5B6CA

Structural details of ufd1 binding to p97
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
GSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Details of Ufd1 Binding to p97 and Their Functional Implications in ER-Associated Degradation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5b6cA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5b6cA02
4KDIA 1E32A 1EU1A 1AA6A 1S3SA 2NYAA 2VPWA 5FTLA 3HU1A 5C1BA 2NAPA 2VPZA 1FDOA 1PQEA 3TM7B 2R92A 1TWFA 1ZC1A 5DYIA 1PYQA 2WB1A 2JIPA 1QDNA 2YU9A 2E2IA 1KQGA 4CRZA 3GTKA 3GTOA 3IR7A 2WAQA 5EPPA 1PT1A 4CS0A 2Y0SA 1SIWA 2DMRA 1G8JA 1PPYA 2IV2X 3QQ7A 5FTMA 3ML1A 2B63A 2R7ZA 1E61A 5T5MD 2PMZA 1E5VA 1YLEA 4KODA 1CR5A 2VPYA 1DMSA 1R7RA 4GA6A 3IR6A 4RV0A 1TMOA 2KI8A 4DMRA 1AW8B 4D7ZB 2V3VA 2JV2A 2C45A 1WLFA 2E2HA 1Q16A 1Y4ZA 1VC3B 3QWZA 5FTKA 1KQFA 1TWCA 1UHDA 3HU2A 1SFOA 4C2MA 1Y5IA 2JIMA 1E60A 4QIWA 1PT0A 3H0GA 3GTGA 3CQZA 1CZ5A 1TWAA 5B6CA 1PYUB 1Y1VA 1UHEA 3QC8A 3O5AA 1PQFA 5T5ID 1WCMA 4AAYA 2NVYA 4CRYG 3TIWA 4GA5A 1E18A 1CZ4A 1R27A 2E7ZA 3QQ8A 3CF2A 4AONB 4AYBA 3GTQA 1TWGA 2EEOB 1OGYA 3IR5A 1QCSA 3GTLA 5FTNA 1PQHA 3DMRA 2JIRA 5FTJA 3FKIA 1DMRA 5GLFA 3GTPA 2JIOA 3HKZA 4AOKB 1Y1WA 2VPXA 2PJHB 2JA5A 3HU3A 1I3QA 1I50A 5DYGA 5C18A 2R93A 3GTJA 4KLNA 4KO8A 2V45A 1H5NA 2JIQA 2NVXA 1R9TA 1TWHA 1FDIA 1H0HA 4AZDA 1G8KA 1K83A 2YUJA 2VUMA 1IW7D 3PLXB 2JA6A 4KDLA 2JA7A 3GTMA 3OUGA
chains in the Genus database with same CATH superfamily
5H4UA 4KDIA 2GFAA 1E32A 1EU1A 1AA6A 2Q1CX 1S3SA 2NYAA 2VPWA 5FTLA 1BW4A 2ENGA 5ERGB 3HU1A 5C1BA 2NAPA 4FFTA 3M3GA 3FPUA 2KQAA 2VPZA 2PWYA 1FDOA 2HCZX 1PQEA 3TM7B 2R92A 3X2NA 1TWFA 4ENGA 1ZC1A 2PJJA 4CQNA 5DYIA 1PYQA 2WB1A 1WC2A 2JIPA 1QDNA 2YU9A 3X2KA 2E2IA 1KQGA 4CRZA 3GTKA 3GTOA 3IR7A 4AQ7A 2WAQA 5EPPA 1PT1A 4CS0A 2Y0SA 1SIWA 2BH0A 1G8JA 1PPYA 2DMRA 4FERA 5GLYA 2IV2X 2QQSA 1SMYD 4UC4A 2GAEA 1OA7A 3QQ7A 5FTMA 1N10A 3ML1A 2B63A 5GLXA 3X2GA 5CCBA 2R7ZA 1E61A 5T5MD 2PMZA 1E5VA 3D30A 1YLEA 2PNWA 4KODA 1CR5A 2VPYA 1DMSA 3X2JA 1R7RA 4GA6A 3IR6A 4RV0A 1TMOA 3SUKA 2KI8A 4DMRA 1AW8B 1HD5A 2V3VA 3X2PA 4D7ZB 2JV2A 2C45A 2A6ED 3LGAA 1WLFA 4JP7A 2E2HA 1Q16A 1Y4ZA 1VC3B 3QWZA 5FTKA 1KQFA 2B25A 2Q18X 1I9GA 2A6HD 3FPTA 1TWCA 1UHDA 3HU2A 