5B6CA

Structural details of ufd1 binding to p97
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
GSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Details of Ufd1 Binding to p97 and Their Functional Implications in ER-Associated Degradation
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5b6cA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5b6cA02
1OGYA 1FDOA 1TMOA 4AONB 4C2MA 5T5ID 2R7ZA 3QC8A 5T5MD 3GTQA 5GLFA 1CR5A 2JIPA 3QWZA 1Y4ZA 1UHDA 2PMZA 3HU1A 3CQZA 1KQFA 3HU2A 2NVXA 3ML1A 1KQGA 2JV2A 5FTNA 1QDNA 2E7ZA 5DYIA 2IV2X 1R27A 3HKZA 3GTKA 5C1BA 3IR6A 4CS0A 1K83A 2NVYA 4CRYG 2Y0SA 1Y1VA 1PT0A 5FTMA 1PPYA 1TWHA 1G8KA 5C18A 1ZC1A 4AYBA 1FDIA 2V3VA 1PQEA 3O5AA 1R9TA 1EU1A 2JIMA 3DMRA 2R92A 5FTLA 1PQFA 1UHEA 2VPXA 3QQ8A 4AAYA 1I50A 3GTLA 1R7RA 2VPWA 1WCMA 3IR7A 1E32A 5DYGA 3CF2A 2C45A 4AOKB 2NAPA 2JA5A 1E5VA 1TWAA 3GTGA 5FTJA 3GTJA 4DMRA 2VUMA 5FTKA 1PYQA 3TIWA 1TWCA 1AW8B 2WAQA 4GA6A 1PYUB 4QIWA 3HU3A 1YLEA 1H5NA 1H0HA 2E2IA 2JIOA 1PT1A 1TWFA 1IW7D 2NYAA 4KODA 1PQHA 1DMRA 1QCSA 1Q16A 2VPZA 3FKIA 3IR5A 4KDLA 1Y1WA 1CZ5A 3GTMA 1E61A 4KO8A 1CZ4A 2VPYA 3PLXB 2WB1A 3OUGA 1S3SA 2DMRA 1SIWA 2JIQA 4CRZA 5B6CA 2EEOB 2V45A 2B63A 5EPPA 1TWGA 4AZDA 2JA6A 4RV0A 3QQ7A 1VC3B 1I3QA 1SFOA 2R93A 2E2HA 4GA5A 1E18A 2PJHB 1E60A 4KDIA 1WLFA 3GTPA 4KLNA 3GTOA 1G8JA 1DMSA 4D7ZB 2KI8A 3H0GA 3TM7B 1Y5IA 2YU9A 2YUJA 1AA6A 2JA7A 2JIRA
chains in the Genus database with same CATH superfamily
2A6ED 3FPUA 3X2HA 1OGYA 1FDOA 1TMOA 4AONB 4C2MA 4UC4A 4NOHA 5T5ID 2R7ZA 3QC8A 5T5MD 2Q18X 3GTQA 5GLFA 4JS7A 2AE0X 2MM2A 1CR5A 2JIPA 3QWZA 1Y4ZA 1UHDA 2GAEA 2PMZA 3HU1A 5GM9A 3X2JA 3CQZA 1KQFA 5GLYA 3LGAA 3HU2A 2NVXA 1BW4A 3ML1A 1KQGA 2JV2A 4FERA 2Q1AX 5FTNA 1QDNA 2KY9A 2E7ZA 5DYIA 2IV2X 2PWYA 1R27A 3HKZA 3GTKA 4ARCA 5C1BA 3IR6A 4CS0A 1K83A 5D6WA 5EQJB 2NVYA 2JIRA 3SUKA 4CRYG 2Y0SA 1Y1VA 2Q1DX 1PT0A 1WC2A 5FTMA 3ZGZA 1PPYA 1TWHA 1G8KA 2G5DA 1ZC1A 4FG2A 5C18A 4AYBA 5ERGB 1FDIA 2V3VA 1PQEA 3O5AA 3FPTA 4ENGA 1R9TA 5CD1A 2G6GA 1EU1A 3X2PA 2KQAA 2GF7A 2JIMA 3DMRA 2R92A 2QQSA 5FTLA 1PQFA 1UHEA 2VPXA 3QQ8A 4AAYA 1I50A 3GTLA 5H4UA 1R7RA 2VPWA 1WCMA 3IR7A 1E32A 2Q19X 4AS1A 3SUMA 5DYGA 2BE5D 3CF2A 2C45A 3ENGA 4AOKB 2NAPA 1ZYRD 2JA5A 