5B6CA

Structural details of ufd1 binding to p97
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
b'GSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
molecule tags Hydrolase/protein binding
source organism Homo sapiens
publication title Structural Details of Ufd1 Binding to p97 and Their Functional Implications in ER-Associated Degradation
pubmed doi rcsb
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5b6cA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5b6cA02
4KDLA 5FTNA 1TWCA 1H0HA 1UHDA 1PQFA 1QDNA 4KO8A 1G8JA 3TIWA 5FTMA 1CZ5A 5DYGA 4KLNA 1I3QA 2YU9A 1SIWA 4KDIA 4RV0A 3CF2A 1WCMA 2IV2X 2V3VA 4GA6A 1PYUB 3OUGA 1CZ4A 2VUMA 5B6CA 1YLEA 1KQFA 2VPXA 3GTLA 3GTQA 1ZC1A 4GA5A 4CRYG 2JIMA 4AZDA 5FTKA 3TM7B 1E18A 3HU1A 3FKIA 1PT0A 1UHEA 3QWZA 3GTJA 3ML1A 4DMRA 4QIWA 2PJHB 5T5ID 4AYBA 1K83A 2VPZA 2YUJA 1FDIA 1TWGA 3DMRA 3HU2A 1TWHA 1E5VA 1Q16A 1PQHA 1VC3B 5EPPA 3CQZA 2JIPA 1QCSA 1FDOA 1SFOA 2NAPA 3GTKA 3GTOA 1PYQA 2DMRA 5FTLA 1PT1A 3HKZA 1TWAA 2JV2A 5DYIA 4CS0A 4AOKB 2R92A 2JA7A 1DMRA 1CR5A 4CRZA 2JA5A 4AAYA 2VPYA 1R9TA 2JIOA 2EEOB 1G8KA 1I50A 3QQ7A 1KQGA 2JA6A 1PQEA 1IW7D 3IR5A 1TWFA 5T5MD 2NVYA 4D7ZB 2R7ZA 5FTJA 3QC8A 1R27A 3IR6A 5GLFA 2V45A 4KODA 2NYAA 1S3SA 1OGYA 1AW8B 2KI8A 2JIRA 1Y1VA 1E61A 3IR7A 2Y0SA 5C1BA 1DMSA 2E7ZA 1WLFA 1EU1A 2VPWA 3GTMA 1Y5IA 3GTPA 2NVXA 1E32A 2B63A 3O5AA 5C18A 1H5NA 3HU3A 4AONB 2WAQA 2E2IA 2JIQA 2PMZA 3QQ8A 3GTGA 2R93A 1Y4ZA 3PLXB 1TMOA 1E60A 1PPYA 1R7RA 1AA6A 3H0GA 2E2HA 2WB1A 1Y1WA 4C2MA 2C45A
chains in the Genus database with same CATH superfamily
4L48A 3X2PA 4KDLA 4ARCA 5FTNA 2Q1CX 4JP7A 1TWCA 4FG4A 1H0HA 1UHDA 1PQFA 1QDNA 4KO8A 1G8JA 3TIWA 5FTMA 1CZ5A 3ZJTA 5DYGA 3FPUA 5GLYA 4KLNA 1I3QA 2YU9A 2QQSA 1SIWA 4KDIA 3FPTA 4RV0A 3CF2A 1WCMA 2IV2X 1L8FA 2V3VA 2LW6A 2A69D 1OA7A 1PYUB 4GA6A 3OUGA 3X2GA 1CZ4A 2PJJA 2VUMA 5B6CA 1YLEA 5GLXA 1KQFA 1I9GA 2VPXA 3GTLA 1ZC1A 3GTQA 4GA5A 4CRYG 2JIMA 4AZDA 1WC2A 5FTKA 3TM7B 2BH0A 1E18A 3HU1A 3FKIA 1PT0A 1HD5A 1UHEA 3QWZA 3X2IA 4ENGA 3GTJA 3FPRA 4AQ7A 3SUMA 2ENGA 3CZBA 3ML1A 4QIWA 4DMRA 3LHDA 5ERGB 5CCBA 1SMYD 2PJHB 2AE0X 5T5ID 2PWYA 5GM9A 5EQJB 3X2HA 4AYBA 2Q19X 2Q1AX 1K83A 2VPZA 1N10A 2O5JD 2YUJA 3X2JA 1FDIA 3SUKA 1TWGA 1TWHA 3DMRA 3HU2A 1E5VA 