1CZ5A

Nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
185
structure length
185
Chain Sequence
MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords VCP-LIKE ATPASE
total genus 23
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1cz5A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1cz5A02
1E5VA 1H0HA 5FTKA 2B63A 1IW7D 3IR5A 3CQZA 2EEOB 1E60A 3GTMA 1KQGA 3H0GA 1TWFA 4KODA 4AAYA 2IV2X 1G8KA 1TWGA 2R92A 1FDIA 1PPYA 1QDNA 2E7ZA 3IR6A 2JA7A 2YU9A 2KI8A 1TWHA 2NVXA 3GTGA 1Y1VA 3GTKA 5EPPA 1AW8B 2JV2A 1H5NA 1WLFA 3TM7B 5B6CA 3IR7A 3CF2A 2R7ZA 1CR5A 1R7RA 5FTJA 1Y4ZA 2PJHB 4AOKB 4CRYG 2WB1A 3FKIA 3ML1A 4CRZA 3DMRA 1R9TA 4C2MA 2NYAA 2JIOA 1Q16A 5FTNA 2DMRA 3QWZA 5C18A 4KLNA 2JIMA 1E32A 3QQ8A 5DYGA 3GTOA 1PQFA 2C45A 4RV0A 4AONB 1G8JA 3HU2A 5FTMA 1TMOA 2NAPA 2V3VA 4AYBA 5C1BA 1E18A 2YUJA 4KO8A 5GLFA 4CS0A 3OUGA 1PYUB 4DMRA 2VPYA 1AA6A 1WCMA 1SIWA 1SFOA 1YLEA 1UHDA 2JIPA 1KQFA 1OGYA 1PYQA 2VPZA 3HU1A 3HU3A 1PT0A 2JA5A 4GA5A 1EU1A 2V45A 5T5MD 2E2IA 2WAQA 2PMZA 1Y1WA 2JIQA 1PQEA 4KDIA 1I3QA 4GA6A 3GTPA 1I50A 1DMRA 4AZDA 5T5ID 3HKZA 3GTJA 1DMSA 1FDOA 1QCSA 1K83A 5DYIA 4KDLA 5FTLA 1PQHA 2NVYA 1UHEA 2VPWA 1S3SA 1Y5IA 1ZC1A 2VUMA 1VC3B 1PT1A 1E61A 2R93A 3PLXB 2E2HA 2VPXA 1CZ4A 1CZ5A 2JIRA 3O5AA 4D7ZB 1TWCA 1R27A 3QC8A 3QQ7A 1TWAA 3GTLA 4QIWA 2JA6A 3GTQA 2Y0SA 3TIWA
chains in the Genus database with same CATH superfamily
1E5VA 1H0HA 5FTKA 2B63A 2PWYA 1IW7D 3IR5A 3CQZA 4FFTA 2Q18X 2Q1DX 2EEOB 1O54A 4L48A 1E60A 2GAEA 3GTMA 3SUJA 3H0GA 1KQGA 1TWFA 4KODA 4AAYA 2IV2X 1G8KA 1OA7A 1TWGA 2R92A 1FDIA 1PPYA 1QDNA 2E7ZA 3IR6A 2JA7A 2YU9A 4UC4A 3X2HA 2KI8A 1TWHA 3ENGA 2NVXA 5CD1A 3GTGA 3X2NA 1Y1VA 3GTKA 5EPPA 1AW8B 3X2GA 2GF7A 2Q19X 2JV2A 1H5NA 1WLFA 3TM7B 2BH0A 5B6CA 2LW6A 2GFAA 3IR7A 2MM0A 1OA9A 2A69D 3X2JA 2Q1CX 3CF2A 2R7ZA 1CR5A 5GLYA 1R7RA 5FTJA 1Y4ZA 3SUKA 5D6YA 2A6ED 3FPTA 2PJHB 4AOKB 4CRYG 4ARCA 2WB1A 4ZM7A 3FKIA 3ML1A 4CRZA 3MB5A 3DMRA 1R9TA 4C2MA 2NYAA 2JIOA 2KQAA 1Q16A 3ZJTA 5FTNA 2DMRA 3QWZA 5C18A 4KLNA 2PICA 2JIMA 1E32A 3QQ8A 5DYGA 3GTOA 2PJJA 1PQFA 5H4UA 1L8FA 2C45A 2ENGA 4RV0A 4AONB 1G8JA 3HU2A 2KY9A 5FTMA 1TMOA 5D6WA 4AQ7A 3ZJVA 2NAPA 2V3VA 1I9GA 3FPRA 3FPUA 2QQRA 4AYBA 5C1BA 1E18A 