3SULA 3ZJTA 1TWAA 4JJOA 3GTGA 5FTJA 2YVLA 5D6YA 1N10A 5GLXA 3GTJA 4DMRA 3ZJVA 3X2GA 4JP6A 3X2LA 2VUMA 1YNND 2B25A 5FTKA 2CW0D 4AQ7A 1PYQA 3TIWA 1TWCA 1AW8B 2WAQA 4GA6A 1PYUB 2HCZX 3HU3A 4QIWA 1YLEA 2A69D 1H5NA 1H0HA 3D30A 3CZBA 2JIOA 4ZM7A 2E2IA 1PT1A 1TWFA 1IW7D 2BH0A 3SUJA 2NYAA 3LHDA 4KODA 1PQHA 1DMRA 1L8FA 1QCSA 1Q16A 2A68D 2VPZA 3FKIA 3IR5A 4KDLA 3X2MA 1Y1WA 1CZ5A 1OA9A 3GTMA 3M3GA 1E61A 4KO8A 2MM0A 1CZ4A 2VPYA 4L48A 1I9GA 4FG4A 5D6XA 1HD5A 3PLXB 4ARIA 2WB1A 2PI8A 3OUGA 1S3SA 2DMRA 1SIWA 2JIQA 1O54A 4JCWA 2A6HD 4CRZA 2EEOB 2V45A 4FFTA 3X2NA 5EPPA 5B6CA 2B63A 1TWGA 1SMYD 4AZDA 2JA6A 3X2OA 4RV0A 4JP7A 2GFAA 3QQ7A 1VC3B 1I3QA 1SFOA 2R93A 2E2HA 2QQRA 4GA5A 1E18A 2PJHB 2PJJA 4CQNA 4FIBA 1E60A 1BW3A 2PNWA 3ZJUA 4KDIA 1WLFA 3X2IA 3GTPA 2Q1CX 2PICA 4KLNA 3GTOA 1G8JA 1DMSA 3X2KA 4D7ZB 2ENGA 2KI8A 5CCXA 3MB5A 3H0GA 3TM7B 1Y5IA 2O5JD 2LW6A 1YNJD 2YU9A 2YUJA 4AVRA 2XDPA 1AA6A 3FPRA 1OA7A 2JA7A 5CCBA 3BQBA 1E5VA
chains in the Genus database with same CATH topology
2A6ED 3FPUA 1OGYA 1FDOA 1TMOA 4AONB 4C2MA 4UC4A 4NOHA 5T5ID 2R7ZA 3QC8A 5T5MD 2Q18X 3GTQA 5GLFA 2AE0X 2MM2A 1CR5A 2JIPA 3QWZA 1Y4ZA 1UHDA 2GAEA 2PMZA 3HU1A 3CQZA 1KQFA 3LGAA 3HU2A 2NVXA 3ML1A 1KQGA 2JV2A 2Q1AX 5FTNA 1QDNA 2KY9A 2E7ZA 5DYIA 2IV2X 2PWYA 1R27A 3HKZA 3GTKA 4ARCA 5C1BA 3IR6A 4CS0A 1K83A 5D6WA 5EQJB 2NVYA 4CRYG 2Y0SA 1Y1VA 2Q1DX 1PT0A 5FTMA 3ZGZA 1PPYA 1TWHA 1G8KA 2G5DA 1ZC1A 5C18A 4AYBA 1FDIA 2V3VA 1PQEA 3O5AA 3FPTA 1R9TA 5CD1A 2G6GA 1EU1A 2GF7A 2JIMA 3DMRA 2R92A 2QQSA 5FTLA 1PQFA 1UHEA 2VPXA 3QQ8A 4AAYA 1I50A 3GTLA 1R7RA 2VPWA 1WCMA 3IR7A 1E32A 2Q19X 4AS1A 5DYGA 2BE5D 3CF2A 2C45A 4AOKB 2NAPA 1ZYRD 2JA5A 3ZJTA 1E5VA 1TWAA 3GTGA 5FTJA 2YVLA 5D6YA 3GTJA 3ZJVA 4DMRA 2VUMA 1YNND 2B25A 5FTKA 2CW0D 4AQ7A 1PYQA 3TIWA 1TWCA 1AW8B 2WAQA 4GA6A 1PYUB 4QIWA 3HU3A 1YLEA 2A69D 1H5NA 1H0HA 2E2IA 3CZBA 2JIOA 1PT1A 1TWFA 1IW7D 2NYAA 3LHDA 4KODA 1PQHA 1DMRA 1QCSA 1Q16A 2A68D 2VPZA 3FKIA 3IR5A 4KDLA 1Y1WA 1CZ5A 3GTMA 1E61A 4KO8A 2MM0A 1CZ4A 2VPYA 1I9GA 5D6XA 4ARIA 3PLXB 2WB1A 2PI8A 3OUGA 1S3SA 2DMRA 1SIWA 2JIQA 1O54A 2A6HD 4CRZA 2EEOB 2V45A 5B6CA 2B63A 5EPPA 5ERGB 1TWGA 1SMYD 4AZDA 2JA6A 4RV0A 2GFAA 3QQ7A 1VC3B 1I3QA 1SFOA 2R93A 2E2HA 2QQRA 4GA5A 1E18A 2PJHB 