5B6CA

Structural details of ufd1 binding to p97
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
b'GSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Details of Ufd1 Binding to p97 and Their Functional Implications in ER-Associated Degradation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5b6cA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5b6cA02
1QDNA 2JA7A 3GTJA 5EPPA 3GTKA 4AYBA 1PQEA 4CS0A 1PYUB 1DMRA 3O5AA 5FTLA 1H5NA 1E32A 1AW8B 2WB1A 3CF2A 4GA5A 5GLFA 4C2MA 5DYIA 2WAQA 2C45A 2E2IA 2R93A 2R7ZA 4KO8A 2NVXA 2Y0SA 2VPZA 5T5ID 1G8JA 2E7ZA 3HU1A 5C18A 3ML1A 2NYAA 3IR5A 1Y4ZA 4CRYG 2JIQA 3HU3A 1K83A 1FDOA 2E2HA 3IR7A 4KDIA 1I3QA 2YU9A 2VPXA 3OUGA 1TMOA 1Y1VA 2VPYA 1WLFA 3QWZA 4GA6A 1TWHA 1UHDA 3GTQA 1R7RA 1PT0A 3GTGA 2PMZA 4CRZA 2VUMA 3CQZA 3HKZA 1CZ4A 2JIPA 4QIWA 1DMSA 1UHEA 2YUJA 1E61A 1E5VA 1G8KA 1R9TA 3PLXB 3TM7B 2PJHB 2JIOA 4KDLA 3H0GA 1TWAA 3IR6A 2V3VA 2NAPA 1WCMA 3GTPA 4KODA 1IW7D 5C1BA 2JIMA 1CZ5A 1Y1WA 1I50A 2V45A 5FTKA 2JIRA 1PQHA 3HU2A 3TIWA 4AAYA 3GTMA 2R92A 2JA5A 1H0HA 2B63A 1E18A 4RV0A 1YLEA 3DMRA 1TWCA 5FTJA 5DYGA 2JA6A 1FDIA 2NVYA 1SIWA 1TWFA 1SFOA 1KQGA 3FKIA 4AONB 1ZC1A 1OGYA 1KQFA 1EU1A 5T5MD 2VPWA 1Q16A 3QQ7A 1TWGA 4AOKB 2EEOB 1PQFA 3QQ8A 3GTLA 3QC8A 4AZDA 3GTOA 1CR5A 5B6CA 1R27A 2IV2X 1PT1A 4KLNA 1PPYA 5FTMA 2JV2A 5FTNA 1S3SA 1AA6A 1PYQA 2DMRA 4DMRA 2KI8A 1VC3B 1QCSA 1Y5IA 1E60A 4D7ZB
chains in the Genus database with same CATH superfamily
1OA9A 1QDNA 2JA7A 3GTJA 5EPPA 3GTKA 1I9GA 1BW3A 4AYBA 2GAEA 1ZYRD 1PQEA 4CS0A 1PYUB 1DMRA 1YNJD 3X2KA 4ARIA 3O5AA 5FTLA 1H5NA 1E32A 3X2IA 2QQSA 1AW8B 2WB1A 3CF2A 3CZBA 4GA5A 5GLFA 4C2MA 2XDPA 5DYIA 5GLXA 2WAQA 2C45A 2E2IA 2KQAA 2R93A 2Q1AX 4JS7A 1HD5A 4KO8A 2R7ZA 2PWYA 2BE5D 2CW0D 2Y0SA 5GLYA 2NVXA 2QQRA 2VPZA 5T5ID 4AS1A 1G8JA 2E7ZA 3HU1A 3SULA 3ML1A 2NYAA 3D30A 1Y4ZA 3IR5A 3X2HA 2JIQA 3HU3A 3SUMA 4CRYG 1FDOA 1K83A 3IR7A 2E2HA 2A6HD 1O54A 2Q1CX 4KDIA 1I3QA 4L48A 2YU9A 2AE0X 4AVRA 2VPXA 2ENGA 3OUGA 2A69D 1TMOA 1Y1VA 2VPYA 5D6WA 1WLFA 2A68D 3QWZA 4GA6A 3FPTA 2BH0A 1TWHA 1UHDA 3GTQA 4FIBA 1R7RA 5EQJB 1PT0A 3GTGA 2PMZA 4CRZA 2Q19X 2VUMA 3CQZA 4ARCA 3HKZA 1CZ4A 2JIPA 2GFAA 4QIWA 1DMSA 4ZM7A 4AQ7A 1UHEA 2YUJA 1E61A 1E5VA 1G8KA 