1CZ5A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
185
structure length
185
Chain Sequence
MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords VCP-LIKE ATPASE
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 23
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz5A02
3OUGA 1E5VA 2YU9A 1Y1WA 1CR5A 2VPWA 1AA6A 1R7RA 4AZDA 2VPXA 4KLNA 3QWZA 1Y4ZA 5T5ID 3GTKA 1YLEA 1UHDA 4RV0A 3DMRA 5FTMA 1EU1A 2WB1A 1VC3B 1UHEA 1FDIA 1PYQA 1E61A 1TWAA 5GLFA 3GTPA 2NVXA 5B6CA 1IW7D 5T5MD 1QDNA 5FTJA 3QQ8A 2E2HA 2JIPA 1SIWA 2R92A 1H0HA 4D7ZB 3FKIA 3IR7A 1E18A 1TWFA 4CRZA 3CF2A 5DYGA 1KQGA 2B63A 1SFOA 1G8JA 3GTLA 2IV2X 3GTGA 2JIMA 5C1BA 1TMOA 3CQZA 3GTQA 1KQFA 2PJHB 3GTJA 2JIRA 1TWGA 1PQFA 2VUMA 3O5AA 1R27A 1E32A 1WLFA 4GA5A 5FTKA 1K83A 1CZ4A 2E7ZA 3GTOA 2KI8A 1Y5IA 3IR6A 3HKZA 3GTMA 1Q16A 2DMRA 1TWHA 3IR5A 4GA6A 4KO8A 3HU3A 1H5NA 5C18A 2Y0SA 1AW8B 3H0GA 4DMRA 1ZC1A 2PMZA 1I3QA 2R7ZA 1I50A 3TM7B 2YUJA 1E60A 3TIWA 4KDLA 4AAYA 1PT1A 2VPYA 2NAPA 4KODA 1R9TA 3PLXB 2JIQA 1CZ5A 4QIWA 4AONB 3ML1A 1PT0A 5FTNA 1FDOA 1PQEA 1PPYA 2JIOA 2VPZA 2NVYA 2JV2A 5DYIA 1PQHA 1S3SA 1OGYA 1QCSA 2JA6A 4CRYG 4C2MA 5EPPA 4AYBA 1DMSA 1TWCA 2C45A 1PYUB 2V45A 3HU1A 3QQ7A 2E2IA 3HU2A 5FTLA 2EEOB 1G8KA 2V3VA 2R93A 2NYAA 2JA7A 2WAQA 2JA5A 4AOKB 1DMRA 1Y1VA 4CS0A 1WCMA 4KDIA 3QC8A
chains in the Genus database with same CATH superfamily
4L48A 3OUGA 1E5VA 2YU9A 1Y1WA 1CR5A 2VPWA 1AA6A 3X2GA 1R7RA 4AZDA 2VPXA 4KLNA 3QWZA 1Y4ZA 2G5DA 5T5ID 2PICA 2HCZX 1YLEA 1UHDA 3GTKA 1L8FA 4ZM7A 3FPTA 4RV0A 3DMRA 5FTMA 5D6YA 1EU1A 2WB1A 4FG2A 5GLYA 5CCBA 1VC3B 5H4UA 1UHEA 3CZBA 1FDIA 1PYQA 1E61A 2PNWA 1TWAA 2Q1CX 2QQRA 3M3GA 5GLFA 3GTPA 2NVXA 5B6CA 5CD1A 1IW7D 5T5MD 1QDNA 3ZJTA 2AE0X 3QQ8A 5FTJA 2JIPA 2E2HA 1SIWA 2PJJA 4ARIA 1SMYD 4JP7A 2R92A 1H0HA 3LGAA 4D7ZB 3FKIA 3IR7A 1E18A 1TWFA 4CRZA 2G6GA 3CF2A 5DYGA 1KQGA 2GFAA 2B63A 1SFOA 1G8JA 4AVRA 3GTLA 2IV2X 3X2MA 3GTGA 2PWYA 2JIMA 3SUKA 1N10A 5C1BA 2Q18X 1TMOA 4ENGA 4FG4A 3CQZA 3GTQA 3X2OA 1KQFA 2PJHB 3GTJA 2JIRA 2MM0A 1TWGA 1PQFA 5GM9A 2VUMA 5CCXA 3O5AA 5EQJB 1I9GA 1R27A 1E32A 1WLFA 4GA5A 5FTKA 1K83A 3MB5A 3ZJUA 1CZ4A 2E7ZA 3X2IA 3GTOA 2KI8A 3BQBA 1O54A 1Y5IA 1BW3A 5ERGB 3IR6A 3HKZA 3GTMA 