5B6CA

Structural details of ufd1 binding to p97
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
GSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Details of Ufd1 Binding to p97 and Their Functional Implications in ER-Associated Degradation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5b6cA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5b6cA02
1TWCA 1TWGA 1CZ5A 1Y1VA 4DMRA 1S3SA 3PLXB 2NYAA 5C18A 5FTNA 1R9TA 5FTMA 5T5ID 2JIQA 1G8KA 2DMRA 3QC8A 2JIPA 1Y1WA 1OGYA 5C1BA 5EPPA 1WLFA 4GA6A 1Y4ZA 2Y0SA 1E5VA 1QDNA 3QQ7A 1H5NA 1PQHA 1CZ4A 5DYIA 2WAQA 1TMOA 4RV0A 4CRYG 2IV2X 2WB1A 3GTKA 1VC3B 1AA6A 1PYQA 5B6CA 2JV2A 3HKZA 2V3VA 1UHDA 2R92A 3CQZA 2VPYA 2KI8A 3IR6A 4CS0A 1TWAA 1QCSA 4KDLA 4CRZA 2B63A 5DYGA 2JA7A 1KQGA 1SFOA 3GTMA 1UHEA 1SIWA 1DMRA 2PMZA 1KQFA 2VPXA 3HU3A 3GTPA 4KLNA 4D7ZB 3DMRA 2E2IA 1Q16A 2V45A 3O5AA 4KDIA 5GLFA 3FKIA 5FTLA 1FDIA 5T5MD 1I3QA 3IR5A 4AAYA 1I50A 3TM7B 1TWFA 1YLEA 4AOKB 1PT0A 1FDOA 3GTOA 3GTQA 2JIRA 1PQEA 3QWZA 2NVYA 3OUGA 1H0HA 5FTKA 2JIOA 2R93A 3GTLA 2YUJA 1PPYA 2PJHB 1R7RA 3H0GA 4QIWA 4C2MA 1E61A 4GA5A 5FTJA 2R7ZA 3IR7A 1PQFA 4AONB 3TIWA 2YU9A 1PYUB 2NVXA 3HU2A 2C45A 1AW8B 1G8JA 3QQ8A 1PT1A 2JA6A 1Y5IA 4KO8A 2VPZA 4KODA 1E60A 1IW7D 1ZC1A 1TWHA 3ML1A 2EEOB 4AYBA 4AZDA 2E2HA 3GTJA 3GTGA 2JA5A 1K83A 2VPWA 1E32A 3CF2A 3HU1A 1R27A 2JIMA 2VUMA 2E7ZA 2NAPA 1CR5A 1DMSA 1EU1A 1WCMA 1E18A
chains in the Genus database with same CATH superfamily
1TWCA 3X2NA 1TWGA 1CZ5A 2PNWA 1Y1VA 3SUJA 1S3SA 3PLXB 4DMRA 1BW3A 2NYAA 5C18A 2B25A 5D6WA 1O54A 5FTNA 1R9TA 2A68D 1BW4A 5FTMA 5T5ID 2JIQA 1G8KA 2DMRA 3QC8A 2JIPA 1Y1WA 1OGYA 3MB5A 3ZJVA 4AS1A 5GLXA 5C1BA 4ARCA 5EPPA 3FPUA 4AQ7A 1WLFA 5H4UA 4GA6A 3D30A 1Y4ZA 3X2KA 2Y0SA 1E5VA 2PICA 1QDNA 5GLYA 4CQNA 3QQ7A 1H5NA 1PQHA 1CZ4A 2Q1CX 5CCXA 4AVRA 5DYIA 2WAQA 1TMOA 3ENGA 4RV0A 4CRYG 2IV2X 2A69D 5D6XA 1HD5A 2G6GA 3ZGZA 2WB1A 3X2IA 3GTKA 1VC3B 2BH0A 1AA6A 1PYQA 2PJJA 5B6CA 2JV2A 2A6ED 3HKZA 4ARIA 2V3VA 1UHDA 5CD1A 4FG4A 2R92A 3CQZA 2VPYA 2GF7A 2KI8A 3X2HA 1SMYD 3IR6A 3X2LA 2CW0D 2GAEA 3CZBA 4CS0A 1TWAA 1QCSA 3FPRA 1YNND 4KDLA 4CRZA 2B63A 5DYGA 2JA7A 2A6HD 3X2PA 1KQGA 1SFOA 3GTMA 1UHEA 1SIWA 2G5DA 1WC2A 2KQAA 1YNJD 1DMRA 1ZYRD 2PMZA 