1CZ5A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
185
structure length
185
Chain Sequence
b'MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VCP-LIKE ATPASE
molecule tags Hydrolase
source organism Thermoplasma acidophilum
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
total genus 23
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz5A02
5B6CA 1SIWA 3HU1A 3TIWA 3HKZA 5FTJA 1K83A 1R9TA 1QDNA 1TMOA 1PYUB 2EEOB 1E32A 4KODA 2KI8A 2JA7A 3QQ8A 1ZC1A 1EU1A 1PT0A 4CRZA 2E2IA 2PJHB 1YLEA 2PMZA 1OGYA 2NYAA 1VC3B 5DYIA 3DMRA 2B63A 3GTLA 2YUJA 5FTNA 2DMRA 2JIQA 1PYQA 1WCMA 2VPWA 4KDIA 2E2HA 3QC8A 4D7ZB 1PPYA 2JIRA 4GA6A 3H0GA 1Y5IA 1UHEA 4GA5A 1FDIA 2VPYA 5FTMA 4AONB 5FTKA 5FTLA 3GTGA 3GTKA 5T5MD 2JA6A 5C1BA 2Y0SA 1SFOA 1AW8B 3ML1A 3HU2A 4KO8A 3GTOA 2NVXA 1CZ5A 1KQGA 2C45A 1CZ4A 1Y1VA 1R7RA 1S3SA 1PQEA 1I3QA 1E18A 4CRYG 3O5AA 2WAQA 3TM7B 3GTMA 2NAPA 1DMRA 1TWGA 1TWCA 3GTPA 1G8KA 1PT1A 3QWZA 4CS0A 3QQ7A 1CR5A 4RV0A 2NVYA 2JV2A 2JIPA 2VPXA 1KQFA 1E5VA 1UHDA 2R93A 1E61A 4AYBA 2JIMA 1H0HA 2V45A 1TWAA 2E7ZA 1Y1WA 2WB1A 1R27A 2V3VA 2YU9A 2JA5A 4KLNA 4AZDA 2R92A 1G8JA 3PLXB 5DYGA 1TWFA 1FDOA 1WLFA 1TWHA 1PQFA 1IW7D 3IR5A 2JIOA 3CQZA 4QIWA 2IV2X 4KDLA 3CF2A 1H5NA 1DMSA 2VPZA 3GTJA 3GTQA 1I50A 4AAYA 5T5ID 1AA6A 5GLFA 3OUGA 1QCSA 3HU3A 4C2MA 1E60A 4DMRA 3FKIA 5EPPA 4AOKB 5C18A 1Q16A 3IR6A 1PQHA 3IR7A 2VUMA 2R7ZA 1Y4ZA
chains in the Genus database with same CATH superfamily
5B6CA 1SIWA 3HU1A 2A6HD 3X2JA 3TIWA 3HKZA 5FTJA 2G5DA 1K83A 1R9TA 1QDNA 1TMOA 3LGAA 4NOHA 1PYUB 4JS7A 2EEOB 1E32A 5GLYA 4CQNA 3ZJUA 4KODA 2KI8A 2JA7A 3QQ8A 1ZC1A 1EU1A 1PT0A 1YNND 4CRZA 2PJHB 2E2IA 1YLEA 3X2GA 2PMZA 1OGYA 2NYAA 2PWYA 2Q1AX 2ENGA 4FERA 2GFAA 1VC3B 3D30A 5DYIA 3DMRA 2G6GA 2B63A 1WC2A 3SUKA 4AVRA 3GTLA 2GAEA 2YUJA 3ENGA 5FTNA 2DMRA 2JIQA 1PYQA 1WCMA 2VPWA 4KDIA 4FG2A 2E2HA 3QC8A 4D7ZB 5ERGB 1PPYA 2JIRA 4GA6A 2YVLA 3H0GA 5D6YA 2PI8A 1Y5IA 1O54A 1UHEA 4GA5A 1FDIA 2VPYA 3FPTA 5FTMA 1BW3A 4AONB 2A68D 5FTKA 5FTLA 3GTGA 3GTKA 2QQSA 3ZGZA 5T5MD 5CCXA 2JA6A 5C1BA 2AE0X 4FG4A 2Y0SA 1SFOA 5H4UA 1L8FA 1AW8B 3ML1A 3HU2A 4KO8A 3GTOA 5EQJB 2NVXA 2A69D 1CZ5A 4FFTA 2O5JD 1KQGA 2C45A 3X2KA 1CZ4A 1Y1VA 5D6XA 1R7RA 1S3SA 1PQEA 1I3QA 