1CZ5A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
185
structure length
185
Chain Sequence
MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VCP-LIKE ATPASE
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 23
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz5A02
4AAYA 3GTLA 3GTGA 4CS0A 3TIWA 4KDIA 2NYAA 2R7ZA 2PMZA 3IR5A 1DMSA 1E60A 1IW7D 1K83A 1E61A 4KLNA 2WB1A 1TWFA 4D7ZB 1CR5A 1QCSA 4C2MA 3H0GA 2JA6A 2JA5A 4RV0A 1DMRA 4AZDA 5T5ID 2VPZA 1AW8B 2JIPA 2E7ZA 5T5MD 5C1BA 3GTPA 1Y4ZA 3HKZA 1ZC1A 5GLFA 1TWAA 5FTKA 3DMRA 1OGYA 1S3SA 1FDIA 2EEOB 4AOKB 1E32A 2JA7A 2IV2X 1Q16A 1SFOA 1PQEA 2WAQA 1CZ5A 1H5NA 1E18A 1PYUB 1YLEA 2E2IA 2V45A 3TM7B 1TWHA 3HU2A 4GA6A 2NVYA 1TMOA 3HU1A 2YUJA 1E5VA 4KODA 2R93A 4QIWA 1FDOA 3QWZA 5DYIA 2YU9A 1R27A 1KQFA 2B63A 1PQHA 2Y0SA 1AA6A 3QQ7A 3GTJA 4KO8A 5EPPA 4GA5A 5FTLA 1R9TA 1UHEA 2PJHB 3QQ8A 2JV2A 4DMRA 1PQFA 1WCMA 3FKIA 2KI8A 5FTNA 4CRZA 2JIMA 4KDLA 1G8KA 2JIOA 3ML1A 5C18A 2NVXA 1R7RA 1KQGA 1QDNA 2VPYA 3IR6A 5B6CA 2VPXA 1TWGA 4CRYG 1WLFA 5FTMA 1Y1WA 1SIWA 1I50A 2E2HA 3CF2A 1G8JA 3GTKA 2VUMA 3GTQA 1PT0A 1PYQA 1EU1A 3GTMA 3CQZA 3PLXB 3GTOA 3O5AA 2V3VA 2VPWA 1PPYA 3IR7A 4AYBA 1CZ4A 4AONB 3HU3A 2DMRA 2JIRA 1Y1VA 1PT1A 1TWCA 1UHDA 5FTJA 3QC8A 2R92A 1I3QA 1Y5IA 2NAPA 1H0HA 5DYGA 1VC3B 3OUGA 2JIQA 2C45A
chains in the Genus database with same CATH superfamily
4AAYA 3GTLA 1OA9A 3GTGA 4JP7A 2MM0A 2GAEA 4CS0A 3TIWA 4KDIA 2NYAA 2R7ZA 2PMZA 4AS1A 3IR5A 2XDPA 1DMSA 1E60A 1IW7D 4JCWA 3M3GA 1K83A 2A68D 1SMYD 1E61A 4KLNA 2WB1A 5D6XA 1TWFA 4D7ZB 1CR5A 1QCSA 4C2MA 3H0GA 2JA6A 2JA5A 3BQBA 4RV0A 3LGAA 1DMRA 4FFTA 4AZDA 5T5ID 2VPZA 1AW8B 1YNND 2JIPA 2E7ZA 5T5MD 2B25A 5C1BA 3GTPA 1YNJD 1Y4ZA 3X2JA 2Q18X 3HKZA 1ZC1A 5GLFA 1HD5A 5FTKA 3ZJTA 5D6WA 4AVRA 3DMRA 1OGYA 1S3SA 3ENGA 1FDIA 2EEOB 2PI8A 1L8FA 3SULA 4AOKB 1E32A 2JA7A 2IV2X 1Q16A 1SFOA 1PQEA 2WAQA 1CZ5A 4ARCA 1H5NA 2KQAA 1E18A 4ZM7A 4CQNA 1PYUB 1YLEA 3X2GA 2V45A 1WC2A 3TM7B 2E2IA 1TWHA 3HU2A 2PNWA 4GA6A 5CCBA 2NVYA 1TMOA 3HU1A 2JIQA 2CW0D 2PJJA 2YUJA 1I9GA 1E5VA 3ZGZA 2A69D 2ENGA 4KODA 3X2LA 3CZBA 3SUJA 4QIWA 2R93A 1FDOA 2BH0A 3QWZA 5DYIA 3X2IA 2HCZX 1R27A 4JP6A 1KQFA 2YU9A 2Q1CX 2B63A 4JS7A 2QQSA 1PQHA 1N10A 