5B6CA

Structural details of ufd1 binding to p97
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
GSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Details of Ufd1 Binding to p97 and Their Functional Implications in ER-Associated Degradation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5b6cA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5b6cA02
4KLNA 1PYUB 1G8JA 3QQ7A 1E5VA 1PYQA 2R92A 1I50A 3GTPA 2E2HA 5FTNA 4C2MA 1TWHA 4RV0A 1R9TA 1Y4ZA 3ML1A 1TWFA 1I3QA 2B63A 2VPXA 1KQGA 2R7ZA 1QCSA 2NAPA 1PT1A 1YLEA 1Y1VA 1TMOA 5C1BA 2PMZA 3TIWA 2WB1A 3HU2A 4CRZA 2JA7A 3GTJA 4AONB 1SFOA 2NVXA 1TWAA 2VPYA 5T5MD 1PQEA 2E7ZA 3QWZA 1WLFA 2VUMA 1FDOA 1Y5IA 4AZDA 1S3SA 3O5AA 1UHDA 1E32A 3CF2A 5EPPA 5FTKA 2NYAA 2JIPA 3H0GA 1UHEA 2VPZA 2VPWA 2YU9A 2JV2A 3IR6A 3TM7B 2E2IA 1KQFA 1PT0A 2KI8A 3HU3A 2JIRA 4AAYA 5FTMA 1Y1WA 1CR5A 1IW7D 3IR5A 4KDLA 2WAQA 2NVYA 3CQZA 5T5ID 3GTQA 3GTOA 1E61A 1PQHA 2JA6A 4AYBA 1VC3B 1OGYA 1QDNA 1DMSA 1WCMA 1AA6A 3QC8A 5GLFA 4CRYG 1R7RA 4KODA 4DMRA 2V45A 1CZ4A 5FTLA 4D7ZB 1ZC1A 1AW8B 3GTMA 1G8KA 1K83A 3FKIA 5B6CA 4KO8A 1PPYA 1R27A 1TWCA 4QIWA 2JIQA 5DYIA 1EU1A 3DMRA 2JIMA 4KDIA 2C45A 1H5NA 3HKZA 4CS0A 2JA5A 2EEOB 1SIWA 3IR7A 2Y0SA 2JIOA 1FDIA 3OUGA 1E60A 2R93A 1PQFA 4GA6A 3GTKA 2YUJA 1CZ5A 3GTGA 2IV2X 3QQ8A 2PJHB 1TWGA 1DMRA 1Q16A 3GTLA 4GA5A 5FTJA 5C18A 1E18A 3PLXB 5DYGA 4AOKB 3HU1A 2DMRA 1H0HA 2V3VA
chains in the Genus database with same CATH superfamily
4KLNA 1PYUB 1G8JA 3QQ7A 2A68D 3SUKA 1E5VA 1PYQA 2AE0X 3X2HA 2R92A 1I50A 3GTPA 2E2HA 5FTNA 2QQRA 4C2MA 1TWHA 4RV0A 3ZGZA 1R9TA 1Y4ZA 3ML1A 1TWFA 3X2OA 1I3QA 2B63A 2VPXA 3ZJVA 3ZJTA 1KQGA 3M3GA 2R7ZA 3X2MA 2BE5D 3LGAA 1QCSA 4L48A 5D6YA 2NAPA 1PT1A 1YLEA 2PJJA 1O54A 1Y1VA 1TMOA 5C1BA 2PMZA 2LW6A 3TIWA 3BQBA 2HCZX 5CCBA 2WB1A 3HU2A 4CRZA 2JA7A 2GAEA 3FPRA 3GTJA 4AONB 5D6WA 1SFOA 4ENGA 1ZYRD 3X2IA 2NVXA 1TWAA 2VPYA 5T5MD 4FFTA 2MM2A 1PQEA 2E7ZA 3QWZA 5ERGB 3CZBA 5H4UA 1OA9A 1WLFA 2VUMA 1FDOA 1Y5IA 3X2KA 3X2PA 5EQJB 4AZDA 1S3SA 3O5AA 1UHDA 1E32A 2BH0A 4JS7A 2B25A 3CF2A 5EPPA 5FTKA 2PWYA 2NYAA 2JIPA 2PI8A 1I9GA 5CCXA 3H0GA 4JP7A 1UHEA 2VPZA 2VPWA 2YU9A 2JV2A 3LHDA 5CD1A 3IR6A 3TM7B 2E2IA 2YVLA 4FERA 1KQFA 2MM0A 4AS1A 1SMYD 1PT0A 