1Q16A 2YVLA 3FPRA 2DMRA 1TWHA 3IR5A 3ENGA 4GA6A 3D30A 4KO8A 3HU3A 1H5NA 5C18A 2Y0SA 1AW8B 3H0GA 4DMRA 2QQSA 1ZC1A 2A69D 4FERA 2PMZA 3X2JA 4JCWA 1I3QA 2R7ZA 1I50A 3X2KA 3TM7B 2YUJA 1YNND 1BW4A 1E60A 2KY9A 3TIWA 4KDLA 2B25A 4AAYA 1PT1A 2VPYA 2NAPA 4KODA 1R9TA 1WC2A 1ZYRD 2JIQA 3PLXB 1CZ5A 2Q1DX 2A6ED 4AQ7A 4QIWA 2MM2A 4AONB 3ML1A 1PT0A 5GLXA 4CQNA 2Q19X 5FTNA 4ARCA 1FDOA 1PQEA 1PPYA 2KQAA 3ZJVA 3X2HA 2JIOA 3LHDA 2VPZA 2NVYA 2JV2A 2PI8A 2A68D 5DYIA 3X2NA 4AS1A 1PQHA 3SULA 1S3SA 2XDPA 4JJOA 1OGYA 1QCSA 2JA6A 4CRYG 2GF7A 4C2MA 3FPUA 5EPPA 4AYBA 4FIBA 1DMSA 1TWCA 2C45A 1OA9A 2GAEA 1PYUB 2O5JD 3SUJA 3X2LA 5D6XA 2V45A 3HU1A 5D6WA 2BH0A 4JS7A 3QQ7A 2E2IA 4NOHA 3HU2A 2CW0D 3SUMA 4JP6A 5FTLA 2EEOB 3X2PA 1G8KA 2V3VA 2R93A 2BE5D 2A6HD 4UC4A 2NYAA 2JA7A 3ZGZA 2ENGA 2WAQA 2LW6A 4FFTA 2JA5A 4AOKB 2Q1AX 1DMRA 1Y1VA 1HD5A 4CS0A 1YNJD 1WCMA 4KDIA 3QC8A 1OA7A
chains in the Genus database with same CATH topology
3OUGA 1E5VA 2YU9A 1Y1WA 1CR5A 2VPWA 1AA6A 1R7RA 4AZDA 2VPXA 4KLNA 3QWZA 1Y4ZA 2G5DA 5T5ID 2PICA 3GTKA 1YLEA 1UHDA 3FPTA 4RV0A 3DMRA 5FTMA 5D6YA 1EU1A 2WB1A 5CCBA 1VC3B 1UHEA 3CZBA 1FDIA 1PYQA 1E61A 2PNWA 1TWAA 2Q1CX 2QQRA 5GLFA 3GTPA 2NVXA 5B6CA 5CD1A 1IW7D 5T5MD 1QDNA 3ZJTA 2AE0X 3QQ8A 5FTJA 2JIPA 2E2HA 1SIWA 2PJJA 4ARIA 1SMYD 2R92A 1H0HA 3LGAA 4D7ZB 3FKIA 3IR7A 1E18A 1TWFA 4CRZA 2G6GA 3CF2A 5DYGA 1KQGA 2GFAA 2B63A 1SFOA 1G8JA 3GTLA 2IV2X 3GTGA 2PWYA 2JIMA 5C1BA 2Q18X 1TMOA 3CQZA 3GTQA 1KQFA 2PJHB 3GTJA 2JIRA 2MM0A 1TWGA 1PQFA 2VUMA 5CCXA 3O5AA 5EQJB 1I9GA 1R27A 1E32A 1WLFA 4GA5A 5FTKA 1K83A 3MB5A 3ZJUA 1CZ4A 2E7ZA 3GTOA 2KI8A 3BQBA 1O54A 1Y5IA 5ERGB 3IR6A 3HKZA 3GTMA 1Q16A 2YVLA 3FPRA 2DMRA 1TWHA 3IR5A 4GA6A 4KO8A 3HU3A 1H5NA 5C18A 2Y0SA 1AW8B 3H0GA 4DMRA 2QQSA 1ZC1A 2A69D 2PMZA 1I3QA 2R7ZA 1I50A 3TM7B 2YUJA 1YNND 1E60A 2KY9A 3TIWA 4KDLA 2B25A 4AAYA 1PT1A 2VPYA 2NAPA 4KODA 1R9TA 3PLXB 1ZYRD 2JIQA 1CZ5A 2Q1DX 4AQ7A 2A6ED 4QIWA 2MM2A 4AONB 3ML1A 1PT0A 4CQNA 2Q19X 5FTNA 4ARCA 1FDOA 1PQEA 1PPYA 3ZJVA 2JIOA 3LHDA 2VPZA 2NVYA 2JV2A 2PI8A 2A68D 5DYIA 4AS1A 1PQHA 1S3SA 2XDPA 1OGYA 1QCSA 2JA6A 4CRYG 2GF7A 4C2MA 3FPUA 5EPPA 4AYBA 4FIBA 1DMSA 1TWCA 2C45A 2GAEA 1PYUB 2O5JD 5D6XA 2V45A 3HU1A 5D6WA 3QQ7A 2E2IA 