1BW4A 2YUJA 4AS1A 4KO8A 5GLFA 2CW0D 5ERGB 4CS0A 3OUGA 2QQSA 4AVRA 1PYUB 4DMRA 3X2MA 3BQBA 2VPYA 1AA6A 3X2LA 2YVLA 2PNWA 4JP7A 1WCMA 4JS7A 1SIWA 1SFOA 5EQJB 1YLEA 1UHDA 1WC2A 2JIPA 1KQFA 1OGYA 1PYQA 2VPZA 3HU1A 3HU3A 1YNJD 1PT0A 2JA5A 5CCXA 4GA5A 1EU1A 2V45A 4FERA 5T5MD 4FG2A 2E2IA 2WAQA 2PMZA 2O5JD 3SULA 5CCBA 4NOHA 1Y1WA 2JIQA 3LGAA 1PQEA 3SUMA 4KDIA 3X2PA 4ARIA 1I3QA 1ZYRD 2G5DA 4GA6A 3GTPA 1I50A 1DMRA 4AZDA 5T5ID 1HD5A 3HKZA 3GTJA 4CQNA 1DMSA 1FDOA 3ZGZA 1QCSA 1K83A 5DYIA 4JCWA 5GM9A 2PI8A 4KDLA 3X2IA 5FTLA 1PQHA 2NVYA 3D30A 1UHEA 3CZBA 2Q1AX 1S3SA 1ZC1A 1Y5IA 2VPWA 4FG4A 2VUMA 1VC3B 1PT1A 2B25A 5D6XA 1E61A 3X2OA 1BW3A 3M3GA 2R93A 3PLXB 4JJOA 2AE0X 2VPXA 2E2HA 1CZ4A 1CZ5A 2JIRA 2HCZX 3O5AA 2G6GA 1TWCA 4JP6A 4D7ZB 4ENGA 1R27A 1SMYD 1N10A 2A68D 1TWAA 2BE5D 3QC8A 3QQ7A 5GLXA 3X2KA 2A6HD 4QIWA 3GTLA 1YNND 2JA6A 3GTQA 2MM2A 3LHDA 3ZJUA 2Y0SA 3TIWA 2XDPA 4FIBA
chains in the Genus database with same CATH topology
1E5VA 1H0HA 5FTKA 2B63A 2PWYA 1IW7D 3IR5A 3CQZA 2Q1DX 2Q18X 2EEOB 1O54A 1E60A 2GAEA 3GTMA 1KQGA 3H0GA 1TWFA 4KODA 4AAYA 2IV2X 1G8KA 1TWGA 2R92A 1FDIA 1PPYA 1QDNA 2E7ZA 3IR6A 2JA7A 2YU9A 4UC4A 2KI8A 1TWHA 2NVXA 5CD1A 3GTGA 1Y1VA 3GTKA 5EPPA 1AW8B 2GF7A 2Q19X 2JV2A 1H5NA 1WLFA 3TM7B 5B6CA 2LW6A 2GFAA 3IR7A 2A69D 2Q1CX 3CF2A 2R7ZA 1CR5A 1R7RA 5FTJA 1Y4ZA 5D6YA 2A6ED 3FPTA 2PJHB 4AOKB 4CRYG 4ARCA 2WB1A 3FKIA 3ML1A 4CRZA 3MB5A 3DMRA 1R9TA 4C2MA 2NYAA 2JIOA 1Q16A 3ZJTA 5FTNA 2DMRA 3QWZA 5C18A 4KLNA 2PICA 2JIMA 1E32A 3QQ8A 5DYGA 3GTOA 2PJJA 1PQFA 2C45A 4RV0A 4AONB 1G8JA 3HU2A 2KY9A 5FTMA 1TMOA 5D6WA 4AQ7A 3ZJVA 2NAPA 2V3VA 1I9GA 3FPRA 3FPUA 2QQRA 4AYBA 5C1BA 1E18A 2YUJA 4AS1A 4KO8A 5GLFA 2CW0D 5ERGB 4CS0A 3OUGA 2QQSA 1PYUB 4DMRA 3BQBA 2VPYA 1AA6A 2YVLA 2PNWA 1WCMA 1SIWA 1SFOA 5EQJB 1YLEA 1UHDA 2JIPA 1KQFA 1OGYA 1PYQA 2VPZA 3HU1A 3HU3A 1YNJD 1PT0A 2JA5A 5CCXA 4GA5A 1EU1A 2V45A 5T5MD 2E2IA 2WAQA 2PMZA 2O5JD 5CCBA 4NOHA 1Y1WA 2JIQA 3LGAA 1PQEA 4KDIA 4ARIA 1I3QA 1ZYRD 2G5DA 4GA6A 3GTPA 1I50A 1DMRA 4AZDA 5T5ID 4CQNA 3HKZA 3GTJA 1DMSA 1FDOA 3ZGZA 1QCSA 1K83A 5DYIA 2PI8A 4KDLA 5FTLA 1PQHA 2NVYA 1UHEA 3CZBA 2Q1AX 1S3SA 1ZC1A 1Y5IA 2VPWA 2VUMA 1VC3B 1PT1A 2B25A 5D6XA 1E61A 2R93A 3PLXB 2AE0X 2VPXA 2E2HA 