2KI8A 3HU3A 2G6GA 3FPTA 4FG4A 4UC4A 2JIRA 4AAYA 3ZJUA 5FTMA 1Y1WA 3D30A 1BW3A 1CR5A 1IW7D 3X2JA 2KQAA 3IR5A 4KDLA 2WAQA 2NVYA 3SUJA 3CQZA 5T5ID 2O5JD 3GTQA 3GTOA 1E61A 1PQHA 2JA6A 3SULA 2KY9A 4AYBA 1VC3B 1BW4A 2G5DA 1OGYA 1QDNA 4JP6A 3ENGA 1DMSA 1WCMA 4FIBA 1AA6A 1YNJD 3QC8A 2A6HD 1R7RA 4KODA 5GLFA 4CRYG 4DMRA 2Q1AX 1OA7A 2V45A 2Q18X 1CZ4A 5FTLA 2PNWA 3X2NA 4D7ZB 3MB5A 1ZC1A 1AW8B 3GTMA 2Q1CX 2Q1DX 1G8KA 1K83A 3FKIA 1L8FA 5B6CA 4ARIA 4KO8A 1N10A 1PPYA 4AVRA 2XDPA 1R27A 1TWCA 4QIWA 2JIQA 5DYIA 5GM9A 5D6XA 1EU1A 3DMRA 2JIMA 4KDIA 2C45A 3FPUA 1H5NA 5GLYA 5GLXA 3X2LA 2CW0D 2Q19X 4JCWA 4AQ7A 4ARCA 3HKZA 4CS0A 2JA5A 2EEOB 4CQNA 1SIWA 3IR7A 2A6ED 2JIOA 2Y0SA 1FDIA 3SUMA 2PICA 3OUGA 2A69D 4NOHA 1E60A 4FG2A 1PQFA 2R93A 2ENGA 4GA6A 2YUJA 3GTKA 1HD5A 1CZ5A 1YNND 3GTGA 2IV2X 3QQ8A 2GFAA 2PJHB 1TWGA 1WC2A 1DMRA 2QQSA 2GF7A 4JJOA 1Q16A 3GTLA 4ZM7A 4GA5A 5FTJA 5C18A 1E18A 3PLXB 5DYGA 4AOKB 3HU1A 3X2GA 2DMRA 1H0HA 2V3VA
chains in the Genus database with same CATH topology
4KLNA 1PYUB 1G8JA 3QQ7A 2A68D 1E5VA 1PYQA 2AE0X 2R92A 1I50A 3GTPA 2E2HA 5FTNA 2QQRA 4C2MA 1TWHA 4RV0A 3ZGZA 1R9TA 1Y4ZA 3ML1A 1TWFA 1I3QA 2B63A 2VPXA 3ZJVA 3ZJTA 1KQGA 2R7ZA 3LGAA 2BE5D 1QCSA 5D6YA 2NAPA 1PT1A 1YLEA 2PJJA 1O54A 1Y1VA 1TMOA 5C1BA 2PMZA 2LW6A 3TIWA 3BQBA 5CCBA 2WB1A 3HU2A 4CRZA 2JA7A 2GAEA 3FPRA 3GTJA 4AONB 5D6WA 1SFOA 1ZYRD 2NVXA 1TWAA 2VPYA 5T5MD 2MM2A 1PQEA 2E7ZA 3QWZA 5ERGB 3CZBA 1WLFA 2VUMA 1FDOA 1Y5IA 5EQJB 4AZDA 1S3SA 3O5AA 1UHDA 1E32A 2B25A 3CF2A 5EPPA 5FTKA 2PWYA 2NYAA 2JIPA 2PI8A 1I9GA 5CCXA 3H0GA 1UHEA 2VPZA 2VPWA 2YU9A 2JV2A 3LHDA 5CD1A 3IR6A 3TM7B 2E2IA 2YVLA 1KQFA 2MM0A 4AS1A 1SMYD 1PT0A 2KI8A 3HU3A 2G6GA 3FPTA 4UC4A 2JIRA 4AAYA 3ZJUA 5FTMA 1Y1WA 1CR5A 1IW7D 3IR5A 4KDLA 2WAQA 2NVYA 3CQZA 5T5ID 2O5JD 3GTQA 3GTOA 1E61A 1PQHA 2JA6A 2KY9A 4AYBA 1VC3B 2G5DA 1OGYA 1QDNA 1DMSA 1WCMA 4FIBA 1AA6A 1YNJD 3QC8A 2A6HD 1R7RA 4KODA 5GLFA 4CRYG 4DMRA 2Q1AX 2V45A 2Q18X 1CZ4A 5FTLA 2PNWA 4D7ZB 3MB5A 1ZC1A 1AW8B 3GTMA 2Q1CX 2Q1DX 1G8KA 1K83A 3FKIA 5B6CA 4ARIA 4KO8A 1PPYA 2XDPA 1R27A 1TWCA 4QIWA 2JIQA 5DYIA 5D6XA 1EU1A 3DMRA 2JIMA 4KDIA 2C45A 3FPUA 1H5NA 2CW0D 2Q19X 4AQ7A 4ARCA 3HKZA 4CS0A 2JA5A 2EEOB 4CQNA 1SIWA 3IR7A 2A6ED 2JIOA 2Y0SA 1FDIA 