5D6WA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
b'QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6wA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6wA02
2DIQA 2VYTA 3BDLA 4BDZA 4A4HA 3MEAA 5J39A 2HQEA 5D6WA 2R57A 2RI5A 3UWNA 3LH0A 3E9GA 3OYIA 3DB4A 4A4GA 4E7JA 3OMCA 4IURA 4QQDA 3H8ZA 4BD3A 4IKFA 2O4XA 3OB9A 2GFAA 3S6WA 5FROA 2O4XB 2QQRA 3S3MA 3L2UA 3OY9A 1G5VA 2M0OA 4B9WA 1MHNA 3LYIA 5C0MA 4BDYA 2LRQA 3LGLA 4QVZA 2BUDA 2RHXA 4IUUA 4BE0A 1H3ZA 2P0KA 2XK0A 3QKJA 2E6NA 2EQKA 2CKKA 2M16A 2R5MA 1WGSA 3MP1A 2MWOA 3PMTA 3C4SA 4CRIA 3OS0A 2LDMA 3QJ6A 4L59A 5FRNA 1WJSA 2YRVA 4IUTA 5D6YA 4E7LA 1XNIA 2EFIA 2L8DA 5CIUA 1OZ2A 3OYNA 5KCOA 2X35A 3OYGA 4BE2A 3LLRA 3DLMA 4C5IA 3ASKA 4N4HA 3F70A 2RJFA 3OYKA 2M1HA 2RHYA 3EAEA 2LCCA 4HCZA 3FEOA 2EQJA 4E7KA 3ME9A 3OYMA 4N4GA 2EKOA 4ZTJA 5KE3A 2R5AA 3E9FA 4NS5A 4BACA 4N4IA 3NTHA 2L3RA 4A4EA 4UC4A 2BKDN 3L2RA 4FU6A 4QQ6A 4C5GA 5C6SA 4PLIA 4QW2A 1RI0A 4IUVA 3QBYA 1OZ3A 2DAQA 3SD4A 3MEVA 3L2VA 1WJQA 3FDRA 2D9TA 4PLLA 4E7IA 4GY5A 2XDPA 3MEUA 3M9QA 3OYLA 2LVMA 3LX7A 2BIVA 2G3RA 4ZTFA 3L2WA 2JZ2A 3NTKA 4BE1A 2JTFA 1WJRA 4C5EA 5KE2A 3OYHA 4E7HA 2B8AA 2RI3A 4C5HA 2WACA 2EQMA 2K3YA 2LTOA 2RJEA 2RO0A 3OYAA 3ZEHA 1OYXA 3S3OA 3QIIA 3OS2A 3DB3A 5IN1A 3MP8A 3OYBA 2X4YA 2RHUA 3UT1A 5KH6A 3OS1A 3PMIA 3OYJA 3FC3A 4Q5WA 3OQ5A 5FRMA 2RHZA 3Q1JA 2GF7A 4RG2A 3OYDA 3O8VA 2RI2A 4X34A 1KHCA 4FL6A 5KCHA 3OA6A 3GOXA 2R58A 3META 4LD6A 4B9XA 3S3NA 2FHDA 3OYEA 4EDUA 2PQWA 2E5QA 3MO8A 3CEYA 3FLGA 2IG0A 2X4XA 3L2QA 2DIGA 4QQGA 4Z02A 3OYFA 3PNWC 4II1A 4A4FA 2X4WA 2HQXA 2GFUA 4IUQA 3NTIA 2L89A 3H6ZA 3L42A 1OI1A 3MP6A 3LGFA 4IUPA 2K3XA 5D6XA 3PFSA 2QQSA 3KUFA 2NLUA 5M9OA 3P8DA 4PL6A 2RJDA 3P8HA 5J26A 2F5KA 1SSFA 3OMGA 2MWPA 2EQUA 2RJCA 4OVAA 3MEWA 2RHIA 3OYCA 5IAYA 1N27A
chains in the Genus database with same CATH superfamily