3MB5A 4L48A 2Y0SA 2KY9A 1AA6A 3QQ7A 3GTJA 4KO8A 4NOHA 5EPPA 4GA5A 5CCXA 5FTLA 1R9TA 3FPRA 1UHEA 4AQ7A 2AE0X 3FPTA 3FPUA 3X2HA 2PJHB 2QQRA 5D6YA 3QQ8A 2JV2A 4DMRA 1PQFA 1WCMA 2G5DA 4FG2A 3FKIA 2A6ED 3X2KA 1BW4A 2G6GA 2KI8A 4JJOA 5FTNA 2O5JD 3LHDA 1OA7A 4CRZA 2JIMA 4KDLA 2BE5D 1G8KA 2JIOA 1O54A 3ML1A 5C18A 2NVXA 1R7RA 5GLYA 3X2NA 4ENGA 1KQGA 3SUKA 1QDNA 2VPYA 3IR6A 5B6CA 5EQJB 2VPXA 1TWGA 2A6HD 1WLFA 4CRYG 2GFAA 2Q1AX 2Q1DX 5FTMA 1Y1WA 1SIWA 1I50A 2E2HA 3CF2A 2PICA 3ZJUA 1G8JA 3GTKA 2VUMA 5ERGB 2Q19X 3GTQA 1PT0A 1PYQA 1EU1A 4FG4A 3GTMA 3CQZA 1BW3A 3X2PA 3PLXB 3GTOA 3O5AA 2V3VA 2LW6A 5CD1A 2VPWA 1PPYA 1ZYRD 5GLXA 3IR7A 3X2OA 4AYBA 2YVLA 3SUMA 1CZ4A 4AONB 3HU3A 2DMRA 2JIRA 1Y1VA 1PT1A 2MM2A 4FIBA 1TWCA 4FERA 4ARIA 1UHDA 5FTJA 3QC8A 5H4UA 2R92A 1I3QA 1Y5IA 2NAPA 3ZJVA 3D30A 3X2MA 1H0HA 2GF7A 5DYGA 4UC4A 2PWYA 5GM9A 1VC3B 3OUGA 1TWAA 2C45A
chains in the Genus database with same CATH topology
4AAYA 3GTLA 3GTGA 2MM0A 2GAEA 4CS0A 3TIWA 4KDIA 2NYAA 2R7ZA 2PMZA 4AS1A 3IR5A 2XDPA 1DMSA 1E60A 1IW7D 1K83A 2A68D 1SMYD 1E61A 4KLNA 2WB1A 5D6XA 1TWFA 4D7ZB 1CR5A 1QCSA 4C2MA 3H0GA 2JA6A 2JA5A 3BQBA 4RV0A 3LGAA 1DMRA 4AZDA 5T5ID 2VPZA 1AW8B 1YNND 2JIPA 2E7ZA 5T5MD 2B25A 5C1BA 3GTPA 1YNJD 1Y4ZA 2Q18X 3HKZA 1ZC1A 5GLFA 1TWAA 5FTKA 3ZJTA 5D6WA 3DMRA 1OGYA 1S3SA 1FDIA 2EEOB 2PI8A 4AOKB 1E32A 2JA7A 2IV2X 1Q16A 1SFOA 1PQEA 2WAQA 1CZ5A 4ARCA 1H5NA 4CQNA 1E18A 1PYUB 1YLEA 2E2IA 2V45A 3TM7B 5CCBA 1TWHA 3HU2A 2PNWA 4GA6A 2NVYA 1TMOA 3HU1A 2CW0D 2PJJA 2YUJA 1I9GA 1E5VA 3ZGZA 2A69D 4KODA 3CZBA 2R93A 4QIWA 2Q19X 1FDOA 3QWZA 5DYIA 2YU9A 1R27A 1KQFA 2QQSA 2Q1CX 2B63A 1PQHA 3MB5A 2Y0SA 2KY9A 1AA6A 3QQ7A 3GTJA 4KO8A 4NOHA 5EPPA 4GA5A 5CCXA 5FTLA 1R9TA 3FPRA 1UHEA 4AQ7A 2AE0X 3FPTA 3FPUA 2PJHB 2QQRA 5D6YA 3QQ8A 2JV2A 4DMRA 1PQFA 1WCMA 2G5DA 3FKIA 2A6ED 2G6GA 2KI8A 5FTNA 3LHDA 2O5JD 4CRZA 2JIMA 4KDLA 2BE5D 1G8KA 2JIOA 1O54A 3ML1A 5C18A 2NVXA 1R7RA 1KQGA 1QDNA 2VPYA 3IR6A 5B6CA 5EQJB 2VPXA 1TWGA 2A6HD 1WLFA 4CRYG 2GFAA 2Q1AX 2Q1DX 5FTMA 1Y1WA 1SIWA 1I50A 2E2HA 3CF2A 2PICA 3ZJUA 1G8JA 3GTKA 2VUMA 5ERGB 3GTQA 1PT0A 1PYQA 1EU1A 3GTMA 3CQZA 3PLXB 3GTOA 3O5AA 2V3VA 2LW6A 5CD1A 2VPWA 1PPYA 1ZYRD 3IR7A 4AYBA 2YVLA 1CZ4A 4AONB 3HU3A 