1E18A 2A6ED 3BQBA 4CRYG 2KQAA 3O5AA 2WAQA 3SUMA 3TM7B 3GTMA 5CD1A 2QQRA 2NAPA 1DMRA 3LHDA 1TWGA 1TWCA 4ARIA 3ZJVA 3GTPA 2XDPA 3X2NA 1BW4A 1G8KA 1PT1A 2PJJA 4AS1A 3QWZA 4CS0A 3QQ7A 4L48A 1CR5A 4RV0A 2BE5D 2NVYA 2JV2A 2JIPA 2VPXA 4JCWA 4AQ7A 1KQFA 4ENGA 1E5VA 1UHDA 2R93A 1E61A 4UC4A 1N10A 4AYBA 4JP7A 2JIMA 1H0HA 2V45A 2E7ZA 1HD5A 1SMYD 1TWAA 1Y1WA 2WB1A 1R27A 2V3VA 2YU9A 2JA5A 4KLNA 1ZYRD 4AZDA 2R92A 3ZJTA 1G8JA 3PLXB 4ARCA 2PNWA 4JJOA 3M3GA 5DYGA 3X2MA 3X2PA 2MM2A 1TWFA 1FDOA 1WLFA 1TWHA 1PQFA 5GM9A 2LW6A 1IW7D 3IR5A 3FPUA 2JIOA 3CQZA 3X2IA 2Q1CX 4QIWA 2IV2X 1I9GA 5GLXA 4KDLA 3FPRA 2Q19X 5D6WA 3MB5A 3CF2A 1H5NA 1DMSA 3X2OA 2VPZA 3CZBA 3GTJA 3X2LA 3GTQA 1I50A 2GF7A 4AAYA 5T5ID 1AA6A 3SULA 5GLFA 1YNJD 3OUGA 1QCSA 3HU3A 4FIBA 4JP6A 1E60A 2HCZX 3X2HA 3FKIA 5EPPA 4DMRA 4C2MA 2KY9A 2MM0A 4AOKB 5CCBA 3SUJA 1OA7A 5C18A 1Q16A 3IR6A 2B25A 1PQHA 2PICA 3IR7A 4ZM7A 2CW0D 2VUMA 2Q18X 2Q1DX 2BH0A 2R7ZA 1OA9A 1Y4ZA
chains in the Genus database with same CATH topology
5B6CA 1SIWA 3HU1A 2A6HD 3TIWA 3HKZA 5FTJA 2G5DA 1K83A 1R9TA 1QDNA 1TMOA 3LGAA 4NOHA 1PYUB 4CQNA 2EEOB 1E32A 3ZJUA 4KODA 2KI8A 2JA7A 3QQ8A 1ZC1A 1EU1A 1PT0A 1YNND 4CRZA 2PJHB 2E2IA 1YLEA 2PMZA 1OGYA 2NYAA 2PWYA 2Q1AX 2GFAA 1VC3B 5DYIA 3DMRA 2G6GA 2B63A 3GTLA 2GAEA 2YUJA 5FTNA 2DMRA 2JIQA 1PYQA 1WCMA 2VPWA 4KDIA 2E2HA 3QC8A 4D7ZB 5ERGB 1PPYA 2JIRA 4GA6A 2YVLA 3H0GA 5D6YA 2PI8A 1Y5IA 1O54A 1UHEA 4GA5A 1FDIA 2VPYA 3FPTA 5FTMA 4AONB 2A68D 5FTKA 5FTLA 3GTGA 3GTKA 2QQSA 3ZGZA 5T5MD 5CCXA 2JA6A 5C1BA 2AE0X 2Y0SA 1SFOA 1AW8B 3ML1A 3HU2A 4KO8A 3GTOA 5EQJB 2NVXA 2A69D 1CZ5A 2O5JD 1KQGA 2C45A 1CZ4A 1Y1VA 5D6XA 1R7RA 1S3SA 1PQEA 1I3QA 1E18A 2A6ED 3BQBA 4CRYG 3O5AA 2WAQA 3TM7B 3GTMA 5CD1A 2QQRA 2NAPA 1DMRA 3LHDA 1TWGA 1TWCA 4ARIA 3ZJVA 3GTPA 2XDPA 1G8KA 1PT1A 2PJJA 4AS1A 3QWZA 4CS0A 3QQ7A 1CR5A 4RV0A 2BE5D 2NVYA 2JV2A 2JIPA 2VPXA 4AQ7A 1KQFA 1E5VA 1UHDA 2R93A 1E61A 4UC4A 4AYBA 2JIMA 1H0HA 2V45A 1SMYD 1TWAA 2E7ZA 1Y1WA 2WB1A 1R27A 2V3VA 2YU9A 2JA5A 4KLNA 1ZYRD 4AZDA 2R92A 3ZJTA 1G8JA 3PLXB 4ARCA 2PNWA 5DYGA 2MM2A 1TWFA 1FDOA 1WLFA 1TWHA 1PQFA 2LW6A 3FPUA 1IW7D 3IR5A 2JIOA 3CQZA 2Q1CX 4QIWA 2IV2X 1I9GA 4KDLA 3FPRA 2Q19X 5D6WA 3MB5A 3CF2A 1H5NA 1DMSA 2VPZA 3CZBA 3GTJA 3GTQA 