3X2OA 1SFOA 5CCXA 2Q1DX 4C2MA 1Y5IA 1OA9A 3CZBA 2JIMA 1E60A 4JP6A 4QIWA 3X2MA 1PT0A 3H0GA 3GTGA 3CQZA 2O5JD 1CZ5A 1TWAA 5B6CA 3FPRA 1PYUB 2MM2A 1Y1VA 1UHEA 1L8FA 1YNJD 3QC8A 1ZYRD 4JJOA 2KY9A 3MB5A 3ZJUA 4NOHA 3O5AA 4AS1A 1PQFA 5T5ID 1WCMA 4AAYA 5CD1A 5EQJB 2PICA 2NVYA 4CRYG 2XDPA 2G6GA 3TIWA 2YVLA 2CW0D 4GA5A 1E18A 1CZ4A 1R27A 2E7ZA 3QQ8A 3CF2A 4AONB 4AYBA 3GTQA 2GF7A 1TWGA 3SULA 2EEOB 1OGYA 4FG4A 3IR5A 1QCSA 5D6WA 3GTLA 2QQRA 5FTNA 1BW3A 4JCWA 1PQHA 3DMRA 4ARIA 2JIRA 5FTJA 3FKIA 3SUMA 2G5DA 4FG2A 1DMRA 5GLFA 2BE5D 4ZM7A 3GTPA 2JIOA 3ENGA 3HKZA 4AOKB 1Y1WA 2VPXA 2PJHB 2JA5A 3HU3A 1I3QA 2MM0A 1I50A 4L48A 3LHDA 5DYGA 5C18A 2R93A 3GTJA 3X2LA 4KLNA 5D6XA 4KO8A 2V45A 4AVRA 1H5NA 3ZJVA 2A69D 1YNND 2JIQA 2NVXA 1O54A 3ZJTA 1R9TA 2Q1AX 1TWHA 3X2IA 1FDIA 2LW6A 1H0HA 3X2HA 5GM9A 4AZDA 1G8KA 1K83A 5D6YA 4ARCA 2A68D 2YUJA 3BQBA 4JS7A 2VUMA 2AE0X 1IW7D 3PLXB 2JA6A 3ZGZA 2PI8A 4KDLA 2JA7A 2Q19X 4FIBA 3SUJA 3GTMA 3OUGA
chains in the Genus database with same CATH topology
4KDIA 2GFAA 1E32A 1EU1A 1AA6A 2Q1CX 1S3SA 2NYAA 2VPWA 5FTLA 5ERGB 3HU1A 5C1BA 2NAPA 3FPUA 2VPZA 2PWYA 1FDOA 1PQEA 3TM7B 2R92A 1TWFA 1ZC1A 2PJJA 4CQNA 5DYIA 1PYQA 2WB1A 2JIPA 1QDNA 2YU9A 2E2IA 1KQGA 4CRZA 3GTKA 3GTOA 3IR7A 2WAQA 5EPPA 1PT1A 4CS0A 2Y0SA 1SIWA 2DMRA 1G8JA 1PPYA 2IV2X 2QQSA 4UC4A 4AQ7A 1SMYD 2GAEA 3QQ7A 5FTMA 3ML1A 2B63A 5CCBA 2R7ZA 1E61A 5T5MD 2PMZA 1E5VA 1YLEA 2PNWA 4KODA 1CR5A 2VPYA 1DMSA 1R7RA 4GA6A 3IR6A 4RV0A 1TMOA 2KI8A 4DMRA 1AW8B 4D7ZB 2V3VA 2JV2A 2C45A 2A6ED 3LGAA 1WLFA 2E2HA 1Q16A 1Y4ZA 1VC3B 3QWZA 5FTKA 1KQFA 2B25A 2Q18X 1I9GA 2A6HD 3FPTA 1TWCA 1UHDA 3HU2A 1SFOA 5CCXA 2Q1DX 4C2MA 1Y5IA 3CZBA 2JIMA 1E60A 4QIWA 1PT0A 3H0GA 3GTGA 3CQZA 2O5JD 1CZ5A 1TWAA 5B6CA 3FPRA 1PYUB 2MM2A 1Y1VA 1UHEA 3MB5A 1YNJD 3QC8A 1ZYRD 2KY9A 3ZJUA 4NOHA 3O5AA 4AS1A 1PQFA 5T5ID 1WCMA 4AAYA 5CD1A 5EQJB 2PICA 2NVYA 4CRYG 2XDPA 2G6GA 3TIWA 2YVLA 2CW0D 4GA5A 1E18A 1CZ4A 1R27A 2E7ZA 3QQ8A 3CF2A 4AONB 4AYBA 3GTQA 2GF7A 1TWGA 2EEOB 1OGYA 3IR5A 1QCSA 5D6WA 3GTLA 2QQRA 5FTNA 1PQHA 3DMRA 4ARIA 2JIRA 5FTJA 3FKIA 2G5DA 1DMRA 5GLFA 2BE5D 3GTPA 2JIOA 3HKZA 4AOKB 1Y1WA 2VPXA 2PJHB 2JA5A 3HU3A 1I3QA 2MM0A 1I50A 3LHDA 5DYGA 5C18A 2R93A 3GTJA 4KLNA 5D6XA 4KO8A 2V45A 1H5NA 