2DMRA 2JIRA 1Y1VA 1PT1A 2MM2A 4FIBA 1TWCA 4ARIA 1UHDA 5FTJA 3QC8A 2R92A 1I3QA 1Y5IA 2NAPA 3ZJVA 1H0HA 2GF7A 5DYGA 4UC4A 2PWYA 1VC3B 3OUGA 2JIQA 2C45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAY A;  3GTL A;  3GTG A;  4CS0 A;  3TIW A;  4KDI A;  2NYA A;  2R7Z A;  2PMZ A;  3IR5 A;  1DMS A;  1E60 A;  1IW7 D;  1K83 A;  1E61 A;  4KLN A;  2WB1 A;  1TWF A;  4D7Z B;  1CR5 A;  1QCS A;  4C2M A;  3H0G A;  2JA6 A;  2JA5 A;  4RV0 A;  1DMR A;  4AZD A;  5T5I D;  2VPZ A;  1AW8 B;  2JIP A;  2E7Z A;  5T5M D;  5C1B A;  3GTP A;  1Y4Z A;  3HKZ A;  1ZC1 A;  5GLF A;  1TWA A;  5FTK A;  3DMR A;  1OGY A;  1S3S A;  1FDI A;  2EEO B;  4AOK B;  1E32 A;  2JA7 A;  2IV2 X;  1Q16 A;  1SFO A;  1PQE A;  2WAQ A;  1CZ5 A;  1H5N A;  1E18 A;  1PYU B;  1YLE A;  2E2I A;  2V45 A;  3TM7 B;  1TWH A;  3HU2 A;  4GA6 A;  2NVY A;  1TMO A;  3HU1 A;  2YUJ A;  1E5V A;  4KOD A;  2R93 A;  4QIW A;  1FDO A;  3QWZ A;  5DYI A;  2YU9 A;  1R27 A;  1KQF A;  2B63 A;  1PQH A;  2Y0S A;  1AA6 A;  3QQ7 A;  3GTJ A;  4KO8 A;  5EPP A;  4GA5 A;  5FTL A;  1R9T A;  1UHE A;  2PJH B;  3QQ8 A;  2JV2 A;  4DMR A;  1PQF A;  1WCM A;  3FKI A;  2KI8 A;  5FTN A;  4CRZ A;  2JIM A;  4KDL A;  1G8K A;  2JIO A;  3ML1 A;  5C18 A;  2NVX A;  1R7R A;  1KQG A;  1QDN A;  2VPY A;  3IR6 A;  5B6C A;  2VPX A;  1TWG A;  4CRY G;  1WLF A;  5FTM A;  1Y1W A;  1SIW A;  1I50 A;  2E2H A;  3CF2 A;  1G8J A;  3GTK A;  2VUM A;  3GTQ A;  1PT0 A;  1PYQ A;  1EU1 A;  3GTM A;  3CQZ A;  3PLX B;  3GTO A;  3O5A A;  2V3V A;  2VPW A;  1PPY A;  3IR7 A;  4AYB A;  1CZ4 A;  4AON B;  3HU3 A;  2DMR A;  2JIR A;  1Y1V A;  1PT1 A;  1TWC A;  1UHD A;  5FTJ A;  3QC8 A;  2R92 A;  1I3Q A;  1Y5I A;  2NAP A;  1H0H A;  5DYG A;  1VC3 B;  3OUG A;  2JIQ A;  2C45 A; 
#chains in the Genus database with same CATH topology
 4AAY A;  3GTL A;  1OA9 A;  3GTG A;  4JP7 A;  2MM0 A;  2GAE A;  4CS0 A;  3TIW A;  4KDI A;  2NYA A;  2R7Z A;  2PMZ A;  4AS1 A;  3IR5 A;  2XDP A;  1DMS A;  1E60 A;  1IW7 D;  4JCW A;  3M3G A;  1K83 A;  2A68 D;  1SMY D;  1E61 A;  4KLN A;  2WB1 A;  5D6X A;  1TWF A;  4D7Z B;  1CR5 A;  1QCS A;  4C2M A;  3H0G A;  2JA6 A;  2JA5 A;  3BQB A;  4RV0 A;  3LGA A;  1DMR A;  4FFT A;  4AZD A;  5T5I D;  2VPZ A;  