4NOHA 3HU2A 2CW0D 5FTLA 2EEOB 1G8KA 2V3VA 2R93A 2BE5D 2A6HD 4UC4A 2NYAA 2JA7A 3ZGZA 2WAQA 2LW6A 2JA5A 4AOKB 2Q1AX 1DMRA 1Y1VA 4CS0A 1YNJD 1WCMA 4KDIA 3QC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUG A;  1E5V A;  2YU9 A;  1Y1W A;  1CR5 A;  2VPW A;  1AA6 A;  1R7R A;  4AZD A;  2VPX A;  4KLN A;  3QWZ A;  1Y4Z A;  5T5I D;  3GTK A;  1YLE A;  1UHD A;  4RV0 A;  3DMR A;  5FTM A;  1EU1 A;  2WB1 A;  1VC3 B;  1UHE A;  1FDI A;  1PYQ A;  1E61 A;  1TWA A;  5GLF A;  3GTP A;  2NVX A;  5B6C A;  1IW7 D;  5T5M D;  1QDN A;  5FTJ A;  3QQ8 A;  2E2H A;  2JIP A;  1SIW A;  2R92 A;  1H0H A;  4D7Z B;  3FKI A;  3IR7 A;  1E18 A;  1TWF A;  4CRZ A;  3CF2 A;  5DYG A;  1KQG A;  2B63 A;  1SFO A;  1G8J A;  3GTL A;  2IV2 X;  3GTG A;  2JIM A;  5C1B A;  1TMO A;  3CQZ A;  3GTQ A;  1KQF A;  2PJH B;  3GTJ A;  2JIR A;  1TWG A;  1PQF A;  2VUM A;  3O5A A;  1R27 A;  1E32 A;  1WLF A;  4GA5 A;  5FTK A;  1K83 A;  1CZ4 A;  2E7Z A;  3GTO A;  2KI8 A;  1Y5I A;  3IR6 A;  3HKZ A;  3GTM A;  1Q16 A;  2DMR A;  1TWH A;  3IR5 A;  4GA6 A;  4KO8 A;  3HU3 A;  1H5N A;  5C18 A;  2Y0S A;  1AW8 B;  3H0G A;  4DMR A;  1ZC1 A;  2PMZ A;  1I3Q A;  2R7Z A;  1I50 A;  3TM7 B;  2YUJ A;  1E60 A;  3TIW A;  4KDL A;  4AAY A;  1PT1 A;  2VPY A;  2NAP A;  4KOD A;  1R9T A;  3PLX B;  2JIQ A;  1CZ5 A;  4QIW A;  4AON B;  3ML1 A;  1PT0 A;  5FTN A;  1FDO A;  1PQE A;  1PPY A;  2JIO A;  2VPZ A;  2NVY A;  2JV2 A;  5DYI A;  1PQH A;  1S3S A;  1OGY A;  1QCS A;  2JA6 A;  4CRY G;  4C2M A;  5EPP A;  4AYB A;  1DMS A;  1TWC A;  2C45 A;  1PYU B;  2V45 A;  3HU1 A;  3QQ7 A;  2E2I A;  3HU2 A;  5FTL A;  2EEO B;  1G8K A;  2V3V A;  2R93 A;  2NYA A;  2JA7 A;  2WAQ A;  2JA5 A;  4AOK B;  1DMR A;  1Y1V A;  4CS0 A;  1WCM A;  4KDI A;  3QC8 A; 
#chains in the Genus database with same CATH topology
 4L48 A;  3OUG A;  1E5V A;  2YU9 A;  1Y1W A;  1CR5 A;  2VPW A;  1AA6 A;  3X2G A;  1R7R A;  4AZD A;  2VPX A;  4KLN A;  3QWZ A;  1Y4Z A;  2G5D A;  5T5I D;  2PIC A;  2HCZ X;  1YLE A;  1UHD A;  3GTK A;  1L8F A;  4ZM7 A;  3FPT A;  4RV0 A;  3DMR A;  5FTM A;  5D6Y A;  1EU1 A;  2WB1 A;  4FG2 A;  5GLY A;  5CCB A;  1VC3 B;  5H4U A;  1UHE A;  3CZB A;  1FDI A;  1PYQ A;  1E61 A;  2PNW A;  1TWA A;  2Q1C X;  