1R9TA 3LGAA 3FPRA 3PLXB 3TM7B 4FG2A 3ZGZA 2PJHB 2JIOA 4KDLA 3H0GA 1TWAA 3IR6A 1OA7A 2V3VA 2NAPA 1WCMA 5GM9A 3GTPA 4KODA 1IW7D 5C1BA 1BW4A 2JIMA 1CZ5A 1Y1WA 1I50A 2V45A 3X2PA 5CCXA 1YNND 2JIRA 5FTKA 1PQHA 3HU2A 5CD1A 3TIWA 4AAYA 3GTMA 2R92A 2JA5A 2KY9A 1H0HA 4JP7A 2B63A 1E18A 3FPUA 4RV0A 2G5DA 1YLEA 3DMRA 1TWCA 5FTJA 5DYGA 2JA6A 2LW6A 4JJOA 1FDIA 3X2JA 2NVYA 4FERA 3ZJTA 1SIWA 1TWFA 2PI8A 3SUJA 1SFOA 4JCWA 1KQGA 3FKIA 5CCBA 4AONB 1ZC1A 3ZJVA 1OGYA 2HCZX 5ERGB 1WC2A 3X2GA 1KQFA 1N10A 1EU1A 5T5MD 2VPWA 4NOHA 5H4UA 4ENGA 1Q16A 2B25A 3QQ7A 1TWGA 3MB5A 4AOKB 2EEOB 1PQFA 3BQBA 3QQ8A 3GTLA 4FFTA 3X2OA 2PICA 3X2NA 3SUKA 2PJJA 3QC8A 5C18A 4AZDA 3GTOA 5D6YA 1CR5A 3ENGA 5B6CA 3LHDA 1R27A 2IV2X 1PT1A 4KLNA 2MM0A 2YVLA 1PPYA 3X2MA 2G6GA 2A6ED 5FTMA 4UC4A 2JV2A 5FTNA 4JP6A 2PNWA 2O5JD 1S3SA 3M3GA 4FG4A 3ZJUA 3X2LA 1AA6A 1PYQA 2DMRA 1SMYD 4DMRA 4CQNA 2MM2A 2Q18X 2KI8A 2Q1DX 1VC3B 1L8FA 1QCSA 1Y5IA 1E60A 4D7ZB 5D6XA 2GF7A
chains in the Genus database with same CATH topology
1QDNA 2JA7A 3GTJA 5EPPA 3GTKA 4AYBA 2GAEA 1ZYRD 1PQEA 4CS0A 1PYUB 1DMRA 1YNJD 3O5AA 5FTLA 1H5NA 1E32A 2QQSA 1AW8B 2WB1A 3CF2A 3CZBA 4GA5A 5GLFA 4C2MA 2XDPA 5DYIA 2WAQA 2C45A 2E2IA 2R93A 2Q1AX 2R7ZA 4KO8A 2PWYA 2BE5D 2CW0D 2Y0SA 2NVXA 2QQRA 4AS1A 2VPZA 5T5ID 4ARIA 1G8JA 2E7ZA 3HU1A 5C18A 3ML1A 2NYAA 3IR5A 1Y4ZA 1I9GA 4CRYG 2JIQA 3HU3A 1K83A 1FDOA 2E2HA 3IR7A 2A6HD 1O54A 2Q1CX 4KDIA 1I3QA 2YU9A 2AE0X 2VPXA 3OUGA 2A69D 1TMOA 1Y1VA 2VPYA 5D6WA 1WLFA 2A68D 3QWZA 4GA6A 3FPTA 1TWHA 1UHDA 3GTQA 4FIBA 1R7RA 5EQJB 1PT0A 3GTGA 2PMZA 4CRZA 2Q19X 2VUMA 3CQZA 4ARCA 3HKZA 1CZ4A 2JIPA 2GFAA 4QIWA 1DMSA 4AQ7A 1UHEA 2YUJA 1E61A 1E5VA 1G8KA 1R9TA 3LGAA 3FPRA 3PLXB 3TM7B 3ZGZA 2PJHB 2JIOA 4KDLA 3H0GA 1TWAA 3IR6A 2V3VA 2NAPA 1WCMA 3GTPA 4KODA 1IW7D 5C1BA 2JIMA 1CZ5A 1Y1WA 1I50A 2V45A 5CCXA 1YNND 2JIRA 5FTKA 1PQHA 3HU2A 5CD1A 3TIWA 4AAYA 3GTMA 2R92A 2JA5A 2KY9A 1H0HA 2B63A 1E18A 3FPUA 4RV0A 2G5DA 1YLEA 3DMRA 1TWCA 5FTJA 5DYGA 2JA6A 2LW6A 1FDIA 2NVYA 3ZJTA 1SIWA 1TWFA 2PI8A 1SFOA 1KQGA 3FKIA 5CCBA 4AONB 1ZC1A 3ZJVA 1OGYA 5ERGB 1KQFA 1EU1A 5T5MD 2VPWA 4NOHA 1Q16A 2B25A 3QQ7A 1TWGA 3MB5A 4AOKB 2EEOB 1PQFA 3BQBA 3QQ8A 3GTLA 2PICA 2PJJA 3QC8A 5D6YA 4AZDA 3GTOA 1CR5A 5B6CA 3LHDA 