1CZ4A 1CZ5A 2JIRA 3O5AA 4D7ZB 2G6GA 1TWCA 2MM0A 1R27A 1SMYD 2A68D 3QC8A 1TWAA 2BE5D 3QQ7A 2A6HD 4QIWA 3GTLA 1YNND 2JA6A 3GTQA 2MM2A 3LHDA 3ZJUA 2Y0SA 3TIWA 2XDPA 4FIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5V A;  1H0H A;  5FTK A;  2B63 A;  1IW7 D;  3IR5 A;  3CQZ A;  2EEO B;  1E60 A;  3GTM A;  1KQG A;  3H0G A;  1TWF A;  4KOD A;  4AAY A;  2IV2 X;  1G8K A;  1TWG A;  2R92 A;  1FDI A;  1PPY A;  1QDN A;  2E7Z A;  3IR6 A;  2JA7 A;  2YU9 A;  2KI8 A;  1TWH A;  2NVX A;  3GTG A;  1Y1V A;  3GTK A;  5EPP A;  1AW8 B;  2JV2 A;  1H5N A;  1WLF A;  3TM7 B;  5B6C A;  3IR7 A;  3CF2 A;  2R7Z A;  1CR5 A;  1R7R A;  5FTJ A;  1Y4Z A;  2PJH B;  4AOK B;  4CRY G;  2WB1 A;  3FKI A;  3ML1 A;  4CRZ A;  3DMR A;  1R9T A;  4C2M A;  2NYA A;  2JIO A;  1Q16 A;  5FTN A;  2DMR A;  3QWZ A;  5C18 A;  4KLN A;  2JIM A;  1E32 A;  3QQ8 A;  5DYG A;  3GTO A;  1PQF A;  2C45 A;  4RV0 A;  4AON B;  1G8J A;  3HU2 A;  5FTM A;  1TMO A;  2NAP A;  2V3V A;  4AYB A;  5C1B A;  1E18 A;  2YUJ A;  4KO8 A;  5GLF A;  4CS0 A;  3OUG A;  1PYU B;  4DMR A;  2VPY A;  1AA6 A;  1WCM A;  1SIW A;  1SFO A;  1YLE A;  1UHD A;  2JIP A;  1KQF A;  1OGY A;  1PYQ A;  2VPZ A;  3HU1 A;  3HU3 A;  1PT0 A;  2JA5 A;  4GA5 A;  1EU1 A;  2V45 A;  5T5M D;  2E2I A;  2WAQ A;  2PMZ A;  1Y1W A;  2JIQ A;  1PQE A;  4KDI A;  1I3Q A;  4GA6 A;  3GTP A;  1I50 A;  1DMR A;  4AZD A;  5T5I D;  3HKZ A;  3GTJ A;  1DMS A;  1FDO A;  1QCS A;  1K83 A;  5DYI A;  4KDL A;  5FTL A;  1PQH A;  2NVY A;  1UHE A;  2VPW A;  1S3S A;  1Y5I A;  1ZC1 A;  2VUM A;  1VC3 B;  1PT1 A;  1E61 A;  2R93 A;  3PLX B;  2E2H A;  2VPX A;  1CZ4 A;  1CZ5 A;  2JIR A;  3O5A A;  4D7Z B;  1TWC A;  1R27 A;  3QC8 A;  3QQ7 A;  1TWA A;  3GTL A;  4QIW A;  2JA6 A;  3GTQ A;  2Y0S A;  3TIW A; 
#chains in the Genus database with same CATH topology
 1E5V A;  1H0H A;  5FTK A;  2B63 A;  2PWY A;  1IW7 D;  3IR5 A;  3CQZ A;  4FFT A;  2Q18 X;  2Q1D X;  2EEO B;  1O54 A;  4L48 A;  1E60 A;  2GAE A;  3GTM A;  3SUJ A;  3H0G A;  1KQG A;  1TWF A;  4KOD A;  4AAY A;  2IV2 X;  1G8K A;  1OA7 A;  1TWG A;  2R92 A;  1FDI A;  1PPY A;  1QDN A;  2E7Z A;  3IR6 A;  2JA7 A;  2YU9 A;  4UC4 A;  3X2H A;  2KI8 A;  1TWH A;  3ENG A;  2NVX A;  5CD1 A;  3GTG A;  