJT A;  1AW8 B;  1UHD A;  1I9G A;  1KQF A;  4KDI A;  4GA5 A;  2JIP A;  3GTO A;  1FDO A;  1CR5 A;  1ZYR D;  2GAE A;  2WB1 A;  5C1B A;  2V45 A;  2QQS A;  1IW7 D;  1TWA A;  3QQ7 A;  1FDI A;  3HU2 A;  1SIW A;  2PIC A;  2PWY A;  3IR6 A;  3GTM A;  2V3V A;  4CRY G;  3GTG A;  3LHD A;  1Q16 A;  2A6H D;  4UC4 A;  2A6E D;  2Q19 X;  2JA6 A;  1SFO A;  2VPW A;  1EU1 A;  1ZC1 A;  5DYG A;  2JV2 A;  2PI8 A;  3ZJV A;  3OUG A;  2NYA A;  4NOH A;  1PPY A;  1WLF A;  4KLN A;  2QQR A;  5CD1 A;  2JIR A;  1TWH A;  3CF2 A;  3FPR A;  4RV0 A;  3TM7 B;  1E61 A;  2WAQ A;  3GTP A;  1Y1W A;  5T5I D;  1PQE A;  2AE0 X;  5FTM A;  2BE5 D;  1CZ4 A;  1CZ5 A;  1SMY D;  2YU9 A;  1TWC A;  2JA7 A;  3FPU A;  5T5M D;  2JIQ A;  2NAP A;  2PJH B;  5CCX A;  2VPY A;  3HU3 A;  5GLF A;  3GTQ A;  2A69 D;  5FTJ A;  1UHE A;  4D7Z B;  2DMR A;  1I50 A;  3H0G A;  1DMR A;  5D6Y A;  1PQH A;  2R93 A;  2CW0 D;  3PLX B;  2IV2 X;  4AOK B;  4AS1 A;  2PMZ A;  2EEO B;  4AZD A;  3DMR A;  2KY9 A;  1OGY A;  4ARC A;  3HU1 A;  1K83 A;  2Q1C X;  2MM2 A;  5DYI A;  4QIW A;  4C2M A;  5B6C A;  2JIM A;  1E32 A;  2NVY A;  2LW6 A;  4CQN A;  2G5D A;  3TIW A;  2VPX A;  4AON B;  1DMS A;  3O5A A;  4GA6 A;  1YNN D;  4CRZ A;  1R9T A;  2GFA A;  5ERG B;  2JIO A;  5FTL A;  2XDP A;  1QCS A;  1QDN A;  1YLE A;  4DMR A;  1PT0 A;  1G8J A;  3GTJ A;  2Q18 X;  2YUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...