1Q16A 1OA9A 1PQHA 1VC3B 5EPPA 3CQZA 2JIPA 1QCSA 1BW3A 1FDOA 4AVRA 1SFOA 2Q1DX 5CCXA 2NAPA 3X2OA 3GTKA 3GTOA 5D6XA 1PYQA 2DMRA 5FTLA 2G6GA 5D6WA 1PT1A 3LGAA 2GAEA 3HKZA 2HCZX 1TWAA 2JV2A 5DYIA 2YVLA 4CS0A 4AOKB 2R92A 2JA7A 1DMRA 1CR5A 4CRZA 2JA5A 4CQNA 4AAYA 2CW0D 2VPYA 4AS1A 1R9TA 2MM2A 2JIOA 2EEOB 1G8KA 3X2LA 4UC4A 1I50A 3QQ7A 4JP6A 1KQGA 2JA6A 3SUJA 1PQEA 5D6YA 1IW7D 3IR5A 1TWFA 5T5MD 2NVYA 5H4UA 4D7ZB 2MM0A 3X2KA 2R7ZA 5FTJA 3QC8A 1R27A 3X2MA 3D30A 1YNND 3IR6A 2BE5D 2V45A 4NOHA 2KQAA 4KODA 5GLFA 4ARIA 2A68D 2NYAA 4FFTA 4FG2A 2PNWA 1S3SA 1OGYA 1AW8B 2PICA 4JCWA 2G5DA 2KI8A 2JIRA 1Y1VA 1E61A 3IR7A 2Y0SA 5C1BA 5CD1A 1DMSA 4FERA 2E7ZA 1WLFA 1EU1A 2VPWA 1ZYRD 2QQRA 2B25A 3ZJUA 3GTMA 1Y5IA 3GTPA 2NVXA 1E32A 2B63A 3O5AA 5C18A 3ENGA 3BQBA 1H5NA 2GF7A 3HU3A 4AONB 2WAQA 3M3GA 2E2IA 2GFAA 3ZGZA 2JIQA 2PMZA 3QQ8A 3X2NA 4JS7A 3GTGA 2R93A 1YNJD 2Q18X 1Y4ZA 3PLXB 2A6ED 4FIBA 3MB5A 1TMOA 1E60A 4JJOA 1PPYA 2KY9A 4ZM7A 3ZJVA 3SULA 1R7RA 2A6HD 1AA6A 3H0GA 1BW4A 2E2HA 1O54A 2XDPA 2PI8A 2WB1A 1Y1WA 4C2MA 2C45A
chains in the Genus database with same CATH topology
4KDLA 4ARCA 5FTNA 2Q1CX 1TWCA 1H0HA 1UHDA 1PQFA 1QDNA 4KO8A 1G8JA 3TIWA 5FTMA 1CZ5A 3ZJTA 5DYGA 3FPUA 4KLNA 1I3QA 2YU9A 2QQSA 1SIWA 4KDIA 3FPTA 4RV0A 3CF2A 1WCMA 2IV2X 2V3VA 2LW6A 2A69D 4GA6A 1PYUB 3OUGA 1CZ4A 2PJJA 2VUMA 5B6CA 1YLEA 1KQFA 1I9GA 2VPXA 3GTLA 1ZC1A 3GTQA 4GA5A 4CRYG 2JIMA 4AZDA 5FTKA 3TM7B 1E18A 3HU1A 3FKIA 1PT0A 1UHEA 3QWZA 3GTJA 3FPRA 4AQ7A 3ML1A 3CZBA 4QIWA 4DMRA 3LHDA 5ERGB 5CCBA 1SMYD 2PJHB 2AE0X 5T5ID 2PWYA 5EQJB 4AYBA 2Q19X 2Q1AX 1K83A 2VPZA 2O5JD 2YUJA 1FDIA 1TWGA 1TWHA 3DMRA 3HU2A 1E5VA 1Q16A 1PQHA 1VC3B 5EPPA 3CQZA 2JIPA 1QCSA 1FDOA 1SFOA 2Q1DX 5CCXA 2NAPA 3GTKA 3GTOA 5D6XA 1PYQA 2DMRA 5FTLA 2G6GA 5D6WA 1PT1A 3LGAA 2GAEA 3HKZA 1TWAA 2JV2A 5DYIA 2YVLA 4CS0A 4AOKB 2R92A 2JA7A 1DMRA 1CR5A 4CRZA 2JA5A 4CQNA 4AAYA 2CW0D 2VPYA 4AS1A 1R9TA 2MM2A 2JIOA 2EEOB 1G8KA 4UC4A 1I50A 3QQ7A 1KQGA 2JA6A 5D6YA 1PQEA 1IW7D 3IR5A 1TWFA 5T5MD 2NVYA 4D7ZB 2MM0A 2R7ZA 5FTJA 3QC8A 1R27A 3IR6A 1YNND 5GLFA 2BE5D 2V45A 4NOHA 4KODA 4ARIA 2A68D 2NYAA 2PNWA 1S3SA 1OGYA 1AW8B 2PICA 2G5DA 2KI8A 2JIRA 1Y1VA 1E61A 3IR7A 2Y0SA 5C1BA 5CD1A 1DMSA 2E7ZA 1WLFA 1EU1A 2VPWA 1ZYRD 2QQRA 2B25A 3ZJUA 