3X2N A;  1Y1V A;  3GTK A;  5EPP A;  1AW8 B;  3X2G A;  2GF7 A;  2Q19 X;  2JV2 A;  1H5N A;  1WLF A;  3TM7 B;  2BH0 A;  5B6C A;  2LW6 A;  2GFA A;  3IR7 A;  2MM0 A;  1OA9 A;  2A69 D;  3X2J A;  2Q1C X;  3CF2 A;  2R7Z A;  1CR5 A;  5GLY A;  1R7R A;  5FTJ A;  1Y4Z A;  3SUK A;  5D6Y A;  2A6E D;  3FPT A;  2PJH B;  4AOK B;  4CRY G;  4ARC A;  2WB1 A;  4ZM7 A;  3FKI A;  3ML1 A;  4CRZ A;  3MB5 A;  3DMR A;  1R9T A;  4C2M A;  2NYA A;  2JIO A;  2KQA A;  1Q16 A;  3ZJT A;  5FTN A;  2DMR A;  3QWZ A;  5C18 A;  4KLN A;  2PIC A;  2JIM A;  1E32 A;  3QQ8 A;  5DYG A;  3GTO A;  2PJJ A;  1PQF A;  5H4U A;  1L8F A;  2C45 A;  2ENG A;  4RV0 A;  4AON B;  1G8J A;  3HU2 A;  2KY9 A;  5FTM A;  1TMO A;  5D6W A;  4AQ7 A;  3ZJV A;  2NAP A;  2V3V A;  1I9G A;  3FPR A;  3FPU A;  2QQR A;  4AYB A;  5C1B A;  1E18 A;  1BW4 A;  2YUJ A;  4AS1 A;  4KO8 A;  5GLF A;  2CW0 D;  5ERG B;  4CS0 A;  3OUG A;  2QQS A;  4AVR A;  1PYU B;  4DMR A;  3X2M A;  3BQB A;  2VPY A;  1AA6 A;  3X2L A;  2YVL A;  2PNW A;  4JP7 A;  1WCM A;  4JS7 A;  1SIW A;  1SFO A;  5EQJ B;  1YLE A;  1UHD A;  1WC2 A;  2JIP A;  1KQF A;  1OGY A;  1PYQ A;  2VPZ A;  3HU1 A;  3HU3 A;  1YNJ D;  1PT0 A;  2JA5 A;  5CCX A;  4GA5 A;  1EU1 A;  2V45 A;  4FER A;  5T5M D;  4FG2 A;  2E2I A;  2WAQ A;  2PMZ A;  2O5J D;  3SUL A;  5CCB A;  4NOH A;  1Y1W A;  2JIQ A;  3LGA A;  1PQE A;  3SUM A;  4KDI A;  3X2P A;  4ARI A;  1I3Q A;  1ZYR D;  2G5D A;  4GA6 A;  3GTP A;  1I50 A;  1DMR A;  4AZD A;  5T5I D;  1HD5 A;  3HKZ A;  3GTJ A;  4CQN A;  1DMS A;  1FDO A;  3ZGZ A;  1QCS A;  1K83 A;  5DYI A;  4JCW A;  5GM9 A;  2PI8 A;  4KDL A;  3X2I A;  5FTL A;  1PQH A;  2NVY A;  3D30 A;  1UHE A;  3CZB A;  2Q1A X;  1S3S A;  1ZC1 A;  1Y5I A;  2VPW A;  4FG4 A;  2VUM A;  1VC3 B;  1PT1 A;  2B25 A;  5D6X A;  1E61 A;  3X2O A;  1BW3 A;  3M3G A;  2R93 A;  3PLX B;  4JJO A;  2AE0 X;  2VPX A;  2E2H A;  1CZ4 A;  1CZ5 A;  2JIR A;  2HCZ X;  3O5A A;  2G6G A;  1TWC A;  4JP6 A;  4D7Z B;  4ENG A;  1R27 A;  1SMY D;  1N10 A;  2A68 D;  1TWA A;  2BE5 D;  3QC8 A;  3QQ7 A;  5GLX A;  3X2K A;  2A6H D;  4QIW A;  3GTL A;  1YNN D;  2JA6 A;  3GTQ A;  2MM2 A;  3LHD A;  3ZJU A;  2Y0S A;  3TIW A;  2XDP A;  4FIB A; 
#chains in the Genus database with same CATH homology