2GF7A 1I50A 4AAYA 5T5ID 1AA6A 5GLFA 1YNJD 3OUGA 1QCSA 3HU3A 4FIBA 4C2MA 1E60A 4DMRA 2MM0A 3FKIA 5EPPA 2KY9A 4AOKB 5CCBA 5C18A 1Q16A 3IR6A 2B25A 1PQHA 2PICA 3IR7A 2VUMA 2CW0D 2Q1DX 2Q18X 2R7ZA 1Y4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6C A;  1SIW A;  3HU1 A;  3TIW A;  3HKZ A;  5FTJ A;  1K83 A;  1R9T A;  1QDN A;  1TMO A;  1PYU B;  2EEO B;  1E32 A;  4KOD A;  2KI8 A;  2JA7 A;  3QQ8 A;  1ZC1 A;  1EU1 A;  1PT0 A;  4CRZ A;  2E2I A;  2PJH B;  1YLE A;  2PMZ A;  1OGY A;  2NYA A;  1VC3 B;  5DYI A;  3DMR A;  2B63 A;  3GTL A;  2YUJ A;  5FTN A;  2DMR A;  2JIQ A;  1PYQ A;  1WCM A;  2VPW A;  4KDI A;  2E2H A;  3QC8 A;  4D7Z B;  1PPY A;  2JIR A;  4GA6 A;  3H0G A;  1Y5I A;  1UHE A;  4GA5 A;  1FDI A;  2VPY A;  5FTM A;  4AON B;  5FTK A;  5FTL A;  3GTG A;  3GTK A;  5T5M D;  2JA6 A;  5C1B A;  2Y0S A;  1SFO A;  1AW8 B;  3ML1 A;  3HU2 A;  4KO8 A;  3GTO A;  2NVX A;  1CZ5 A;  1KQG A;  2C45 A;  1CZ4 A;  1Y1V A;  1R7R A;  1S3S A;  1PQE A;  1I3Q A;  1E18 A;  4CRY G;  3O5A A;  2WAQ A;  3TM7 B;  3GTM A;  2NAP A;  1DMR A;  1TWG A;  1TWC A;  3GTP A;  1G8K A;  1PT1 A;  3QWZ A;  4CS0 A;  3QQ7 A;  1CR5 A;  4RV0 A;  2NVY A;  2JV2 A;  2JIP A;  2VPX A;  1KQF A;  1E5V A;  1UHD A;  2R93 A;  1E61 A;  4AYB A;  2JIM A;  1H0H A;  2V45 A;  1TWA A;  2E7Z A;  1Y1W A;  2WB1 A;  1R27 A;  2V3V A;  2YU9 A;  2JA5 A;  4KLN A;  4AZD A;  2R92 A;  1G8J A;  3PLX B;  5DYG A;  1TWF A;  1FDO A;  1WLF A;  1TWH A;  1PQF A;  1IW7 D;  3IR5 A;  2JIO A;  3CQZ A;  4QIW A;  2IV2 X;  4KDL A;  3CF2 A;  1H5N A;  1DMS A;  2VPZ A;  3GTJ A;  3GTQ A;  1I50 A;  4AAY A;  5T5I D;  1AA6 A;  5GLF A;  3OUG A;  1QCS A;  3HU3 A;  4C2M A;  1E60 A;  4DMR A;  3FKI A;  5EPP A;  4AOK B;  5C18 A;  1Q16 A;  3IR6 A;  1PQH A;  3IR7 A;  2VUM A;  2R7Z A;  1Y4Z A; 
#chains in the Genus database with same CATH topology
 5B6C A;  1SIW A;  3HU1 A;  2A6H D;  3X2J A;  3TIW A;  3HKZ A;  5FTJ A;  2G5D A;  1K83 A;  1R9T A;  1QDN A;  1TMO A;  3LGA A;  4NOH A;  1PYU B;  4JS7 A;  2EEO B;  1E32 A;  5GLY A;  4CQN A;  3ZJU A;  4KOD A;  2KI8 A;  2JA7 A;  3QQ8 A;  1ZC1 A;  1EU1 A;  1PT0 A;  1YNN D;  4CRZ A;  2PJH B;  2E2I A;  1YLE A;  3X2G A;  2PMZ A;  1OGY A;  2NYA A;  2PWY A;  2Q1A X;  2ENG