1AW8 B;  1YNN D;  2JIP A;  2E7Z A;  5T5M D;  2B25 A;  5C1B A;  3GTP A;  1YNJ D;  1Y4Z A;  3X2J A;  2Q18 X;  3HKZ A;  1ZC1 A;  5GLF A;  1HD5 A;  5FTK A;  3ZJT A;  5D6W A;  4AVR A;  3DMR A;  1OGY A;  1S3S A;  3ENG A;  1FDI A;  2EEO B;  2PI8 A;  1L8F A;  3SUL A;  4AOK B;  1E32 A;  2JA7 A;  2IV2 X;  1Q16 A;  1SFO A;  1PQE A;  2WAQ A;  1CZ5 A;  4ARC A;  1H5N A;  2KQA A;  1E18 A;  4ZM7 A;  4CQN A;  1PYU B;  1YLE A;  3X2G A;  2V45 A;  1WC2 A;  3TM7 B;  2E2I A;  1TWH A;  3HU2 A;  2PNW A;  4GA6 A;  5CCB A;  2NVY A;  1TMO A;  3HU1 A;  2JIQ A;  2CW0 D;  2PJJ A;  2YUJ A;  1I9G A;  1E5V A;  3ZGZ A;  2A69 D;  2ENG A;  4KOD A;  3X2L A;  3CZB A;  3SUJ A;  4QIW A;  2R93 A;  1FDO A;  2BH0 A;  3QWZ A;  5DYI A;  3X2I A;  2HCZ X;  1R27 A;  4JP6 A;  1KQF A;  2YU9 A;  2Q1C X;  2B63 A;  4JS7 A;  2QQS A;  1PQH A;  1N10 A;  3MB5 A;  4L48 A;  2Y0S A;  2KY9 A;  1AA6 A;  3QQ7 A;  3GTJ A;  4KO8 A;  4NOH A;  5EPP A;  4GA5 A;  5CCX A;  5FTL A;  1R9T A;  3FPR A;  1UHE A;  4AQ7 A;  2AE0 X;  3FPT A;  3FPU A;  3X2H A;  2PJH B;  2QQR A;  5D6Y A;  3QQ8 A;  2JV2 A;  4DMR A;  1PQF A;  1WCM A;  2G5D A;  4FG2 A;  3FKI A;  2A6E D;  3X2K A;  1BW4 A;  2G6G A;  2KI8 A;  4JJO A;  5FTN A;  2O5J D;  3LHD A;  1OA7 A;  4CRZ A;  2JIM A;  4KDL A;  2BE5 D;  1G8K A;  2JIO A;  1O54 A;  3ML1 A;  5C18 A;  2NVX A;  1R7R A;  5GLY A;  3X2N A;  4ENG A;  1KQG A;  3SUK A;  1QDN A;  2VPY A;  3IR6 A;  5B6C A;  5EQJ B;  2VPX A;  1TWG A;  2A6H D;  1WLF A;  4CRY G;  2GFA A;  2Q1A X;  2Q1D X;  5FTM A;  1Y1W A;  1SIW A;  1I50 A;  2E2H A;  3CF2 A;  2PIC A;  3ZJU A;  1G8J A;  3GTK A;  2VUM A;  5ERG B;  2Q19 X;  3GTQ A;  1PT0 A;  1PYQ A;  1EU1 A;  4FG4 A;  3GTM A;  3CQZ A;  1BW3 A;  3X2P A;  3PLX B;  3GTO A;  3O5A A;  2V3V A;  2LW6 A;  5CD1 A;  2VPW A;  1PPY A;  1ZYR D;  5GLX A;  3IR7 A;  3X2O A;  4AYB A;  2YVL A;  3SUM A;  1CZ4 A;  4AON B;  3HU3 A;  2DMR A;  2JIR A;  1Y1V A;  1PT1 A;  2MM2 A;  4FIB A;  1TWC A;  4FER A;  4ARI A;  1UHD A;  5FTJ A;  3QC8 A;  5H4U A;  2R92 A;  1I3Q A;  1Y5I A;  2NAP A;  3ZJV A;  3D30 A;  3X2M A;  1H0H A;  2GF7 A;  5DYG A;  4UC4 A;  2PWY A;  5GM9 A;  1VC3 B;  3OUG A;  1TWA A;  2C45 A; 
#chains in the Genus database with same CATH homology