2PICA 3OUGA 2A69D 4NOHA 1E60A 2R93A 1PQFA 4GA6A 2YUJA 3GTKA 1CZ5A 1YNND 3GTGA 2IV2X 3QQ8A 2GFAA 2PJHB 1TWGA 1DMRA 2QQSA 2GF7A 1Q16A 3GTLA 4GA5A 5FTJA 5C18A 1E18A 3PLXB 5DYGA 4AOKB 3HU1A 2DMRA 1H0HA 2V3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLN A;  1PYU B;  1G8J A;  3QQ7 A;  1E5V A;  1PYQ A;  2R92 A;  1I50 A;  3GTP A;  2E2H A;  5FTN A;  4C2M A;  1TWH A;  4RV0 A;  1R9T A;  1Y4Z A;  3ML1 A;  1TWF A;  1I3Q A;  2B63 A;  2VPX A;  1KQG A;  2R7Z A;  1QCS A;  2NAP A;  1PT1 A;  1YLE A;  1Y1V A;  1TMO A;  5C1B A;  2PMZ A;  3TIW A;  2WB1 A;  3HU2 A;  4CRZ A;  2JA7 A;  3GTJ A;  4AON B;  1SFO A;  2NVX A;  1TWA A;  2VPY A;  5T5M D;  1PQE A;  2E7Z A;  3QWZ A;  1WLF A;  2VUM A;  1FDO A;  1Y5I A;  4AZD A;  1S3S A;  3O5A A;  1UHD A;  1E32 A;  3CF2 A;  5EPP A;  5FTK A;  2NYA A;  2JIP A;  3H0G A;  1UHE A;  2VPZ A;  2VPW A;  2YU9 A;  2JV2 A;  3IR6 A;  3TM7 B;  2E2I A;  1KQF A;  1PT0 A;  2KI8 A;  3HU3 A;  2JIR A;  4AAY A;  5FTM A;  1Y1W A;  1CR5 A;  1IW7 D;  3IR5 A;  4KDL A;  2WAQ A;  2NVY A;  3CQZ A;  5T5I D;  3GTQ A;  3GTO A;  1E61 A;  1PQH A;  2JA6 A;  4AYB A;  1VC3 B;  1OGY A;  1QDN A;  1DMS A;  1WCM A;  1AA6 A;  3QC8 A;  5GLF A;  4CRY G;  1R7R A;  4KOD A;  4DMR A;  2V45 A;  1CZ4 A;  5FTL A;  4D7Z B;  1ZC1 A;  1AW8 B;  3GTM A;  1G8K A;  1K83 A;  3FKI A;  5B6C A;  4KO8 A;  1PPY A;  1R27 A;  1TWC A;  4QIW A;  2JIQ A;  5DYI A;  1EU1 A;  3DMR A;  2JIM A;  4KDI A;  2C45 A;  1H5N A;  3HKZ A;  4CS0 A;  2JA5 A;  2EEO B;  1SIW A;  3IR7 A;  2Y0S A;  2JIO A;  1FDI A;  3OUG A;  1E60 A;  2R93 A;  1PQF A;  4GA6 A;  3GTK A;  2YUJ A;  1CZ5 A;  3GTG A;  2IV2 X;  3QQ8 A;  2PJH B;  1TWG A;  1DMR A;  1Q16 A;  3GTL A;  4GA5 A;  5FTJ A;  5C18 A;  1E18 A;  3PLX B;  5DYG A;  4AOK B;  3HU1 A;  2DMR A;  1H0H A;  2V3V A; 
#chains in the Genus database with same CATH topology
 4KLN A;  1PYU B;  1G8J A;  3QQ7 A;  2A68 D;  3SUK A;  1E5V A;  1PYQ A;  2AE0 X;  3X2H A;  2R92 A;  1I50 A;  3GTP A;  2E2H A;  5FTN A;  2QQR A;  4C2M A;  1TWH A;  4RV0 A;  3ZGZ A;  1R9T A;  1Y4Z A;  3ML1 A;  1TWF A;  3X2O A;  1I3Q A;  2B63 A;  2VPX A;  3ZJV A;  3ZJT A;  1KQG A;  3M3G A;  2R7Z A;  3X2M A;  2BE5 D;  3LGA A;  1QCS A;  4L48 A;  5D6Y A;  2NAP A;  1PT1 