1KQFA 2VPXA 3HU3A 3GTPA 4ENGA 4KLNA 3FPTA 3LGAA 4D7ZB 3DMRA 4JP6A 4JP7A 2E2IA 1Q16A 2V45A 3O5AA 4KDIA 5GLFA 4UC4A 3FKIA 5FTLA 2O5JD 4FIBA 3ZJTA 1FDIA 5D6YA 5CCBA 5T5MD 1I3QA 4FG2A 3IR5A 3X2GA 4AAYA 2KY9A 3M3GA 1I50A 3TM7B 1TWFA 1YLEA 2Q1DX 4AOKB 1PT0A 1FDOA 1L8FA 2BE5D 3GTOA 3GTQA 2JIRA 1PQEA 3QWZA 2NVYA 3OUGA 1H0HA 5FTKA 2JIOA 2R93A 3GTLA 2YUJA 5GM9A 3ZJUA 1PPYA 2PJHB 1R7RA 3H0GA 1OA7A 4QIWA 4C2MA 3X2OA 2Q18X 4FERA 1E61A 4GA5A 5FTJA 3X2JA 1OA9A 2R7ZA 3IR7A 3BQBA 1PQFA 2MM2A 4AONB 4L48A 3TIWA 2YU9A 1PYUB 3X2MA 2NVXA 3HU2A 2C45A 1AW8B 1G8JA 4ZM7A 3QQ8A 1PT1A 2JA6A 3LHDA 1Y5IA 1I9GA 2PI8A 4KO8A 2VPZA 4KODA 1E60A 5EQJB 2PWYA 1IW7D 1ZC1A 1TWHA 3ML1A 4JJOA 2EEOB 4FFTA 4AYBA 4AZDA 2QQSA 5ERGB 2XDPA 2E2HA 2HCZX 3GTJA 3GTGA 2JA5A 2QQRA 2ENGA 4JS7A 2VPWA 3SUMA 2AE0X 3SUKA 1K83A 2GFAA 2LW6A 2Q1AX 1E32A 2YVLA 3CF2A 4NOHA 3HU1A 2Q19X 1R27A 2MM0A 2JIMA 3SULA 2VUMA 2E7ZA 1N10A 2NAPA 4JCWA 1CR5A 1DMSA 1EU1A 1WCMA 1E18A
chains in the Genus database with same CATH topology
1TWCA 1TWGA 1CZ5A 2PNWA 1Y1VA 4DMRA 1S3SA 3PLXB 2B25A 2NYAA 5C18A 5D6WA 1O54A 5FTNA 1R9TA 2A68D 5FTMA 5T5ID 2JIQA 1G8KA 2DMRA 3QC8A 2JIPA 1Y1WA 1OGYA 3MB5A 3ZJVA 4AS1A 5C1BA 4ARCA 5EPPA 3FPUA 4AQ7A 1WLFA 4GA6A 1Y4ZA 2Y0SA 1E5VA 2PICA 1QDNA 4CQNA 3QQ7A 1H5NA 1PQHA 1CZ4A 2Q1CX 5CCXA 5DYIA 2WAQA 1TMOA 4RV0A 4CRYG 2IV2X 2A69D 5D6XA 2G6GA 3ZGZA 2WB1A 3GTKA 1VC3B 1AA6A 1PYQA 2PJJA 5B6CA 2JV2A 2A6ED 3HKZA 4ARIA 2V3VA 1UHDA 5CD1A 2R92A 3CQZA 2VPYA 2GF7A 2KI8A 1SMYD 3IR6A 2CW0D 2GAEA 3CZBA 4CS0A 1TWAA 1QCSA 3FPRA 1YNND 4KDLA 4CRZA 2B63A 5DYGA 2JA7A 2A6HD 1KQGA 1SFOA 3GTMA 1UHEA 1SIWA 2G5DA 1YNJD 1DMRA 1ZYRD 2PMZA 1KQFA 2VPXA 3HU3A 3GTPA 4KLNA 3FPTA 3LGAA 4D7ZB 3DMRA 2E2IA 1Q16A 2V45A 3O5AA 4KDIA 5GLFA 4UC4A 3FKIA 5FTLA 2O5JD 4FIBA 3ZJTA 1FDIA 5CCBA 5T5MD 1I3QA 3IR5A 4AAYA 2KY9A 1I50A 3TM7B 1TWFA 1YLEA 2Q1DX 4AOKB 1PT0A 1FDOA 2BE5D 3GTOA 3GTQA 2JIRA 1PQEA 3QWZA 2NVYA 3OUGA 1H0HA 5FTKA 2JIOA 2R93A 3GTLA 2YUJA 3ZJUA 1PPYA 2PJHB 1R7RA 3H0GA 2Q18X 4QIWA 4C2MA 1E61A 4GA5A 5FTJA 2R7ZA 3IR7A 3BQBA 1PQFA 2MM2A 4AONB 3TIWA 2YU9A 1PYUB 2NVXA 3HU2A 2C45A 1AW8B 1G8JA 3QQ8A 1PT1A 2JA6A 3LHDA 1Y5IA 1I9GA 2PI8A 4KO8A 2VPZA 4KODA 1E60A 5EQJB 2PWYA 1IW7D 1ZC1A 1TWHA 3ML1A 2EEOB 