2PJJA 4CQNA 4FIBA 1E60A 3ZJUA 2PNWA 4KDIA 1WLFA 3GTPA 2Q1CX 2PICA 4KLNA 3GTOA 1G8JA 1DMSA 4D7ZB 2KI8A 5CCXA 3MB5A 3H0GA 3TM7B 1Y5IA 2O5JD 2LW6A 1YNJD 2YU9A 2YUJA 2XDPA 1AA6A 3FPRA 2JA7A 5CCBA 3BQBA 2JIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGY A;  1FDO A;  1TMO A;  4AON B;  4C2M A;  5T5I D;  2R7Z A;  3QC8 A;  5T5M D;  3GTQ A;  5GLF A;  1CR5 A;  2JIP A;  3QWZ A;  1Y4Z A;  1UHD A;  2PMZ A;  3HU1 A;  3CQZ A;  1KQF A;  3HU2 A;  2NVX A;  3ML1 A;  1KQG A;  2JV2 A;  5FTN A;  1QDN A;  2E7Z A;  5DYI A;  2IV2 X;  1R27 A;  3HKZ A;  3GTK A;  5C1B A;  3IR6 A;  4CS0 A;  1K83 A;  2NVY A;  4CRY G;  2Y0S A;  1Y1V A;  1PT0 A;  5FTM A;  1PPY A;  1TWH A;  1G8K A;  5C18 A;  1ZC1 A;  4AYB A;  1FDI A;  2V3V A;  1PQE A;  3O5A A;  1R9T A;  1EU1 A;  2JIM A;  3DMR A;  2R92 A;  5FTL A;  1PQF A;  1UHE A;  2VPX A;  3QQ8 A;  4AAY A;  1I50 A;  3GTL A;  1R7R A;  2VPW A;  1WCM A;  3IR7 A;  1E32 A;  5DYG A;  3CF2 A;  2C45 A;  4AOK B;  2NAP A;  2JA5 A;  1E5V A;  1TWA A;  3GTG A;  5FTJ A;  3GTJ A;  4DMR A;  2VUM A;  5FTK A;  1PYQ A;  3TIW A;  1TWC A;  1AW8 B;  2WAQ A;  4GA6 A;  1PYU B;  4QIW A;  3HU3 A;  1YLE A;  1H5N A;  1H0H A;  2E2I A;  2JIO A;  1PT1 A;  1TWF A;  1IW7 D;  2NYA A;  4KOD A;  1PQH A;  1DMR A;  1QCS A;  1Q16 A;  2VPZ A;  3FKI A;  3IR5 A;  4KDL A;  1Y1W A;  1CZ5 A;  3GTM A;  1E61 A;  4KO8 A;  1CZ4 A;  2VPY A;  3PLX B;  2WB1 A;  3OUG A;  1S3S A;  2DMR A;  1SIW A;  2JIQ A;  4CRZ A;  5B6C A;  2EEO B;  2V45 A;  2B63 A;  5EPP A;  1TWG A;  4AZD A;  2JA6 A;  4RV0 A;  3QQ7 A;  1VC3 B;  1I3Q A;  1SFO A;  2R93 A;  2E2H A;  4GA5 A;  1E18 A;  2PJH B;  1E60 A;  4KDI A;  1WLF A;  3GTP A;  4KLN A;  3GTO A;  1G8J A;  1DMS A;  4D7Z B;  2KI8 A;  3H0G A;  3TM7 B;  1Y5I A;  2YU9 A;  2YUJ A;  1AA6 A;  2JA7 A;  2JIR A; 
#chains in the Genus database with same CATH topology
 2A6E D;  3FPU A;  3X2H A;  1OGY A;  1FDO A;  1TMO A;  4AON B;  4C2M A;  4UC4 A;  4NOH A;  5T5I D;  2R7Z A;  3QC8 A;  5T5M D;  2Q18 X;  3GTQ A;  5GLF A;  4JS7 A;  2AE0 X;  2MM2 A;  1CR5 A;  2JIP A;  3QWZ A;  1Y4Z A;  1UHD A;  2GAE A;  2PMZ A;  3HU1 A;  5GM9 A;  3X2J A;  3CQZ A;  1KQF A;  5GLY A;  3LGA A;  3HU2 A;  2NVX A;  1BW4 A;  3ML1 A;  1KQG A;  2JV2 A;  4FER