3GTMA 1Y5IA 3GTPA 2NVXA 1E32A 2B63A 3O5AA 5C18A 3BQBA 1H5NA 2GF7A 3HU3A 4AONB 2WAQA 2E2IA 2GFAA 3ZGZA 2JIQA 2PMZA 3QQ8A 3GTGA 2R93A 1YNJD 2Q18X 1Y4ZA 3PLXB 2A6ED 4FIBA 3MB5A 1TMOA 1E60A 1PPYA 2KY9A 3ZJVA 1R7RA 2A6HD 1AA6A 3H0GA 1O54A 2E2HA 2XDPA 2PI8A 2WB1A 1Y1WA 4C2MA 2C45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDL A;  5FTN A;  1TWC A;  1H0H A;  1UHD A;  1PQF A;  1QDN A;  4KO8 A;  1G8J A;  3TIW A;  5FTM A;  1CZ5 A;  5DYG A;  4KLN A;  1I3Q A;  2YU9 A;  1SIW A;  4KDI A;  4RV0 A;  3CF2 A;  1WCM A;  2IV2 X;  2V3V A;  4GA6 A;  1PYU B;  3OUG A;  1CZ4 A;  2VUM A;  5B6C A;  1YLE A;  1KQF A;  2VPX A;  3GTL A;  3GTQ A;  1ZC1 A;  4GA5 A;  4CRY G;  2JIM A;  4AZD A;  5FTK A;  3TM7 B;  1E18 A;  3HU1 A;  3FKI A;  1PT0 A;  1UHE A;  3QWZ A;  3GTJ A;  3ML1 A;  4DMR A;  4QIW A;  2PJH B;  5T5I D;  4AYB A;  1K83 A;  2VPZ A;  2YUJ A;  1FDI A;  1TWG A;  3DMR A;  3HU2 A;  1TWH A;  1E5V A;  1Q16 A;  1PQH A;  1VC3 B;  5EPP A;  3CQZ A;  2JIP A;  1QCS A;  1FDO A;  1SFO A;  2NAP A;  3GTK A;  3GTO A;  1PYQ A;  2DMR A;  5FTL A;  1PT1 A;  3HKZ A;  1TWA A;  2JV2 A;  5DYI A;  4CS0 A;  4AOK B;  2R92 A;  2JA7 A;  1DMR A;  1CR5 A;  4CRZ A;  2JA5 A;  4AAY A;  2VPY A;  1R9T A;  2JIO A;  2EEO B;  1G8K A;  1I50 A;  3QQ7 A;  1KQG A;  2JA6 A;  1PQE A;  1IW7 D;  3IR5 A;  1TWF A;  5T5M D;  2NVY A;  4D7Z B;  2R7Z A;  5FTJ A;  3QC8 A;  1R27 A;  3IR6 A;  5GLF A;  2V45 A;  4KOD A;  2NYA A;  1S3S A;  1OGY A;  1AW8 B;  2KI8 A;  2JIR A;  1Y1V A;  1E61 A;  3IR7 A;  2Y0S A;  5C1B A;  1DMS A;  2E7Z A;  1WLF A;  1EU1 A;  2VPW A;  3GTM A;  1Y5I A;  3GTP A;  2NVX A;  1E32 A;  2B63 A;  3O5A A;  5C18 A;  1H5N A;  3HU3 A;  4AON B;  2WAQ A;  2E2I A;  2JIQ A;  2PMZ A;  3QQ8 A;  3GTG A;  2R93 A;  1Y4Z A;  3PLX B;  1TMO A;  1E60 A;  1PPY A;  1R7R A;  1AA6 A;  3H0G A;  2E2H A;  2WB1 A;  1Y1W A;  4C2M A;  2C45 A; 
#chains in the Genus database with same CATH topology