A;  4FER A;  2GFA A;  1VC3 B;  3D30 A;  5DYI A;  3DMR A;  2G6G A;  2B63 A;  1WC2 A;  3SUK A;  4AVR A;  3GTL A;  2GAE A;  2YUJ A;  3ENG A;  5FTN A;  2DMR A;  2JIQ A;  1PYQ A;  1WCM A;  2VPW A;  4KDI A;  4FG2 A;  2E2H A;  3QC8 A;  4D7Z B;  5ERG B;  1PPY A;  2JIR A;  4GA6 A;  2YVL A;  3H0G A;  5D6Y A;  2PI8 A;  1Y5I A;  1O54 A;  1UHE A;  4GA5 A;  1FDI A;  2VPY A;  3FPT A;  5FTM A;  1BW3 A;  4AON B;  2A68 D;  5FTK A;  5FTL A;  3GTG A;  3GTK A;  2QQS A;  3ZGZ A;  5T5M D;  5CCX A;  2JA6 A;  5C1B A;  2AE0 X;  4FG4 A;  2Y0S A;  1SFO A;  5H4U A;  1L8F A;  1AW8 B;  3ML1 A;  3HU2 A;  4KO8 A;  3GTO A;  5EQJ B;  2NVX A;  2A69 D;  1CZ5 A;  4FFT A;  2O5J D;  1KQG A;  2C45 A;  3X2K A;  1CZ4 A;  1Y1V A;  5D6X A;  1R7R A;  1S3S A;  1PQE A;  1I3Q A;  1E18 A;  2A6E D;  3BQB A;  4CRY G;  2KQA A;  3O5A A;  2WAQ A;  3SUM A;  3TM7 B;  3GTM A;  5CD1 A;  2QQR A;  2NAP A;  1DMR A;  3LHD A;  1TWG A;  1TWC A;  4ARI A;  3ZJV A;  3GTP A;  2XDP A;  3X2N A;  1BW4 A;  1G8K A;  1PT1 A;  2PJJ A;  4AS1 A;  3QWZ A;  4CS0 A;  3QQ7 A;  4L48 A;  1CR5 A;  4RV0 A;  2BE5 D;  2NVY A;  2JV2 A;  2JIP A;  2VPX A;  4JCW A;  4AQ7 A;  1KQF A;  4ENG A;  1E5V A;  1UHD A;  2R93 A;  1E61 A;  4UC4 A;  1N10 A;  4AYB A;  4JP7 A;  2JIM A;  1H0H A;  2V45 A;  2E7Z A;  1HD5 A;  1SMY D;  1TWA A;  1Y1W A;  2WB1 A;  1R27 A;  2V3V A;  2YU9 A;  2JA5 A;  4KLN A;  1ZYR D;  4AZD A;  2R92 A;  3ZJT A;  1G8J A;  3PLX B;  4ARC A;  2PNW A;  4JJO A;  3M3G A;  5DYG A;  3X2M A;  3X2P A;  2MM2 A;  1TWF A;  1FDO A;  1WLF A;  1TWH A;  1PQF A;  5GM9 A;  2LW6 A;  1IW7 D;  3IR5 A;  3FPU A;  2JIO A;  3CQZ A;  3X2I A;  2Q1C X;  4QIW A;  2IV2 X;  1I9G A;  5GLX A;  4KDL A;  3FPR A;  2Q19 X;  5D6W A;  3MB5 A;  3CF2 A;  1H5N A;  1DMS A;  3X2O A;  2VPZ A;  3CZB A;  3GTJ A;  3X2L A;  3GTQ A;  1I50 A;  2GF7 A;  4AAY A;  5T5I D;  1AA6 A;  3SUL A;  5GLF A;  1YNJ D;  3OUG A;  1QCS A;  3HU3 A;  4FIB A;  4JP6 A;  1E60 A;  2HCZ X;  3X2H A;  3FKI A;  5EPP A;  4DMR A;  4C2M A;  2KY9 A;  2MM0 A;  4AOK B;  5CCB A;  3SUJ A;  1OA7 A;  5C18 A;  1Q16 A;  3IR6 A;  2B25 A;  1PQH A;  2PIC A;  3IR7 A;  4ZM7 A;  2CW0 D;  2VUM A;  2Q18 X;  2Q1D X;  2BH0 A;  2R7Z A;  1OA9 A;  1Y4Z A; 
#chains in the Genus database with same CATH homology