1R27A 2IV2X 1PT1A 4KLNA 2MM0A 2YVLA 1PPYA 2G6GA 2A6ED 5FTMA 4UC4A 2JV2A 5FTNA 2PNWA 2O5JD 1S3SA 3ZJUA 1AA6A 1PYQA 2DMRA 1SMYD 4DMRA 4CQNA 2MM2A 2Q18X 2KI8A 2Q1DX 1VC3B 1QCSA 1Y5IA 1E60A 4D7ZB 5D6XA 2GF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QDN A;  2JA7 A;  3GTJ A;  5EPP A;  3GTK A;  4AYB A;  1PQE A;  4CS0 A;  1PYU B;  1DMR A;  3O5A A;  5FTL A;  1H5N A;  1E32 A;  1AW8 B;  2WB1 A;  3CF2 A;  4GA5 A;  5GLF A;  4C2M A;  5DYI A;  2WAQ A;  2C45 A;  2E2I A;  2R93 A;  2R7Z A;  4KO8 A;  2NVX A;  2Y0S A;  2VPZ A;  5T5I D;  1G8J A;  2E7Z A;  3HU1 A;  5C18 A;  3ML1 A;  2NYA A;  3IR5 A;  1Y4Z A;  4CRY G;  2JIQ A;  3HU3 A;  1K83 A;  1FDO A;  2E2H A;  3IR7 A;  4KDI A;  1I3Q A;  2YU9 A;  2VPX A;  3OUG A;  1TMO A;  1Y1V A;  2VPY A;  1WLF A;  3QWZ A;  4GA6 A;  1TWH A;  1UHD A;  3GTQ A;  1R7R A;  1PT0 A;  3GTG A;  2PMZ A;  4CRZ A;  2VUM A;  3CQZ A;  3HKZ A;  1CZ4 A;  2JIP A;  4QIW A;  1DMS A;  1UHE A;  2YUJ A;  1E61 A;  1E5V A;  1G8K A;  1R9T A;  3PLX B;  3TM7 B;  2PJH B;  2JIO A;  4KDL A;  3H0G A;  1TWA A;  3IR6 A;  2V3V A;  2NAP A;  1WCM A;  3GTP A;  4KOD A;  1IW7 D;  5C1B A;  2JIM A;  1CZ5 A;  1Y1W A;  1I50 A;  2V45 A;  5FTK A;  2JIR A;  1PQH A;  3HU2 A;  3TIW A;  4AAY A;  3GTM A;  2R92 A;  2JA5 A;  1H0H A;  2B63 A;  1E18 A;  4RV0 A;  1YLE A;  3DMR A;  1TWC A;  5FTJ A;  5DYG A;  2JA6 A;  1FDI A;  2NVY A;  1SIW A;  1TWF A;  1SFO A;  1KQG A;  3FKI A;  4AON B;  1ZC1 A;  1OGY A;  1KQF A;  1EU1 A;  5T5M D;  2VPW A;  1Q16 A;  3QQ7 A;  1TWG A;  4AOK B;  2EEO B;  1PQF A;  3QQ8 A;  3GTL A;  3QC8 A;  4AZD A;  3GTO A;  1CR5 A;  5B6C A;  1R27 A;  2IV2 X;  1PT1 A;  4KLN A;  1PPY A;  5FTM A;  2JV2 A;  5FTN A;  1S3S A;  1AA6 A;  1PYQ A;  2DMR A;  4DMR A;  2KI8 A;  1VC3 B;  1QCS A;  1Y5I A;  1E60 A;  4D7Z B; 
#chains in the Genus database with same CATH topology
 1OA9 A;  1QDN A;  2JA7 A;  3GTJ A;  5EPP A;  3GTK A;  1I9G A;  1BW3 A;  4AYB A;  2GAE A;  1ZYR D;  1PQE A;  4CS0 A;  1PYU B;  1DMR A;  1YNJ D;  3X2K A;  4ARI A;  3O5A A;  5FTL A;  1H5N A;  1E32 A;  3X2I A;  2QQS A;  1AW8 B;  2WB1 A;  3CF2 A;  3CZB A;  4GA5 A;  5GLF A;  4C2M A;  2XDP A;  5DYI A;  5GLX A;  2WAQ A;  2C45 A;  2E2I A;  2KQA A;  2R93 A;  2Q1A X;  4JS7 