A;  2Q1A X;  5FTN A;  1QDN A;  2KY9 A;  2E7Z A;  5DYI A;  2IV2 X;  2PWY A;  1R27 A;  3HKZ A;  3GTK A;  4ARC A;  5C1B A;  3IR6 A;  4CS0 A;  1K83 A;  5D6W A;  5EQJ B;  2NVY A;  2JIR A;  3SUK A;  4CRY G;  2Y0S A;  1Y1V A;  2Q1D X;  1PT0 A;  1WC2 A;  5FTM A;  3ZGZ A;  1PPY A;  1TWH A;  1G8K A;  2G5D A;  1ZC1 A;  4FG2 A;  5C18 A;  4AYB A;  5ERG B;  1FDI A;  2V3V A;  1PQE A;  3O5A A;  3FPT A;  4ENG A;  1R9T A;  5CD1 A;  2G6G A;  1EU1 A;  3X2P A;  2KQA A;  2GF7 A;  2JIM A;  3DMR A;  2R92 A;  2QQS A;  5FTL A;  1PQF A;  1UHE A;  2VPX A;  3QQ8 A;  4AAY A;  1I50 A;  3GTL A;  5H4U A;  1R7R A;  2VPW A;  1WCM A;  3IR7 A;  1E32 A;  2Q19 X;  4AS1 A;  3SUM A;  5DYG A;  2BE5 D;  3CF2 A;  2C45 A;  3ENG A;  4AOK B;  2NAP A;  1ZYR D;  2JA5 A;  3SUL A;  3ZJT A;  1TWA A;  4JJO A;  3GTG A;  5FTJ A;  2YVL A;  5D6Y A;  1N10 A;  5GLX A;  3GTJ A;  4DMR A;  3ZJV A;  3X2G A;  4JP6 A;  3X2L A;  2VUM A;  1YNN D;  2B25 A;  5FTK A;  2CW0 D;  4AQ7 A;  1PYQ A;  3TIW A;  1TWC A;  1AW8 B;  2WAQ A;  4GA6 A;  1PYU B;  2HCZ X;  3HU3 A;  4QIW A;  1YLE A;  2A69 D;  1H5N A;  1H0H A;  3D30 A;  3CZB A;  2JIO A;  4ZM7 A;  2E2I A;  1PT1 A;  1TWF A;  1IW7 D;  2BH0 A;  3SUJ A;  2NYA A;  3LHD A;  4KOD A;  1PQH A;  1DMR A;  1L8F A;  1QCS A;  1Q16 A;  2A68 D;  2VPZ A;  3FKI A;  3IR5 A;  4KDL A;  3X2M A;  1Y1W A;  1CZ5 A;  1OA9 A;  3GTM A;  3M3G A;  1E61 A;  4KO8 A;  2MM0 A;  1CZ4 A;  2VPY A;  4L48 A;  1I9G A;  4FG4 A;  5D6X A;  1HD5 A;  3PLX B;  4ARI A;  2WB1 A;  2PI8 A;  3OUG A;  1S3S A;  2DMR A;  1SIW A;  2JIQ A;  1O54 A;  4JCW A;  2A6H D;  4CRZ A;  2EEO B;  2V45 A;  4FFT A;  3X2N A;  5EPP A;  5B6C A;  2B63 A;  1TWG A;  1SMY D;  4AZD A;  2JA6 A;  3X2O A;  4RV0 A;  4JP7 A;  2GFA A;  3QQ7 A;  1VC3 B;  1I3Q A;  1SFO A;  2R93 A;  2E2H A;  2QQR A;  4GA5 A;  1E18 A;  2PJH B;  2PJJ A;  4CQN A;  4FIB A;  1E60 A;  1BW3 A;  2PNW A;  3ZJU A;  4KDI A;  1WLF A;  3X2I A;  3GTP A;  2Q1C X;  2PIC A;  4KLN A;  3GTO A;  1G8J A;  1DMS A;  3X2K A;  4D7Z B;  2ENG A;  2KI8 A;  5CCX A;  3MB5 A;  3H0G A;  3TM7 B;  1Y5I A;  2O5J D;  2LW6 A;  1YNJ D;  2YU9 A;  2YUJ A;  4AVR A;  2XDP A;  1AA6 A;  3FPR A;  1OA7 A;  2JA7 A;  5CCB A;  3BQB A;  1E5V A; 
#chains in the Genus database with same CATH homology