3ZJVA 2A69D 1YNND 2JIQA 2NVXA 1O54A 3ZJTA 1R9TA 2Q1AX 1TWHA 1FDIA 2LW6A 1H0HA 4AZDA 1G8KA 1K83A 5D6YA 4ARCA 2A68D 2YUJA 3BQBA 2VUMA 2AE0X 1IW7D 3PLXB 2JA6A 3ZGZA 2PI8A 4KDLA 2JA7A 2Q19X 4FIBA 3GTMA 3OUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDI A;  1E32 A;  1EU1 A;  1AA6 A;  1S3S A;  2NYA A;  2VPW A;  5FTL A;  3HU1 A;  5C1B A;  2NAP A;  2VPZ A;  1FDO A;  1PQE A;  3TM7 B;  2R92 A;  1TWF A;  1ZC1 A;  5DYI A;  1PYQ A;  2WB1 A;  2JIP A;  1QDN A;  2YU9 A;  2E2I A;  1KQG A;  4CRZ A;  3GTK A;  3GTO A;  3IR7 A;  2WAQ A;  5EPP A;  1PT1 A;  4CS0 A;  2Y0S A;  1SIW A;  2DMR A;  1G8J A;  1PPY A;  2IV2 X;  3QQ7 A;  5FTM A;  3ML1 A;  2B63 A;  2R7Z A;  1E61 A;  5T5M D;  2PMZ A;  1E5V A;  1YLE A;  4KOD A;  1CR5 A;  2VPY A;  1DMS A;  1R7R A;  4GA6 A;  3IR6 A;  4RV0 A;  1TMO A;  2KI8 A;  4DMR A;  1AW8 B;  4D7Z B;  2V3V A;  2JV2 A;  2C45 A;  1WLF A;  2E2H A;  1Q16 A;  1Y4Z A;  1VC3 B;  3QWZ A;  5FTK A;  1KQF A;  1TWC A;  1UHD A;  3HU2 A;  1SFO A;  4C2M A;  1Y5I A;  2JIM A;  1E60 A;  4QIW A;  1PT0 A;  3H0G A;  3GTG A;  3CQZ A;  1CZ5 A;  1TWA A;  5B6C A;  1PYU B;  1Y1V A;  1UHE A;  3QC8 A;  3O5A A;  1PQF A;  5T5I D;  1WCM A;  4AAY A;  2NVY A;  4CRY G;  3TIW A;  4GA5 A;  1E18 A;  1CZ4 A;  1R27 A;  2E7Z A;  3QQ8 A;  3CF2 A;  4AON B;  4AYB A;  3GTQ A;  1TWG A;  2EEO B;  1OGY A;  3IR5 A;  1QCS A;  3GTL A;  5FTN A;  1PQH A;  3DMR A;  2JIR A;  5FTJ A;  3FKI A;  1DMR A;  5GLF A;  3GTP A;  2JIO A;  3HKZ A;  4AOK B;  1Y1W A;  2VPX A;  2PJH B;  2JA5 A;  3HU3 A;  1I3Q A;  1I50 A;  5DYG A;  5C18 A;  2R93 A;  3GTJ A;  4KLN A;  4KO8 A;  2V45 A;  1H5N A;  2JIQ A;  2NVX A;  1R9T A;  1TWH A;  1FDI A;  1H0H A;  4AZD A;  1G8K A;  1K83 A;  2YUJ A;  2VUM A;  1IW7 D;  3PLX B;  2JA6 A;  4KDL A;  2JA7 A;  3GTM A;  3OUG A; 
#chains in the Genus database with same CATH topology
 5H4U A;  4KDI A;  2GFA A;  1E32 A;  1EU1 A;  1AA6 A;  2Q1C X;  1S3S A;  2NYA A;  2VPW A;  5FTL A;  1BW4 A;  2ENG A;  5ERG B;  3HU1 A;  5C1B A;  2NAP A;  4FFT A;  3M3G A;  3FPU A;  2KQA A;  2VPZ A;  2PWY A;  1FDO A;  2HCZ X;  1PQE A;  3TM7 B;  2R92 A;  3X2N A;  1TWF A;  4ENG A;  1ZC1 A;  2PJJ A;  4CQN A;  5DYI A;  1PYQ A;  2WB1 A;  1WC2 A;  2JIP A;  1QDN A;  2YU9 