A;  1HD5 A;  4KO8 A;  2R7Z A;  2PWY A;  2BE5 D;  2CW0 D;  2Y0S A;  5GLY A;  2NVX A;  2QQR A;  2VPZ A;  5T5I D;  4AS1 A;  1G8J A;  2E7Z A;  3HU1 A;  3SUL A;  3ML1 A;  2NYA A;  3D30 A;  1Y4Z A;  3IR5 A;  3X2H A;  2JIQ A;  3HU3 A;  3SUM A;  4CRY G;  1FDO A;  1K83 A;  3IR7 A;  2E2H A;  2A6H D;  1O54 A;  2Q1C X;  4KDI A;  1I3Q A;  4L48 A;  2YU9 A;  2AE0 X;  4AVR A;  2VPX A;  2ENG A;  3OUG A;  2A69 D;  1TMO A;  1Y1V A;  2VPY A;  5D6W A;  1WLF A;  2A68 D;  3QWZ A;  4GA6 A;  3FPT A;  2BH0 A;  1TWH A;  1UHD A;  3GTQ A;  4FIB A;  1R7R A;  5EQJ B;  1PT0 A;  3GTG A;  2PMZ A;  4CRZ A;  2Q19 X;  2VUM A;  3CQZ A;  4ARC A;  3HKZ A;  1CZ4 A;  2JIP A;  2GFA A;  4QIW A;  1DMS A;  4ZM7 A;  4AQ7 A;  1UHE A;  2YUJ A;  1E61 A;  1E5V A;  1G8K A;  1R9T A;  3LGA A;  3FPR A;  3PLX B;  3TM7 B;  4FG2 A;  3ZGZ A;  2PJH B;  2JIO A;  4KDL A;  3H0G A;  1TWA A;  3IR6 A;  1OA7 A;  2V3V A;  2NAP A;  1WCM A;  5GM9 A;  3GTP A;  4KOD A;  1IW7 D;  5C1B A;  1BW4 A;  2JIM A;  1CZ5 A;  1Y1W A;  1I50 A;  2V45 A;  3X2P A;  5CCX A;  1YNN D;  2JIR A;  5FTK A;  1PQH A;  3HU2 A;  5CD1 A;  3TIW A;  4AAY A;  3GTM A;  2R92 A;  2JA5 A;  2KY9 A;  1H0H A;  4JP7 A;  2B63 A;  1E18 A;  3FPU A;  4RV0 A;  2G5D A;  1YLE A;  3DMR A;  1TWC A;  5FTJ A;  5DYG A;  2JA6 A;  2LW6 A;  4JJO A;  1FDI A;  3X2J A;  2NVY A;  4FER A;  3ZJT A;  1SIW A;  1TWF A;  2PI8 A;  3SUJ A;  1SFO A;  4JCW A;  1KQG A;  3FKI A;  5CCB A;  4AON B;  1ZC1 A;  3ZJV A;  1OGY A;  2HCZ X;  5ERG B;  1WC2 A;  3X2G A;  1KQF A;  1N10 A;  1EU1 A;  5T5M D;  2VPW A;  4NOH A;  5H4U A;  4ENG A;  1Q16 A;  2B25 A;  3QQ7 A;  1TWG A;  3MB5 A;  4AOK B;  2EEO B;  1PQF A;  3BQB A;  3QQ8 A;  3GTL A;  4FFT A;  3X2O A;  2PIC A;  3X2N A;  3SUK A;  2PJJ A;  3QC8 A;  5C18 A;  4AZD A;  3GTO A;  5D6Y A;  1CR5 A;  3ENG A;  5B6C A;  3LHD A;  1R27 A;  2IV2 X;  1PT1 A;  4KLN A;  2MM0 A;  2YVL A;  1PPY A;  3X2M A;  2G6G A;  2A6E D;  5FTM A;  4UC4 A;  2JV2 A;  5FTN A;  4JP6 A;  2PNW A;  2O5J D;  1S3S A;  3M3G A;  4FG4 A;  3ZJU A;  3X2L A;  1AA6 A;  1PYQ A;  2DMR A;  1SMY D;  4DMR A;  4CQN A;  2MM2 A;  2Q18 X;  2KI8 A;  2Q1D X;  1VC3 B;  1L8F A;  1QCS A;  1Y5I A;  1E60 A;  4D7Z B;  5D6X A;  2GF7 A; 