 2A6E D;  3FPU A;  1OGY A;  1FDO A;  1TMO A;  4AON B;  4C2M A;  4UC4 A;  4NOH A;  5T5I D;  2R7Z A;  3QC8 A;  5T5M D;  2Q18 X;  3GTQ A;  5GLF A;  2AE0 X;  2MM2 A;  1CR5 A;  2JIP A;  3QWZ A;  1Y4Z A;  1UHD A;  2GAE A;  2PMZ A;  3HU1 A;  3CQZ A;  1KQF A;  3LGA A;  3HU2 A;  2NVX A;  3ML1 A;  1KQG A;  2JV2 A;  2Q1A X;  5FTN A;  1QDN A;  2KY9 A;  2E7Z A;  5DYI A;  2IV2 X;  2PWY A;  1R27 A;  3HKZ A;  3GTK A;  4ARC A;  5C1B A;  3IR6 A;  4CS0 A;  1K83 A;  5D6W A;  5EQJ B;  2NVY A;  4CRY G;  2Y0S A;  1Y1V A;  2Q1D X;  1PT0 A;  5FTM A;  3ZGZ A;  1PPY A;  1TWH A;  1G8K A;  2G5D A;  1ZC1 A;  5C18 A;  4AYB A;  1FDI A;  2V3V A;  1PQE A;  3O5A A;  3FPT A;  1R9T A;  5CD1 A;  2G6G A;  1EU1 A;  2GF7 A;  2JIM A;  3DMR A;  2R92 A;  2QQS A;  5FTL A;  1PQF A;  1UHE A;  2VPX A;  3QQ8 A;  4AAY A;  1I50 A;  3GTL A;  1R7R A;  2VPW A;  1WCM A;  3IR7 A;  1E32 A;  2Q19 X;  4AS1 A;  5DYG A;  2BE5 D;  3CF2 A;  2C45 A;  4AOK B;  2NAP A;  1ZYR D;  2JA5 A;  3ZJT A;  1E5V A;  1TWA A;  3GTG A;  5FTJ A;  2YVL A;  5D6Y A;  3GTJ A;  3ZJV A;  4DMR A;  2VUM A;  1YNN D;  2B25 A;  5FTK A;  2CW0 D;  4AQ7 A;  1PYQ A;  3TIW A;  1TWC A;  1AW8 B;  2WAQ A;  4GA6 A;  1PYU B;  4QIW A;  3HU3 A;  1YLE A;  2A69 D;  1H5N A;  1H0H A;  2E2I A;  3CZB A;  2JIO A;  1PT1 A;  1TWF A;  1IW7 D;  2NYA A;  3LHD A;  4KOD A;  1PQH A;  1DMR A;  1QCS A;  1Q16 A;  2A68 D;  2VPZ A;  3FKI A;  3IR5 A;  4KDL A;  1Y1W A;  1CZ5 A;  3GTM A;  1E61 A;  4KO8 A;  2MM0 A;  1CZ4 A;  2VPY A;  1I9G A;  5D6X A;  4ARI A;  3PLX B;  2WB1 A;  2PI8 A;  3OUG A;  1S3S A;  2DMR A;  1SIW A;  2JIQ A;  1O54 A;  2A6H D;  4CRZ A;  2EEO B;  2V45 A;  5B6C A;  2B63 A;  5EPP A;  5ERG B;  1TWG A;  1SMY D;  4AZD A;  2JA6 A;  4RV0 A;  2GFA A;  3QQ7 A;  1VC3 B;  1I3Q A;  1SFO A;  2R93 A;  2E2H A;  2QQR A;  4GA5 A;  1E18 A;  2PJH B;  2PJJ A;  4CQN A;  4FIB A;  1E60 A;  3ZJU A;  2PNW A;  4KDI A;  1WLF A;  3GTP A;  2Q1C X;  2PIC A;  4KLN A;  3GTO A;  1G8J A;  1DMS A;  4D7Z B;  2KI8 A;  5CCX A;  3MB5 A;  3H0G A;  3TM7 B;  1Y5I A;  2O5J D;  2LW6 A;  1YNJ D;  2YU9 A;  2YUJ A;  2XDP A;  1AA6 A;  3FPR A;  2JA7 A;  5CCB A;  3BQB A;  2JIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...