A;  1YLE A;  2PJJ A;  1O54 A;  1Y1V A;  1TMO A;  5C1B A;  2PMZ A;  2LW6 A;  3TIW A;  3BQB A;  2HCZ X;  5CCB A;  2WB1 A;  3HU2 A;  4CRZ A;  2JA7 A;  2GAE A;  3FPR A;  3GTJ A;  4AON B;  5D6W A;  1SFO A;  4ENG A;  1ZYR D;  3X2I A;  2NVX A;  1TWA A;  2VPY A;  5T5M D;  4FFT A;  2MM2 A;  1PQE A;  2E7Z A;  3QWZ A;  5ERG B;  3CZB A;  5H4U A;  1OA9 A;  1WLF A;  2VUM A;  1FDO A;  1Y5I A;  3X2K A;  3X2P A;  5EQJ B;  4AZD A;  1S3S A;  3O5A A;  1UHD A;  1E32 A;  2BH0 A;  4JS7 A;  2B25 A;  3CF2 A;  5EPP A;  5FTK A;  2PWY A;  2NYA A;  2JIP A;  2PI8 A;  1I9G A;  5CCX A;  3H0G A;  4JP7 A;  1UHE A;  2VPZ A;  2VPW A;  2YU9 A;  2JV2 A;  3LHD A;  5CD1 A;  3IR6 A;  3TM7 B;  2E2I A;  2YVL A;  4FER A;  1KQF A;  2MM0 A;  4AS1 A;  1SMY D;  1PT0 A;  2KI8 A;  3HU3 A;  2G6G A;  3FPT A;  4FG4 A;  4UC4 A;  2JIR A;  4AAY A;  3ZJU A;  5FTM A;  1Y1W A;  3D30 A;  1BW3 A;  1CR5 A;  1IW7 D;  3X2J A;  2KQA A;  3IR5 A;  4KDL A;  2WAQ A;  2NVY A;  3SUJ A;  3CQZ A;  5T5I D;  2O5J D;  3GTQ A;  3GTO A;  1E61 A;  1PQH A;  2JA6 A;  3SUL A;  2KY9 A;  4AYB A;  1VC3 B;  1BW4 A;  2G5D A;  1OGY A;  1QDN A;  4JP6 A;  3ENG A;  1DMS A;  1WCM A;  4FIB A;  1AA6 A;  1YNJ D;  3QC8 A;  2A6H D;  1R7R A;  4KOD A;  5GLF A;  4CRY G;  4DMR A;  2Q1A X;  1OA7 A;  2V45 A;  2Q18 X;  1CZ4 A;  5FTL A;  2PNW A;  3X2N A;  4D7Z B;  3MB5 A;  1ZC1 A;  1AW8 B;  3GTM A;  2Q1C X;  2Q1D X;  1G8K A;  1K83 A;  3FKI A;  1L8F A;  5B6C A;  4ARI A;  4KO8 A;  1N10 A;  1PPY A;  4AVR A;  2XDP A;  1R27 A;  1TWC A;  4QIW A;  2JIQ A;  5DYI A;  5GM9 A;  5D6X A;  1EU1 A;  3DMR A;  2JIM A;  4KDI A;  2C45 A;  3FPU A;  1H5N A;  5GLY A;  5GLX A;  3X2L A;  2CW0 D;  2Q19 X;  4JCW A;  4AQ7 A;  4ARC A;  3HKZ A;  4CS0 A;  2JA5 A;  2EEO B;  4CQN A;  1SIW A;  3IR7 A;  2A6E D;  2JIO A;  2Y0S A;  1FDI A;  3SUM A;  2PIC A;  3OUG A;  2A69 D;  4NOH A;  1E60 A;  4FG2 A;  1PQF A;  2R93 A;  2ENG A;  4GA6 A;  2YUJ A;  3GTK A;  1HD5 A;  1CZ5 A;  1YNN D;  3GTG A;  2IV2 X;  3QQ8 A;  2GFA A;  2PJH B;  1TWG A;  1WC2 A;  1DMR A;  2QQS A;  2GF7 A;  4JJO A;  1Q16 A;  3GTL A;  4ZM7 A;  4GA5 A;  5FTJ A;  5C18 A;  1E18 A;  3PLX B;  5DYG A;  4AOK B;  3HU1 A;  3X2G A;  2DMR A;  1H0H A;  2V3V A; 
#chains in the Genus database with same CATH homology