#chains in the Genus database with same CATH homology
 1QDN A;  2JA7 A;  3GTJ A;  5EPP A;  3GTK A;  4AYB A;  2GAE A;  1ZYR D;  1PQE A;  4CS0 A;  1PYU B;  1DMR A;  1YNJ D;  3O5A A;  5FTL A;  1H5N A;  1E32 A;  2QQS A;  1AW8 B;  2WB1 A;  3CF2 A;  3CZB A;  4GA5 A;  5GLF A;  4C2M A;  2XDP A;  5DYI A;  2WAQ A;  2C45 A;  2E2I A;  2R93 A;  2Q1A X;  2R7Z A;  4KO8 A;  2PWY A;  2BE5 D;  2CW0 D;  2Y0S A;  2NVX A;  2QQR A;  4AS1 A;  2VPZ A;  5T5I D;  4ARI A;  1G8J A;  2E7Z A;  3HU1 A;  5C18 A;  3ML1 A;  2NYA A;  3IR5 A;  1Y4Z A;  1I9G A;  4CRY G;  2JIQ A;  3HU3 A;  1K83 A;  1FDO A;  2E2H A;  3IR7 A;  2A6H D;  1O54 A;  2Q1C X;  4KDI A;  1I3Q A;  2YU9 A;  2AE0 X;  2VPX A;  3OUG A;  2A69 D;  1TMO A;  1Y1V A;  2VPY A;  5D6W A;  1WLF A;  2A68 D;  3QWZ A;  4GA6 A;  3FPT A;  1TWH A;  1UHD A;  3GTQ A;  4FIB A;  1R7R A;  5EQJ B;  1PT0 A;  3GTG A;  2PMZ A;  4CRZ A;  2Q19 X;  2VUM A;  3CQZ A;  4ARC A;  3HKZ A;  1CZ4 A;  2JIP A;  2GFA A;  4QIW A;  1DMS A;  4AQ7 A;  1UHE A;  2YUJ A;  1E61 A;  1E5V A;  1G8K A;  1R9T A;  3LGA A;  3FPR A;  3PLX B;  3TM7 B;  3ZGZ A;  2PJH B;  2JIO A;  4KDL A;  3H0G A;  1TWA A;  3IR6 A;  2V3V A;  2NAP A;  1WCM A;  3GTP A;  4KOD A;  1IW7 D;  5C1B A;  2JIM A;  1CZ5 A;  1Y1W A;  1I50 A;  2V45 A;  5CCX A;  1YNN D;  2JIR A;  5FTK A;  1PQH A;  3HU2 A;  5CD1 A;  3TIW A;  4AAY A;  3GTM A;  2R92 A;  2JA5 A;  2KY9 A;  1H0H A;  2B63 A;  1E18 A;  3FPU A;  4RV0 A;  2G5D A;  1YLE A;  3DMR A;  1TWC A;  5FTJ A;  5DYG A;  2JA6 A;  2LW6 A;  1FDI A;  2NVY A;  3ZJT A;  1SIW A;  1TWF A;  2PI8 A;  1SFO A;  1KQG A;  3FKI A;  5CCB A;  4AON B;  1ZC1 A;  3ZJV A;  1OGY A;  5ERG B;  1KQF A;  1EU1 A;  5T5M D;  2VPW A;  4NOH A;  1Q16 A;  2B25 A;  3QQ7 A;  1TWG A;  3MB5 A;  4AOK B;  2EEO B;  1PQF A;  3BQB A;  3QQ8 A;  3GTL A;  2PIC A;  2PJJ A;  3QC8 A;  5D6Y A;  4AZD A;  3GTO A;  1CR5 A;  5B6C A;  3LHD A;  1R27 A;  2IV2 X;  1PT1 A;  4KLN A;  2MM0 A;  2YVL A;  1PPY A;  2G6G A;  2A6E D;  5FTM A;  4UC4 A;  2JV2 A;  5FTN A;  2PNW A;  2O5J D;  1S3S A;  3ZJU A;  1AA6 A;  1PYQ A;  2DMR A;  1SMY D;  4DMR A;  4CQN A;  2MM2 A;  2Q18 X;  2KI8 A;  2Q1D X;  1VC3 B;  1QCS A;  1Y5I A;  1E60 A;  4D7Z B;  5D6X A;  2GF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...