 4L48 A;  3X2P A;  4KDL A;  4ARC A;  5FTN A;  2Q1C X;  4JP7 A;  1TWC A;  4FG4 A;  1H0H A;  1UHD A;  1PQF A;  1QDN A;  4KO8 A;  1G8J A;  3TIW A;  5FTM A;  1CZ5 A;  3ZJT A;  5DYG A;  3FPU A;  5GLY A;  4KLN A;  1I3Q A;  2YU9 A;  2QQS A;  1SIW A;  4KDI A;  3FPT A;  4RV0 A;  3CF2 A;  1WCM A;  2IV2 X;  1L8F A;  2V3V A;  2LW6 A;  2A69 D;  1OA7 A;  1PYU B;  4GA6 A;  3OUG A;  3X2G A;  1CZ4 A;  2PJJ A;  2VUM A;  5B6C A;  1YLE A;  5GLX A;  1KQF A;  1I9G A;  2VPX A;  3GTL A;  1ZC1 A;  3GTQ A;  4GA5 A;  4CRY G;  2JIM A;  4AZD A;  1WC2 A;  5FTK A;  3TM7 B;  2BH0 A;  1E18 A;  3HU1 A;  3FKI A;  1PT0 A;  1HD5 A;  1UHE A;  3QWZ A;  3X2I A;  4ENG A;  3GTJ A;  3FPR A;  4AQ7 A;  3SUM A;  2ENG A;  3CZB A;  3ML1 A;  4QIW A;  4DMR A;  3LHD A;  5ERG B;  5CCB A;  1SMY D;  2PJH B;  2AE0 X;  5T5I D;  2PWY A;  5GM9 A;  5EQJ B;  3X2H A;  4AYB A;  2Q19 X;  2Q1A X;  1K83 A;  2VPZ A;  1N10 A;  2O5J D;  2YUJ A;  3X2J A;  1FDI A;  3SUK A;  1TWG A;  1TWH A;  3DMR A;  3HU2 A;  1E5V A;  1Q16 A;  1OA9 A;  1PQH A;  1VC3 B;  5EPP A;  3CQZ A;  2JIP A;  1QCS A;  1BW3 A;  1FDO A;  4AVR A;  1SFO A;  2Q1D X;  5CCX A;  2NAP A;  3X2O A;  3GTK A;  3GTO A;  5D6X A;  1PYQ A;  2DMR A;  5FTL A;  2G6G A;  5D6W A;  1PT1 A;  3LGA A;  2GAE A;  3HKZ A;  2HCZ X;  1TWA A;  2JV2 A;  5DYI A;  2YVL A;  4CS0 A;  4AOK B;  2R92 A;  2JA7 A;  1DMR A;  1CR5 A;  4CRZ A;  2JA5 A;  4CQN A;  4AAY A;  2CW0 D;  2VPY A;  4AS1 A;  1R9T A;  2MM2 A;  2JIO A;  2EEO B;  1G8K A;  3X2L A;  4UC4 A;  1I50 A;  3QQ7 A;  4JP6 A;  1KQG A;  2JA6 A;  3SUJ A;  1PQE A;  5D6Y A;  1IW7 D;  3IR5 A;  1TWF A;  5T5M D;  2NVY A;  5H4U A;  4D7Z B;  2MM0 A;  3X2K A;  2R7Z A;  5FTJ A;  3QC8 A;  1R27 A;  3X2M A;  3D30 A;  1YNN D;  3IR6 A;  2BE5 D;  2V45 A;  4NOH A;  2KQA A;  4KOD A;  5GLF A;  4ARI A;  2A68 D;  2NYA A;  4FFT A;  4FG2 A;  2PNW A;  1S3S A;  1OGY A;  1AW8 B;  2PIC A;  4JCW A;  2G5D A;  2KI8 A;  2JIR A;  1Y1V A;  1E61 A;  3IR7 A;  2Y0S A;  5C1B A;  5CD1 A;  1DMS A;  4FER A;  2E7Z A;  1WLF A;  1EU1 A;  2VPW A;  1ZYR D;  2QQR A;  2B25 A;  3ZJU A;  3GTM A;  1Y5I A;  3GTP A;  2NVX A;  1E32 A;  2B63 A;  3O5A A;  5C18 A;  3ENG A;  3BQB A;  1H5N A;  2GF7 A;  3HU3 A;  4AON B;  2WAQ A;  3M3G A;  2E2I A;  2GFA A;  3ZGZ A;  2JIQ A;  2PMZ A;  3QQ8 A;  3X2N A;  4JS7 A;  3GTG A;  2R93 A;  1YNJ D;  2Q18 X;  1Y4Z A;  3PLX B;  2A6E D;  4FIB A;  3MB5 A;  1TMO A;  1E60 A;  4JJO A;  1PPY A;  2KY9 A;  4ZM7 A;  3ZJV A;  3SUL A;  1R7R A;  2A6H D;  1AA6 A;  3H0G A;  1BW4 A;  2E2H A;  1O54 A;  2XDP A;  2PI8 A;  2WB1 A;  1Y1W A;  4C2M A;  2C45 A; 