4ARIA 2E3IA 3R6NA 3ZJTA 1N8RU 4PFZA 2RI5A 4PJOE 2V8JA 1E6GA 3JV3A 1WQWA 2JTEA 1VOMA 5HKCA 3S6WA 4N0AA 5FROA 1D09B 1V76A 1ZSGA 2EGCA 1VQPQ 4BUGA 4HCKA 3JCMh 1ZUYA 2E5KA 2XHCA 3UF4A 2LW6A 4GLKA 5CVIA 2P4RA 1PSEA 3RESA 3FPTA 2PU9B 1KQSA 3CCEA 1TTHB 4M7AD 4ZGDB 5GANe 3VV0A 1OEBA 3H41A 5EPPA 2CH4W 3CCJA 1VQ6A 1BI1A 2YUQA 2CH4A 4RTXA 4N4HA 1K8AU 1VQ4T 1YFNA 2C0OA 2ZAEA 4ZTJA 3I55A 2DO3A 4NS5A 4J9FA 4N4IA 1AWXA 1O9SA 2KRNA 2KSSA 2RMOA 4XU0A 2DTOA 3QWYA 5GMKl 3RMSA 4M7AB 1QW1A 1UHFA 1RUWA 3MEUA 3M9QA 4M75C 2AIRB 1ZUKA 3I35A 3CCLT 5FWCA 4J6YA 4KDIA 5KE2A 4ORZA 3CCMT 1SRLA 2H8HA 4XK8E 2PUKB 1OU9A 4CQNA 2DL4A 3OS2A 2VASA 4L6V5 4MMKA 1QCNA 3LWIA 2JW4A 2RN8A 2YRDA 1Q81C 1YJ9T 4D8KA 1U06A 1ZQ1A 2XI9A 1F1BB 4KUDK 2P0QA 5FU7B 3E2UA 2FPDA 3JCMf 3V8JA 4DBRA 4ZGJB 1OX9A 2O88A 3VYGA 1M30A 4DQ2A 1B7TA 1M1FA 2QGGA 3RDVA 2AKLA 3L42A 2K3XA 2JT4A 4JJCA 3P8HA 2FRWA 3OMGA 1WXUA 2EQUA 3CCVQ 3OYCA 3CC7T 3BDLA 4OMOA 5HK3A 3VS7A 1WHKA 3RIRA 3VS2A 3PGGA 4A53A 4A4GA 4F7UF 1KD1R 5HY6A 3OB9A 5C18A 2CZ6B 2E3HA 1K4US 5GLFA 4BDYA 2RHXA 1Q81U 2YUNA 1NLPC 1RI9A 3GF5A 2CKKA 4CRIA 4C8QD 4M75F 3A8MB 3M4YA 4J9BA 4MZTA 1ABOA 5C1BA 1BI0A 2F2VA 2DD5A 1Q82R 3ASKA 4M77G 5CCXA 1X75C 3OBYA 4FIBA 4MMLA 1AWOA 1YWPA 2AHJB 4J9GA 1NPPA 4PJNA 1UFFA 4JRKA 1R7RA 2HKNA 1A0NB 3H9NA 3V8LA 4WF2A 2GNCA 4C8QB 3EFRA 3O5ZA 4F16A 3L2VA 4AFSC 5L23A 2SEMA 1H3HA 3LX7A 5AYFA 2EVRA 2OTLA 2I2LA 3JCMe 4KUIA 3QG1A 2OJ2A 5HCKA 4C5EA 3C0CA 1WHJA 1QP3A 1BK2A 3INZA 5I21A 5GAN8 3S3OA 3QIIA 3NHNA 2F2WA 3OQ5A 4Y91A 3CMEA 3CCUQ 1YJNQ 3O8VA 3OA6A 4OB1B 2FHDA 1VQLT 3FJ5A 2MK5A 1UHCA 5I22A 1IREB 3R6OA 3CF2A 1VIEA 4E6RA 2MI6A 4II1A 1ZA2B 2L3PA 4D6WA 3TVTA 3WXMB 4DBQA 2LJ0A 1RAFB 5GAN3 4IUPA 1VQMT 5GAN4 1PD0A 3GPLA 3JB9F 2F5KA 1AT1B 4BI8B 1X6GA 1YCYA 4M77A 3LWHA 4FCYA 1BIBA 3QXEB 4BDZA 1WHHA 2ZCFB 2A3LA 3HRTA 5EC7A 3I56T 3UWNA 2CS7A 3DB4A 