2QQR A;  3M3G A;  5GLF A;  3GTP A;  2NVX A;  5B6C A;  5CD1 A;  1IW7 D;  5T5M D;  1QDN A;  3ZJT A;  2AE0 X;  3QQ8 A;  5FTJ A;  2JIP A;  2E2H A;  1SIW A;  2PJJ A;  4ARI A;  1SMY D;  4JP7 A;  2R92 A;  1H0H A;  3LGA A;  4D7Z B;  3FKI A;  3IR7 A;  1E18 A;  1TWF A;  4CRZ A;  2G6G A;  3CF2 A;  5DYG A;  1KQG A;  2GFA A;  2B63 A;  1SFO A;  1G8J A;  4AVR A;  3GTL A;  2IV2 X;  3X2M A;  3GTG A;  2PWY A;  2JIM A;  3SUK A;  1N10 A;  5C1B A;  2Q18 X;  1TMO A;  4ENG A;  4FG4 A;  3CQZ A;  3GTQ A;  3X2O A;  1KQF A;  2PJH B;  3GTJ A;  2JIR A;  2MM0 A;  1TWG A;  1PQF A;  5GM9 A;  2VUM A;  5CCX A;  3O5A A;  5EQJ B;  1I9G A;  1R27 A;  1E32 A;  1WLF A;  4GA5 A;  5FTK A;  1K83 A;  3MB5 A;  3ZJU A;  1CZ4 A;  2E7Z A;  3X2I A;  3GTO A;  2KI8 A;  3BQB A;  1O54 A;  1Y5I A;  1BW3 A;  5ERG B;  3IR6 A;  3HKZ A;  3GTM A;  1Q16 A;  2YVL A;  3FPR A;  2DMR A;  1TWH A;  3IR5 A;  3ENG A;  4GA6 A;  3D30 A;  4KO8 A;  3HU3 A;  1H5N A;  5C18 A;  2Y0S A;  1AW8 B;  3H0G A;  4DMR A;  2QQS A;  1ZC1 A;  2A69 D;  4FER A;  2PMZ A;  3X2J A;  4JCW A;  1I3Q A;  2R7Z A;  1I50 A;  3X2K A;  3TM7 B;  2YUJ A;  1YNN D;  1BW4 A;  1E60 A;  2KY9 A;  3TIW A;  4KDL A;  2B25 A;  4AAY A;  1PT1 A;  2VPY A;  2NAP A;  4KOD A;  1R9T A;  1WC2 A;  1ZYR D;  2JIQ A;  3PLX B;  1CZ5 A;  2Q1D X;  2A6E D;  4AQ7 A;  4QIW A;  2MM2 A;  4AON B;  3ML1 A;  1PT0 A;  5GLX A;  4CQN A;  2Q19 X;  5FTN A;  4ARC A;  1FDO A;  1PQE A;  1PPY A;  2KQA A;  3ZJV A;  3X2H A;  2JIO A;  3LHD A;  2VPZ A;  2NVY A;  2JV2 A;  2PI8 A;  2A68 D;  5DYI A;  3X2N A;  4AS1 A;  1PQH A;  3SUL A;  1S3S A;  2XDP A;  4JJO A;  1OGY A;  1QCS A;  2JA6 A;  4CRY G;  2GF7 A;  4C2M A;  3FPU A;  5EPP A;  4AYB A;  4FIB A;  1DMS A;  1TWC A;  2C45 A;  1OA9 A;  2GAE A;  1PYU B;  2O5J D;  3SUJ A;  3X2L A;  5D6X A;  2V45 A;  3HU1 A;  5D6W A;  2BH0 A;  4JS7 A;  3QQ7 A;  2E2I A;  4NOH A;  3HU2 A;  2CW0 D;  3SUM A;  4JP6 A;  5FTL A;  2EEO B;  3X2P A;  1G8K A;  2V3V A;  2R93 A;  2BE5 D;  2A6H D;  4UC4 A;  2NYA A;  2JA7 A;  3ZGZ A;  2ENG A;  2WAQ A;  2LW6 A;  4FFT A;  2JA5 A;  4AOK B;  2Q1A X;  1DMR A;  1Y1V A;  1HD5 A;  4CS0 A;  1YNJ D;  1WCM A;  4KDI A;  3QC8 A;  1OA7 A; 
#chains in the Genus database with same CATH homology