 1E5V A;  1H0H A;  5FTK A;  2B63 A;  2PWY A;  1IW7 D;  3IR5 A;  3CQZ A;  2Q1D X;  2Q18 X;  2EEO B;  1O54 A;  1E60 A;  2GAE A;  3GTM A;  1KQG A;  3H0G A;  1TWF A;  4KOD A;  4AAY A;  2IV2 X;  1G8K A;  1TWG A;  2R92 A;  1FDI A;  1PPY A;  1QDN A;  2E7Z A;  3IR6 A;  2JA7 A;  2YU9 A;  4UC4 A;  2KI8 A;  1TWH A;  2NVX A;  5CD1 A;  3GTG A;  1Y1V A;  3GTK A;  5EPP A;  1AW8 B;  2GF7 A;  2Q19 X;  2JV2 A;  1H5N A;  1WLF A;  3TM7 B;  5B6C A;  2LW6 A;  2GFA A;  3IR7 A;  2A69 D;  2Q1C X;  3CF2 A;  2R7Z A;  1CR5 A;  1R7R A;  5FTJ A;  1Y4Z A;  5D6Y A;  2A6E D;  3FPT A;  2PJH B;  4AOK B;  4CRY G;  4ARC A;  2WB1 A;  3FKI A;  3ML1 A;  4CRZ A;  3MB5 A;  3DMR A;  1R9T A;  4C2M A;  2NYA A;  2JIO A;  1Q16 A;  3ZJT A;  5FTN A;  2DMR A;  3QWZ A;  5C18 A;  4KLN A;  2PIC A;  2JIM A;  1E32 A;  3QQ8 A;  5DYG A;  3GTO A;  2PJJ A;  1PQF A;  2C45 A;  4RV0 A;  4AON B;  1G8J A;  3HU2 A;  2KY9 A;  5FTM A;  1TMO A;  5D6W A;  4AQ7 A;  3ZJV A;  2NAP A;  2V3V A;  1I9G A;  3FPR A;  3FPU A;  2QQR A;  4AYB A;  5C1B A;  1E18 A;  2YUJ A;  4AS1 A;  4KO8 A;  5GLF A;  2CW0 D;  5ERG B;  4CS0 A;  3OUG A;  2QQS A;  1PYU B;  4DMR A;  3BQB A;  2VPY A;  1AA6 A;  2YVL A;  2PNW A;  1WCM A;  1SIW A;  1SFO A;  5EQJ B;  1YLE A;  1UHD A;  2JIP A;  1KQF A;  1OGY A;  1PYQ A;  2VPZ A;  3HU1 A;  3HU3 A;  1YNJ D;  1PT0 A;  2JA5 A;  5CCX A;  4GA5 A;  1EU1 A;  2V45 A;  5T5M D;  2E2I A;  2WAQ A;  2PMZ A;  2O5J D;  5CCB A;  4NOH A;  1Y1W A;  2JIQ A;  3LGA A;  1PQE A;  4KDI A;  4ARI A;  1I3Q A;  1ZYR D;  2G5D A;  4GA6 A;  3GTP A;  1I50 A;  1DMR A;  4AZD A;  5T5I D;  4CQN A;  3HKZ A;  3GTJ A;  1DMS A;  1FDO A;  3ZGZ A;  1QCS A;  1K83 A;  5DYI A;  2PI8 A;  4KDL A;  5FTL A;  1PQH A;  2NVY A;  1UHE A;  3CZB A;  2Q1A X;  1S3S A;  1ZC1 A;  1Y5I A;  2VPW A;  2VUM A;  1VC3 B;  1PT1 A;  2B25 A;  5D6X A;  1E61 A;  2R93 A;  3PLX B;  2AE0 X;  2VPX A;  2E2H A;  1CZ4 A;  1CZ5 A;  2JIR A;  3O5A A;  4D7Z B;  2G6G A;  1TWC A;  2MM0 A;  1R27 A;  1SMY D;  2A68 D;  3QC8 A;  1TWA A;  2BE5 D;  3QQ7 A;  2A6H D;  4QIW A;  3GTL A;  1YNN D;  2JA6 A;  3GTQ A;  2MM2 A;  3LHD A;  3ZJU A;  2Y0S A;  3TIW A;  2XDP A;  4FIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...