4AYBA 4AZDA 2QQSA 5ERGB 2XDPA 2E2HA 3GTJA 3GTGA 2JA5A 2QQRA 1K83A 2Q1AX 2VPWA 2LW6A 2AE0X 2YVLA 2GFAA 1E32A 5D6YA 3CF2A 4NOHA 3HU1A 2Q19X 1R27A 2MM0A 2JIMA 2VUMA 2E7ZA 2NAPA 1CR5A 1DMSA 1EU1A 1WCMA 1E18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC A;  1TWG A;  1CZ5 A;  1Y1V A;  4DMR A;  1S3S A;  3PLX B;  2NYA A;  5C18 A;  5FTN A;  1R9T A;  5FTM A;  5T5I D;  2JIQ A;  1G8K A;  2DMR A;  3QC8 A;  2JIP A;  1Y1W A;  1OGY A;  5C1B A;  5EPP A;  1WLF A;  4GA6 A;  1Y4Z A;  2Y0S A;  1E5V A;  1QDN A;  3QQ7 A;  1H5N A;  1PQH A;  1CZ4 A;  5DYI A;  2WAQ A;  1TMO A;  4RV0 A;  4CRY G;  2IV2 X;  2WB1 A;  3GTK A;  1VC3 B;  1AA6 A;  1PYQ A;  5B6C A;  2JV2 A;  3HKZ A;  2V3V A;  1UHD A;  2R92 A;  3CQZ A;  2VPY A;  2KI8 A;  3IR6 A;  4CS0 A;  1TWA A;  1QCS A;  4KDL A;  4CRZ A;  2B63 A;  5DYG A;  2JA7 A;  1KQG A;  1SFO A;  3GTM A;  1UHE A;  1SIW A;  1DMR A;  2PMZ A;  1KQF A;  2VPX A;  3HU3 A;  3GTP A;  4KLN A;  4D7Z B;  3DMR A;  2E2I A;  1Q16 A;  2V45 A;  3O5A A;  4KDI A;  5GLF A;  3FKI A;  5FTL A;  1FDI A;  5T5M D;  1I3Q A;  3IR5 A;  4AAY A;  1I50 A;  3TM7 B;  1TWF A;  1YLE A;  4AOK B;  1PT0 A;  1FDO A;  3GTO A;  3GTQ A;  2JIR A;  1PQE A;  3QWZ A;  2NVY A;  3OUG A;  1H0H A;  5FTK A;  2JIO A;  2R93 A;  3GTL A;  2YUJ A;  1PPY A;  2PJH B;  1R7R A;  3H0G A;  4QIW A;  4C2M A;  1E61 A;  4GA5 A;  5FTJ A;  2R7Z A;  3IR7 A;  1PQF A;  4AON B;  3TIW A;  2YU9 A;  1PYU B;  2NVX A;  3HU2 A;  2C45 A;  1AW8 B;  1G8J A;  3QQ8 A;  1PT1 A;  2JA6 A;  1Y5I A;  4KO8 A;  2VPZ A;  4KOD A;  1E60 A;  1IW7 D;  1ZC1 A;  1TWH A;  3ML1 A;  2EEO B;  4AYB A;  4AZD A;  2E2H A;  3GTJ A;  3GTG A;  2JA5 A;  1K83 A;  2VPW A;  1E32 A;  3CF2 A;  3HU1 A;  1R27 A;  2JIM A;  2VUM A;  2E7Z A;  2NAP A;  1CR5 A;  1DMS A;  1EU1 A;  1WCM A;  1E18 A; 
#chains in the Genus database with same CATH topology
 1TWC A;  3X2N A;  1TWG A;  1CZ5 A;  2PNW A;  1Y1V A;  3SUJ A;  1S3S A;  3PLX B;  4DMR A;  1BW3 A;  2NYA A;  5C18 A;  2B25 A;  5D6W A;  1O54 A;  5FTN A;  1R9T A;  2A68 D;  1BW4 A;  5FTM A;  5T5I D;  2JIQ A;  1G8K A;  2DMR A;  3QC8 A;  2JIP A;  1Y1W A;  1OGY A;  3MB5 A;  3ZJV A;  4AS1 A;  5GLX A;  5C1B A;  4ARC A;  5EPP A;  3FPU A;  4AQ7 A;  1WLF A;  5H4U A;  4GA6 