 5B6C A;  1SIW A;  3HU1 A;  2A6H D;  3TIW A;  3HKZ A;  5FTJ A;  2G5D A;  1K83 A;  1R9T A;  1QDN A;  1TMO A;  3LGA A;  4NOH A;  1PYU B;  4CQN A;  2EEO B;  1E32 A;  3ZJU A;  4KOD A;  2KI8 A;  2JA7 A;  3QQ8 A;  1ZC1 A;  1EU1 A;  1PT0 A;  1YNN D;  4CRZ A;  2PJH B;  2E2I A;  1YLE A;  2PMZ A;  1OGY A;  2NYA A;  2PWY A;  2Q1A X;  2GFA A;  1VC3 B;  5DYI A;  3DMR A;  2G6G A;  2B63 A;  3GTL A;  2GAE A;  2YUJ A;  5FTN A;  2DMR A;  2JIQ A;  1PYQ A;  1WCM A;  2VPW A;  4KDI A;  2E2H A;  3QC8 A;  4D7Z B;  5ERG B;  1PPY A;  2JIR A;  4GA6 A;  2YVL A;  3H0G A;  5D6Y A;  2PI8 A;  1Y5I A;  1O54 A;  1UHE A;  4GA5 A;  1FDI A;  2VPY A;  3FPT A;  5FTM A;  4AON B;  2A68 D;  5FTK A;  5FTL A;  3GTG A;  3GTK A;  2QQS A;  3ZGZ A;  5T5M D;  5CCX A;  2JA6 A;  5C1B A;  2AE0 X;  2Y0S A;  1SFO A;  1AW8 B;  3ML1 A;  3HU2 A;  4KO8 A;  3GTO A;  5EQJ B;  2NVX A;  2A69 D;  1CZ5 A;  2O5J D;  1KQG A;  2C45 A;  1CZ4 A;  1Y1V A;  5D6X A;  1R7R A;  1S3S A;  1PQE A;  1I3Q A;  1E18 A;  2A6E D;  3BQB A;  4CRY G;  3O5A A;  2WAQ A;  3TM7 B;  3GTM A;  5CD1 A;  2QQR A;  2NAP A;  1DMR A;  3LHD A;  1TWG A;  1TWC A;  4ARI A;  3ZJV A;  3GTP A;  2XDP A;  1G8K A;  1PT1 A;  2PJJ A;  4AS1 A;  3QWZ A;  4CS0 A;  3QQ7 A;  1CR5 A;  4RV0 A;  2BE5 D;  2NVY A;  2JV2 A;  2JIP A;  2VPX A;  4AQ7 A;  1KQF A;  1E5V A;  1UHD A;  2R93 A;  1E61 A;  4UC4 A;  4AYB A;  2JIM A;  1H0H A;  2V45 A;  1SMY D;  1TWA A;  2E7Z A;  1Y1W A;  2WB1 A;  1R27 A;  2V3V A;  2YU9 A;  2JA5 A;  4KLN A;  1ZYR D;  4AZD A;  2R92 A;  3ZJT A;  1G8J A;  3PLX B;  4ARC A;  2PNW A;  5DYG A;  2MM2 A;  1TWF A;  1FDO A;  1WLF A;  1TWH A;  1PQF A;  2LW6 A;  3FPU A;  1IW7 D;  3IR5 A;  2JIO A;  3CQZ A;  2Q1C X;  4QIW A;  2IV2 X;  1I9G A;  4KDL A;  3FPR A;  2Q19 X;  5D6W A;  3MB5 A;  3CF2 A;  1H5N A;  1DMS A;  2VPZ A;  3CZB A;  3GTJ A;  3GTQ A;  2GF7 A;  1I50 A;  4AAY A;  5T5I D;  1AA6 A;  5GLF A;  1YNJ D;  3OUG A;  1QCS A;  3HU3 A;  4FIB A;  4C2M A;  1E60 A;  4DMR A;  2MM0 A;  3FKI A;  5EPP A;  2KY9 A;  4AOK B;  5CCB A;  5C18 A;  1Q16 A;  3IR6 A;  2B25 A;  1PQH A;  2PIC A;  3IR7 A;  2VUM A;  2CW0 D;  2Q1D X;  2Q18 X;  2R7Z A;  1Y4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...