A;  3X2K A;  2E2I A;  1KQG A;  4CRZ A;  3GTK A;  3GTO A;  3IR7 A;  4AQ7 A;  2WAQ A;  5EPP A;  1PT1 A;  4CS0 A;  2Y0S A;  1SIW A;  2BH0 A;  1G8J A;  1PPY A;  2DMR A;  4FER A;  5GLY A;  2IV2 X;  2QQS A;  1SMY D;  4UC4 A;  2GAE A;  1OA7 A;  3QQ7 A;  5FTM A;  1N10 A;  3ML1 A;  2B63 A;  5GLX A;  3X2G A;  5CCB A;  2R7Z A;  1E61 A;  5T5M D;  2PMZ A;  1E5V A;  3D30 A;  1YLE A;  2PNW A;  4KOD A;  1CR5 A;  2VPY A;  1DMS A;  3X2J A;  1R7R A;  4GA6 A;  3IR6 A;  4RV0 A;  1TMO A;  3SUK A;  2KI8 A;  4DMR A;  1AW8 B;  1HD5 A;  2V3V A;  3X2P A;  4D7Z B;  2JV2 A;  2C45 A;  2A6E D;  3LGA A;  1WLF A;  4JP7 A;  2E2H A;  1Q16 A;  1Y4Z A;  1VC3 B;  3QWZ A;  5FTK A;  1KQF A;  2B25 A;  2Q18 X;  1I9G A;  2A6H D;  3FPT A;  1TWC A;  1UHD A;  3HU2 A;  3X2O A;  1SFO A;  5CCX A;  2Q1D X;  4C2M A;  1Y5I A;  1OA9 A;  3CZB A;  2JIM A;  1E60 A;  4JP6 A;  4QIW A;  3X2M A;  1PT0 A;  3H0G A;  3GTG A;  3CQZ A;  2O5J D;  1CZ5 A;  1TWA A;  5B6C A;  3FPR A;  1PYU B;  2MM2 A;  1Y1V A;  1UHE A;  1L8F A;  1YNJ D;  3QC8 A;  1ZYR D;  4JJO A;  2KY9 A;  3MB5 A;  3ZJU A;  4NOH A;  3O5A A;  4AS1 A;  1PQF A;  5T5I D;  1WCM A;  4AAY A;  5CD1 A;  5EQJ B;  2PIC A;  2NVY A;  4CRY G;  2XDP A;  2G6G A;  3TIW A;  2YVL A;  2CW0 D;  4GA5 A;  1E18 A;  1CZ4 A;  1R27 A;  2E7Z A;  3QQ8 A;  3CF2 A;  4AON B;  4AYB A;  3GTQ A;  2GF7 A;  1TWG A;  3SUL A;  2EEO B;  1OGY A;  4FG4 A;  3IR5 A;  1QCS A;  5D6W A;  3GTL A;  2QQR A;  5FTN A;  1BW3 A;  4JCW A;  1PQH A;  3DMR A;  4ARI A;  2JIR A;  5FTJ A;  3FKI A;  3SUM A;  2G5D A;  4FG2 A;  1DMR A;  5GLF A;  2BE5 D;  4ZM7 A;  3GTP A;  2JIO A;  3ENG A;  3HKZ A;  4AOK B;  1Y1W A;  2VPX A;  2PJH B;  2JA5 A;  3HU3 A;  1I3Q A;  2MM0 A;  1I50 A;  4L48 A;  3LHD A;  5DYG A;  5C18 A;  2R93 A;  3GTJ A;  3X2L A;  4KLN A;  5D6X A;  4KO8 A;  2V45 A;  4AVR A;  1H5N A;  3ZJV A;  2A69 D;  1YNN D;  2JIQ A;  2NVX A;  1O54 A;  3ZJT A;  1R9T A;  2Q1A X;  1TWH A;  3X2I A;  1FDI A;  2LW6 A;  1H0H A;  3X2H A;  5GM9 A;  4AZD A;  1G8K A;  1K83 A;  5D6Y A;  4ARC A;  2A68 D;  2YUJ A;  3BQB A;  4JS7 A;  2VUM A;  2AE0 X;  1IW7 D;  3PLX B;  2JA6 A;  3ZGZ A;  2PI8 A;  4KDL A;  2JA7 A;  2Q19 X;  4FIB A;  3SUJ A;  3GTM A;  3OUG A; 
#chains in the Genus database with same CATH homology