A;  3D30 A;  1Y4Z A;  3X2K A;  2Y0S A;  1E5V A;  2PIC A;  1QDN A;  5GLY A;  4CQN A;  3QQ7 A;  1H5N A;  1PQH A;  1CZ4 A;  2Q1C X;  5CCX A;  4AVR A;  5DYI A;  2WAQ A;  1TMO A;  3ENG A;  4RV0 A;  4CRY G;  2IV2 X;  2A69 D;  5D6X A;  1HD5 A;  2G6G A;  3ZGZ A;  2WB1 A;  3X2I A;  3GTK A;  1VC3 B;  2BH0 A;  1AA6 A;  1PYQ A;  2PJJ A;  5B6C A;  2JV2 A;  2A6E D;  3HKZ A;  4ARI A;  2V3V A;  1UHD A;  5CD1 A;  4FG4 A;  2R92 A;  3CQZ A;  2VPY A;  2GF7 A;  2KI8 A;  3X2H A;  1SMY D;  3IR6 A;  3X2L A;  2CW0 D;  2GAE A;  3CZB A;  4CS0 A;  1TWA A;  1QCS A;  3FPR A;  1YNN D;  4KDL A;  4CRZ A;  2B63 A;  5DYG A;  2JA7 A;  2A6H D;  3X2P A;  1KQG A;  1SFO A;  3GTM A;  1UHE A;  1SIW A;  2G5D A;  1WC2 A;  2KQA A;  1YNJ D;  1DMR A;  1ZYR D;  2PMZ A;  1KQF A;  2VPX A;  3HU3 A;  3GTP A;  4ENG A;  4KLN A;  3FPT A;  3LGA A;  4D7Z B;  3DMR A;  4JP6 A;  4JP7 A;  2E2I A;  1Q16 A;  2V45 A;  3O5A A;  4KDI A;  5GLF A;  4UC4 A;  3FKI A;  5FTL A;  2O5J D;  4FIB A;  3ZJT A;  1FDI A;  5D6Y A;  5CCB A;  5T5M D;  1I3Q A;  4FG2 A;  3IR5 A;  3X2G A;  4AAY A;  2KY9 A;  3M3G A;  1I50 A;  3TM7 B;  1TWF A;  1YLE A;  2Q1D X;  4AOK B;  1PT0 A;  1FDO A;  1L8F A;  2BE5 D;  3GTO A;  3GTQ A;  2JIR A;  1PQE A;  3QWZ A;  2NVY A;  3OUG A;  1H0H A;  5FTK A;  2JIO A;  2R93 A;  3GTL A;  2YUJ A;  5GM9 A;  3ZJU A;  1PPY A;  2PJH B;  1R7R A;  3H0G A;  1OA7 A;  4QIW A;  4C2M A;  3X2O A;  2Q18 X;  4FER A;  1E61 A;  4GA5 A;  5FTJ A;  3X2J A;  1OA9 A;  2R7Z A;  3IR7 A;  3BQB A;  1PQF A;  2MM2 A;  4AON B;  4L48 A;  3TIW A;  2YU9 A;  1PYU B;  3X2M A;  2NVX A;  3HU2 A;  2C45 A;  1AW8 B;  1G8J A;  4ZM7 A;  3QQ8 A;  1PT1 A;  2JA6 A;  3LHD A;  1Y5I A;  1I9G A;  2PI8 A;  4KO8 A;  2VPZ A;  4KOD A;  1E60 A;  5EQJ B;  2PWY A;  1IW7 D;  1ZC1 A;  1TWH A;  3ML1 A;  4JJO A;  2EEO B;  4FFT A;  4AYB A;  4AZD A;  2QQS A;  5ERG B;  2XDP A;  2E2H A;  2HCZ X;  3GTJ A;  3GTG A;  2JA5 A;  2QQR A;  2ENG A;  4JS7 A;  2VPW A;  3SUM A;  2AE0 X;  3SUK A;  1K83 A;  2GFA A;  2LW6 A;  2Q1A X;  1E32 A;  2YVL A;  3CF2 A;  4NOH A;  3HU1 A;  2Q19 X;  1R27 A;  2MM0 A;  2JIM A;  3SUL A;  2VUM A;  2E7Z A;  1N10 A;  2NAP A;  4JCW A;  1CR5 A;  1DMS A;  1EU1 A;  1WCM A;  1E18 A; 
#chains in the Genus database with same CATH homology