 4AAY A;  3GTL A;  3GTG A;  2MM0 A;  2GAE A;  4CS0 A;  3TIW A;  4KDI A;  2NYA A;  2R7Z A;  2PMZ A;  4AS1 A;  3IR5 A;  2XDP A;  1DMS A;  1E60 A;  1IW7 D;  1K83 A;  2A68 D;  1SMY D;  1E61 A;  4KLN A;  2WB1 A;  5D6X A;  1TWF A;  4D7Z B;  1CR5 A;  1QCS A;  4C2M A;  3H0G A;  2JA6 A;  2JA5 A;  3BQB A;  4RV0 A;  3LGA A;  1DMR A;  4AZD A;  5T5I D;  2VPZ A;  1AW8 B;  1YNN D;  2JIP A;  2E7Z A;  5T5M D;  2B25 A;  5C1B A;  3GTP A;  1YNJ D;  1Y4Z A;  2Q18 X;  3HKZ A;  1ZC1 A;  5GLF A;  1TWA A;  5FTK A;  3ZJT A;  5D6W A;  3DMR A;  1OGY A;  1S3S A;  1FDI A;  2EEO B;  2PI8 A;  4AOK B;  1E32 A;  2JA7 A;  2IV2 X;  1Q16 A;  1SFO A;  1PQE A;  2WAQ A;  1CZ5 A;  4ARC A;  1H5N A;  4CQN A;  1E18 A;  1PYU B;  1YLE A;  2E2I A;  2V45 A;  3TM7 B;  5CCB A;  1TWH A;  3HU2 A;  2PNW A;  4GA6 A;  2NVY A;  1TMO A;  3HU1 A;  2CW0 D;  2PJJ A;  2YUJ A;  1I9G A;  1E5V A;  3ZGZ A;  2A69 D;  4KOD A;  3CZB A;  2R93 A;  4QIW A;  2Q19 X;  1FDO A;  3QWZ A;  5DYI A;  2YU9 A;  1R27 A;  1KQF A;  2QQS A;  2Q1C X;  2B63 A;  1PQH A;  3MB5 A;  2Y0S A;  2KY9 A;  1AA6 A;  3QQ7 A;  3GTJ A;  4KO8 A;  4NOH A;  5EPP A;  4GA5 A;  5CCX A;  5FTL A;  1R9T A;  3FPR A;  1UHE A;  4AQ7 A;  2AE0 X;  3FPT A;  3FPU A;  2PJH B;  2QQR A;  5D6Y A;  3QQ8 A;  2JV2 A;  4DMR A;  1PQF A;  1WCM A;  2G5D A;  3FKI A;  2A6E D;  2G6G A;  2KI8 A;  5FTN A;  3LHD A;  2O5J D;  4CRZ A;  2JIM A;  4KDL A;  2BE5 D;  1G8K A;  2JIO A;  1O54 A;  3ML1 A;  5C18 A;  2NVX A;  1R7R A;  1KQG A;  1QDN A;  2VPY A;  3IR6 A;  5B6C A;  5EQJ B;  2VPX A;  1TWG A;  2A6H D;  1WLF A;  4CRY G;  2GFA A;  2Q1A X;  2Q1D X;  5FTM A;  1Y1W A;  1SIW A;  1I50 A;  2E2H A;  3CF2 A;  2PIC A;  3ZJU A;  1G8J A;  3GTK A;  2VUM A;  5ERG B;  3GTQ A;  1PT0 A;  1PYQ A;  1EU1 A;  3GTM A;  3CQZ A;  3PLX B;  3GTO A;  3O5A A;  2V3V A;  2LW6 A;  5CD1 A;  2VPW A;  1PPY A;  1ZYR D;  3IR7 A;  4AYB A;  2YVL A;  1CZ4 A;  4AON B;  3HU3 A;  2DMR A;  2JIR A;  1Y1V A;  1PT1 A;  2MM2 A;  4FIB A;  1TWC A;  4ARI A;  1UHD A;  5FTJ A;  3QC8 A;  2R92 A;  1I3Q A;  1Y5I A;  2NAP A;  3ZJV A;  1H0H A;  2GF7 A;  5DYG A;  4UC4 A;  2PWY A;  1VC3 B;  3OUG A;  2JIQ A;  2C45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...