 4KDI A;  2GFA A;  1E32 A;  1EU1 A;  1AA6 A;  2Q1C X;  1S3S A;  2NYA A;  2VPW A;  5FTL A;  5ERG B;  3HU1 A;  5C1B A;  2NAP A;  3FPU A;  2VPZ A;  2PWY A;  1FDO A;  1PQE A;  3TM7 B;  2R92 A;  1TWF A;  1ZC1 A;  2PJJ A;  4CQN A;  5DYI A;  1PYQ A;  2WB1 A;  2JIP A;  1QDN A;  2YU9 A;  2E2I A;  1KQG A;  4CRZ A;  3GTK A;  3GTO A;  3IR7 A;  2WAQ A;  5EPP A;  1PT1 A;  4CS0 A;  2Y0S A;  1SIW A;  2DMR A;  1G8J A;  1PPY A;  2IV2 X;  2QQS A;  4UC4 A;  4AQ7 A;  1SMY D;  2GAE A;  3QQ7 A;  5FTM A;  3ML1 A;  2B63 A;  5CCB A;  2R7Z A;  1E61 A;  5T5M D;  2PMZ A;  1E5V A;  1YLE A;  2PNW A;  4KOD A;  1CR5 A;  2VPY A;  1DMS A;  1R7R A;  4GA6 A;  3IR6 A;  4RV0 A;  1TMO A;  2KI8 A;  4DMR A;  1AW8 B;  4D7Z B;  2V3V A;  2JV2 A;  2C45 A;  2A6E D;  3LGA A;  1WLF A;  2E2H A;  1Q16 A;  1Y4Z A;  1VC3 B;  3QWZ A;  5FTK A;  1KQF A;  2B25 A;  2Q18 X;  1I9G A;  2A6H D;  3FPT A;  1TWC A;  1UHD A;  3HU2 A;  1SFO A;  5CCX A;  2Q1D X;  4C2M A;  1Y5I A;  3CZB A;  2JIM A;  1E60 A;  4QIW A;  1PT0 A;  3H0G A;  3GTG A;  3CQZ A;  2O5J D;  1CZ5 A;  1TWA A;  5B6C A;  3FPR A;  1PYU B;  2MM2 A;  1Y1V A;  1UHE A;  3MB5 A;  1YNJ D;  3QC8 A;  1ZYR D;  2KY9 A;  3ZJU A;  4NOH A;  3O5A A;  4AS1 A;  1PQF A;  5T5I D;  1WCM A;  4AAY A;  5CD1 A;  5EQJ B;  2PIC A;  2NVY A;  4CRY G;  2XDP A;  2G6G A;  3TIW A;  2YVL A;  2CW0 D;  4GA5 A;  1E18 A;  1CZ4 A;  1R27 A;  2E7Z A;  3QQ8 A;  3CF2 A;  4AON B;  4AYB A;  3GTQ A;  2GF7 A;  1TWG A;  2EEO B;  1OGY A;  3IR5 A;  1QCS A;  5D6W A;  3GTL A;  2QQR A;  5FTN A;  1PQH A;  3DMR A;  4ARI A;  2JIR A;  5FTJ A;  3FKI A;  2G5D A;  1DMR A;  5GLF A;  2BE5 D;  3GTP A;  2JIO A;  3HKZ A;  4AOK B;  1Y1W A;  2VPX A;  2PJH B;  2JA5 A;  3HU3 A;  1I3Q A;  2MM0 A;  1I50 A;  3LHD A;  5DYG A;  5C18 A;  2R93 A;  3GTJ A;  4KLN A;  5D6X A;  4KO8 A;  2V45 A;  1H5N A;  3ZJV A;  2A69 D;  1YNN D;  2JIQ A;  2NVX A;  1O54 A;  3ZJT A;  1R9T A;  2Q1A X;  1TWH A;  1FDI A;  2LW6 A;  1H0H A;  4AZD A;  1G8K A;  1K83 A;  5D6Y A;  4ARC A;  2A68 D;  2YUJ A;  3BQB A;  2VUM A;  2AE0 X;  1IW7 D;  3PLX B;  2JA6 A;  3ZGZ A;  2PI8 A;  4KDL A;  2JA7 A;  2Q19 X;  4FIB A;  3GTM A;  3OUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...