#chains in the Genus database with same CATH homology
 4KDL A;  4ARC A;  5FTN A;  2Q1C X;  1TWC A;  1H0H A;  1UHD A;  1PQF A;  1QDN A;  4KO8 A;  1G8J A;  3TIW A;  5FTM A;  1CZ5 A;  3ZJT A;  5DYG A;  3FPU A;  4KLN A;  1I3Q A;  2YU9 A;  2QQS A;  1SIW A;  4KDI A;  3FPT A;  4RV0 A;  3CF2 A;  1WCM A;  2IV2 X;  2V3V A;  2LW6 A;  2A69 D;  4GA6 A;  1PYU B;  3OUG A;  1CZ4 A;  2PJJ A;  2VUM A;  5B6C A;  1YLE A;  1KQF A;  1I9G A;  2VPX A;  3GTL A;  1ZC1 A;  3GTQ A;  4GA5 A;  4CRY G;  2JIM A;  4AZD A;  5FTK A;  3TM7 B;  1E18 A;  3HU1 A;  3FKI A;  1PT0 A;  1UHE A;  3QWZ A;  3GTJ A;  3FPR A;  4AQ7 A;  3ML1 A;  3CZB A;  4QIW A;  4DMR A;  3LHD A;  5ERG B;  5CCB A;  1SMY D;  2PJH B;  2AE0 X;  5T5I D;  2PWY A;  5EQJ B;  4AYB A;  2Q19 X;  2Q1A X;  1K83 A;  2VPZ A;  2O5J D;  2YUJ A;  1FDI A;  1TWG A;  1TWH A;  3DMR A;  3HU2 A;  1E5V A;  1Q16 A;  1PQH A;  1VC3 B;  5EPP A;  3CQZ A;  2JIP A;  1QCS A;  1FDO A;  1SFO A;  2Q1D X;  5CCX A;  2NAP A;  3GTK A;  3GTO A;  5D6X A;  1PYQ A;  2DMR A;  5FTL A;  2G6G A;  5D6W A;  1PT1 A;  3LGA A;  2GAE A;  3HKZ A;  1TWA A;  2JV2 A;  5DYI A;  2YVL A;  4CS0 A;  4AOK B;  2R92 A;  2JA7 A;  1DMR A;  1CR5 A;  4CRZ A;  2JA5 A;  4CQN A;  4AAY A;  2CW0 D;  2VPY A;  4AS1 A;  1R9T A;  2MM2 A;  2JIO A;  2EEO B;  1G8K A;  4UC4 A;  1I50 A;  3QQ7 A;  1KQG A;  2JA6 A;  5D6Y A;  1PQE A;  1IW7 D;  3IR5 A;  1TWF A;  5T5M D;  2NVY A;  4D7Z B;  2MM0 A;  2R7Z A;  5FTJ A;  3QC8 A;  1R27 A;  3IR6 A;  1YNN D;  5GLF A;  2BE5 D;  2V45 A;  4NOH A;  4KOD A;  4ARI A;  2A68 D;  2NYA A;  2PNW A;  1S3S A;  1OGY A;  1AW8 B;  2PIC A;  2G5D A;  2KI8 A;  2JIR A;  1Y1V A;  1E61 A;  3IR7 A;  2Y0S A;  5C1B A;  5CD1 A;  1DMS A;  2E7Z A;  1WLF A;  1EU1 A;  2VPW A;  1ZYR D;  2QQR A;  2B25 A;  3ZJU A;  3GTM A;  1Y5I A;  3GTP A;  2NVX A;  1E32 A;  2B63 A;  3O5A A;  5C18 A;  3BQB A;  1H5N A;  2GF7 A;  3HU3 A;  4AON B;  2WAQ A;  2E2I A;  2GFA A;  3ZGZ A;  2JIQ A;  2PMZ A;  3QQ8 A;  3GTG A;  2R93 A;  1YNJ D;  2Q18 X;  1Y4Z A;  3PLX B;  2A6E D;  4FIB A;  3MB5 A;  1TMO A;  1E60 A;  1PPY A;  2KY9 A;  3ZJV A;  1R7R A;  2A6H D;  1AA6 A;  3H0G A;  1O54 A;  2E2H A;  2XDP A;  2PI8 A;  2WB1 A;  1Y1W A;  4C2M A;  2C45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...