 1TWC A;  1TWG A;  1CZ5 A;  2PNW A;  1Y1V A;  4DMR A;  1S3S A;  3PLX B;  2B25 A;  2NYA A;  5C18 A;  5D6W A;  1O54 A;  5FTN A;  1R9T A;  2A68 D;  5FTM A;  5T5I D;  2JIQ A;  1G8K A;  2DMR A;  3QC8 A;  2JIP A;  1Y1W A;  1OGY A;  3MB5 A;  3ZJV A;  4AS1 A;  5C1B A;  4ARC A;  5EPP A;  3FPU A;  4AQ7 A;  1WLF A;  4GA6 A;  1Y4Z A;  2Y0S A;  1E5V A;  2PIC A;  1QDN A;  4CQN A;  3QQ7 A;  1H5N A;  1PQH A;  1CZ4 A;  2Q1C X;  5CCX A;  5DYI A;  2WAQ A;  1TMO A;  4RV0 A;  4CRY G;  2IV2 X;  2A69 D;  5D6X A;  2G6G A;  3ZGZ A;  2WB1 A;  3GTK A;  1VC3 B;  1AA6 A;  1PYQ A;  2PJJ A;  5B6C A;  2JV2 A;  2A6E D;  3HKZ A;  4ARI A;  2V3V A;  1UHD A;  5CD1 A;  2R92 A;  3CQZ A;  2VPY A;  2GF7 A;  2KI8 A;  1SMY D;  3IR6 A;  2CW0 D;  2GAE A;  3CZB A;  4CS0 A;  1TWA A;  1QCS A;  3FPR A;  1YNN D;  4KDL A;  4CRZ A;  2B63 A;  5DYG A;  2JA7 A;  2A6H D;  1KQG A;  1SFO A;  3GTM A;  1UHE A;  1SIW A;  2G5D A;  1YNJ D;  1DMR A;  1ZYR D;  2PMZ A;  1KQF A;  2VPX A;  3HU3 A;  3GTP A;  4KLN A;  3FPT A;  3LGA A;  4D7Z B;  3DMR A;  2E2I A;  1Q16 A;  2V45 A;  3O5A A;  4KDI A;  5GLF A;  4UC4 A;  3FKI A;  5FTL A;  2O5J D;  4FIB A;  3ZJT A;  1FDI A;  5CCB A;  5T5M D;  1I3Q A;  3IR5 A;  4AAY A;  2KY9 A;  1I50 A;  3TM7 B;  1TWF A;  1YLE A;  2Q1D X;  4AOK B;  1PT0 A;  1FDO A;  2BE5 D;  3GTO A;  3GTQ A;  2JIR A;  1PQE A;  3QWZ A;  2NVY A;  3OUG A;  1H0H A;  5FTK A;  2JIO A;  2R93 A;  3GTL A;  2YUJ A;  3ZJU A;  1PPY A;  2PJH B;  1R7R A;  3H0G A;  2Q18 X;  4QIW A;  4C2M A;  1E61 A;  4GA5 A;  5FTJ A;  2R7Z A;  3IR7 A;  3BQB A;  1PQF A;  2MM2 A;  4AON B;  3TIW A;  2YU9 A;  1PYU B;  2NVX A;  3HU2 A;  2C45 A;  1AW8 B;  1G8J A;  3QQ8 A;  1PT1 A;  2JA6 A;  3LHD A;  1Y5I A;  1I9G A;  2PI8 A;  4KO8 A;  2VPZ A;  4KOD A;  1E60 A;  5EQJ B;  2PWY A;  1IW7 D;  1ZC1 A;  1TWH A;  3ML1 A;  2EEO B;  4AYB A;  4AZD A;  2QQS A;  5ERG B;  2XDP A;  2E2H A;  3GTJ A;  3GTG A;  2JA5 A;  2QQR A;  1K83 A;  2Q1A X;  2VPW A;  2LW6 A;  2AE0 X;  2YVL A;  2GFA A;  1E32 A;  5D6Y A;  3CF2 A;  4NOH A;  3HU1 A;  2Q19 X;  1R27 A;  2MM0 A;  2JIM A;  2VUM A;  2E7Z A;  2NAP A;  1CR5 A;  1DMS A;  1EU1 A;  1WCM A;  1E18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...