 3OUG A;  1E5V A;  2YU9 A;  1Y1W A;  1CR5 A;  2VPW A;  1AA6 A;  1R7R A;  4AZD A;  2VPX A;  4KLN A;  3QWZ A;  1Y4Z A;  2G5D A;  5T5I D;  2PIC A;  3GTK A;  1YLE A;  1UHD A;  3FPT A;  4RV0 A;  3DMR A;  5FTM A;  5D6Y A;  1EU1 A;  2WB1 A;  5CCB A;  1VC3 B;  1UHE A;  3CZB A;  1FDI A;  1PYQ A;  1E61 A;  2PNW A;  1TWA A;  2Q1C X;  2QQR A;  5GLF A;  3GTP A;  2NVX A;  5B6C A;  5CD1 A;  1IW7 D;  5T5M D;  1QDN A;  3ZJT A;  2AE0 X;  3QQ8 A;  5FTJ A;  2JIP A;  2E2H A;  1SIW A;  2PJJ A;  4ARI A;  1SMY D;  2R92 A;  1H0H A;  3LGA A;  4D7Z B;  3FKI A;  3IR7 A;  1E18 A;  1TWF A;  4CRZ A;  2G6G A;  3CF2 A;  5DYG A;  1KQG A;  2GFA A;  2B63 A;  1SFO A;  1G8J A;  3GTL A;  2IV2 X;  3GTG A;  2PWY A;  2JIM A;  5C1B A;  2Q18 X;  1TMO A;  3CQZ A;  3GTQ A;  1KQF A;  2PJH B;  3GTJ A;  2JIR A;  2MM0 A;  1TWG A;  1PQF A;  2VUM A;  5CCX A;  3O5A A;  5EQJ B;  1I9G A;  1R27 A;  1E32 A;  1WLF A;  4GA5 A;  5FTK A;  1K83 A;  3MB5 A;  3ZJU A;  1CZ4 A;  2E7Z A;  3GTO A;  2KI8 A;  3BQB A;  1O54 A;  1Y5I A;  5ERG B;  3IR6 A;  3HKZ A;  3GTM A;  1Q16 A;  2YVL A;  3FPR A;  2DMR A;  1TWH A;  3IR5 A;  4GA6 A;  4KO8 A;  3HU3 A;  1H5N A;  5C18 A;  2Y0S A;  1AW8 B;  3H0G A;  4DMR A;  2QQS A;  1ZC1 A;  2A69 D;  2PMZ A;  1I3Q A;  2R7Z A;  1I50 A;  3TM7 B;  2YUJ A;  1YNN D;  1E60 A;  2KY9 A;  3TIW A;  4KDL A;  2B25 A;  4AAY A;  1PT1 A;  2VPY A;  2NAP A;  4KOD A;  1R9T A;  3PLX B;  1ZYR D;  2JIQ A;  1CZ5 A;  2Q1D X;  4AQ7 A;  2A6E D;  4QIW A;  2MM2 A;  4AON B;  3ML1 A;  1PT0 A;  4CQN A;  2Q19 X;  5FTN A;  4ARC A;  1FDO A;  1PQE A;  1PPY A;  3ZJV A;  2JIO A;  3LHD A;  2VPZ A;  2NVY A;  2JV2 A;  2PI8 A;  2A68 D;  5DYI A;  4AS1 A;  1PQH A;  1S3S A;  2XDP A;  1OGY A;  1QCS A;  2JA6 A;  4CRY G;  2GF7 A;  4C2M A;  3FPU A;  5EPP A;  4AYB A;  4FIB A;  1DMS A;  1TWC A;  2C45 A;  2GAE A;  1PYU B;  2O5J D;  5D6X A;  2V45 A;  3HU1 A;  5D6W A;  3QQ7 A;  2E2I A;  4NOH A;  3HU2 A;  2CW0 D;  5FTL A;  2EEO B;  1G8K A;  2V3V A;  2R93 A;  2BE5 D;  2A6H D;  4UC4 A;  2NYA A;  2JA7 A;  3ZGZ A;  2WAQ A;  2LW6 A;  2JA5 A;  4AOK B;  2Q1A X;  1DMR A;  1Y1V A;  4CS0 A;  1YNJ D;  1WCM A;  4KDI A;  3QC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...