 4KLN A;  1PYU B;  1G8J A;  3QQ7 A;  2A68 D;  1E5V A;  1PYQ A;  2AE0 X;  2R92 A;  1I50 A;  3GTP A;  2E2H A;  5FTN A;  2QQR A;  4C2M A;  1TWH A;  4RV0 A;  3ZGZ A;  1R9T A;  1Y4Z A;  3ML1 A;  1TWF A;  1I3Q A;  2B63 A;  2VPX A;  3ZJV A;  3ZJT A;  1KQG A;  2R7Z A;  3LGA A;  2BE5 D;  1QCS A;  5D6Y A;  2NAP A;  1PT1 A;  1YLE A;  2PJJ A;  1O54 A;  1Y1V A;  1TMO A;  5C1B A;  2PMZ A;  2LW6 A;  3TIW A;  3BQB A;  5CCB A;  2WB1 A;  3HU2 A;  4CRZ A;  2JA7 A;  2GAE A;  3FPR A;  3GTJ A;  4AON B;  5D6W A;  1SFO A;  1ZYR D;  2NVX A;  1TWA A;  2VPY A;  5T5M D;  2MM2 A;  1PQE A;  2E7Z A;  3QWZ A;  5ERG B;  3CZB A;  1WLF A;  2VUM A;  1FDO A;  1Y5I A;  5EQJ B;  4AZD A;  1S3S A;  3O5A A;  1UHD A;  1E32 A;  2B25 A;  3CF2 A;  5EPP A;  5FTK A;  2PWY A;  2NYA A;  2JIP A;  2PI8 A;  1I9G A;  5CCX A;  3H0G A;  1UHE A;  2VPZ A;  2VPW A;  2YU9 A;  2JV2 A;  3LHD A;  5CD1 A;  3IR6 A;  3TM7 B;  2E2I A;  2YVL A;  1KQF A;  2MM0 A;  4AS1 A;  1SMY D;  1PT0 A;  2KI8 A;  3HU3 A;  2G6G A;  3FPT A;  4UC4 A;  2JIR A;  4AAY A;  3ZJU A;  5FTM A;  1Y1W A;  1CR5 A;  1IW7 D;  3IR5 A;  4KDL A;  2WAQ A;  2NVY A;  3CQZ A;  5T5I D;  2O5J D;  3GTQ A;  3GTO A;  1E61 A;  1PQH A;  2JA6 A;  2KY9 A;  4AYB A;  1VC3 B;  2G5D A;  1OGY A;  1QDN A;  1DMS A;  1WCM A;  4FIB A;  1AA6 A;  1YNJ D;  3QC8 A;  2A6H D;  1R7R A;  4KOD A;  5GLF A;  4CRY G;  4DMR A;  2Q1A X;  2V45 A;  2Q18 X;  1CZ4 A;  5FTL A;  2PNW A;  4D7Z B;  3MB5 A;  1ZC1 A;  1AW8 B;  3GTM A;  2Q1C X;  2Q1D X;  1G8K A;  1K83 A;  3FKI A;  5B6C A;  4ARI A;  4KO8 A;  1PPY A;  2XDP A;  1R27 A;  1TWC A;  4QIW A;  2JIQ A;  5DYI A;  5D6X A;  1EU1 A;  3DMR A;  2JIM A;  4KDI A;  2C45 A;  3FPU A;  1H5N A;  2CW0 D;  2Q19 X;  4AQ7 A;  4ARC A;  3HKZ A;  4CS0 A;  2JA5 A;  2EEO B;  4CQN A;  1SIW A;  3IR7 A;  2A6E D;  2JIO A;  2Y0S A;  1FDI A;  2PIC A;  3OUG A;  2A69 D;  4NOH A;  1E60 A;  2R93 A;  1PQF A;  4GA6 A;  2YUJ A;  3GTK A;  1CZ5 A;  1YNN D;  3GTG A;  2IV2 X;  3QQ8 A;  2GFA A;  2PJH B;  1TWG A;  1DMR A;  2QQS A;  2GF7 A;  1Q16 A;  3GTL A;  4GA5 A;  5FTJ A;  5C18 A;  1E18 A;  3PLX B;  5DYG A;  4AOK B;  3HU1 A;  2DMR A;  1H0H A;  2V3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...