4HXJA 1ZLMA 4OMMA 5GMKh 4IIOA 2JXBA 2O31A 1XTDA 5CQXA 3NPFA 2P0KA 2E6NA 3MP1A 4CC4B 1PC0A 5FRNA 3CCSA 4L59A 5LJ3g 1ZC1A 2M0YA 3J81E 1QKXA 5ECAA 1GCQC 3CCEQ 1ZBJA 3OYMA 3CCJQ 1VQ6Q 1KHIA 5LJ5g 4GLMA 2K79A 4F7UE 1M8VA 2D1XA 5IXFA 2CUBA 1M1GA 1LOJA 1QVFA 3I55Q 2JM9A 3BFMA 2D9TA 2ZPGB 2F2XA 3H0IA 2MM0A 3M5AA 2LNHB 4RCCA 1AVZC 1FXXA 4BE1A 1PG5B 4F14A 3J7AF 1GRIA 4C92C 2E41A 1WI7A 2QK0A 3ZEHA 1U5SA 1FX7A 4A4KA 2EIFA 4O6JA 3CPWA 1Y57A 2GF7A 5GAOp 1Y7XA 1QMCA 3QZ5B 4X34A 1KHCA 3QQ8A 1YBYA 1MMAA 1AZEA 1SHFA 2LJ3A 3EGXA 1YITA 3PFSA 1YI2T 1WHMA 2NLUA 1WX6A 4J9CA 4E47A 3HHTB 1VQ5Q 3CPFA 5GAMd 3JCMW 2RQRA 2PTKA 4XTXA 4ARCA 3BW1A 3HU2A 4F17A 4OB0B 2W0ZA 3I5RA 3LGLA 4OB3B 1EFNA 1VIFA 1VQKA 4JPBW 2YRVA 2VC8A 2B25A 1OZ2A 4PJOC 1JXOA 2ZPHB 1CSKA 2EYYA 1NJIU 3EAEA 4Y28E 2NYSA 4C92F 2EQJA 2JUFA 1YHQT 4MZPA 5FU6C 1YJWT 1ZHIA 1ZX6A 5FLXE 2J7IA 2D8JA 3E9FA 1JJ2A 3ULRB 4JUVA 1BCMA 2EBPA 4FT2A 3CC4T 3V7SA 2DETA 3QDRB 1VQNT 4R55A 3CCRA 5GMKe 5IXBA 1N6AA 4M7DF 1NLOC 4AMCA 2VGNA 3CXCA 2OTLQ 1VQ7T 4LN2A 1VQPT 2IPOB 4J5YA 2E10A 4LDUA 1AZGB 2M02A 2CT3A 3A8HB 5CK9A 1UDLA 4ZNXA 2K5IA 4J9HA 1Y07A 3NGPA 1S72A 1SG5A 4VUBA 1WNLA 1R77A 5J3BA 1UGVA 3S3NA 4K11A 2L5QA 1R0CB 3CMEQ 4J7IA 3MO8A 4X9DA 3TIWA 3KXTA 1VQOT 3ZJUA 3OYFA 3PNWC 2DL7A 1IO6A 2FEIA 2QTVA 2QA4T 2DRMA 2HL3A 4PL6A 4LDYA 5LL6S 2RHIA 4PJOF 3A5ZB 2DA9A 2SRCA 2HQEA 5D6WA 3JCMc 2MYSA 4JRIA 1TG0A 5GAMg 3OMCA 4EIKA 2D6FA 3PVQA 2CUDA 2YVLA 1BBZA 1KQSS 2G6FX 3X25B 3D7SB 3OS0A 2IIMA 1K76A 1TSFA 1KK7A 1Y71A 3QZ9B 2RQUA 3VUZA 2PVOB 3F70A 3CCSQ 2DM1A 5KYXB 3QJYA 1LNXA 5IHIA 4PJJA 1T3SA 2K5LA 4RTVA 2KVQG 2KR3A 4QW2A 1D1AA 2EGEA 2HMAA 2MIOA 2ZZDA 4QVCA 1WIEA 4EMKC 3VYHB 1P92A 1KC8R 3REBB 3L2WA 1AWJA 1UB4A 4C5HA 2JN0A 3ER0A 2K2MA 2A7YA 3SHWA 1E6HA 3OSVA 2QEXA 3PMIA 5FTKA 3Q1JA 2C0TA 2QQAA 3SWNB 2LX7A 3G4ST 1M1KR 3GLXA 2JVVA 2NUZA 4M78G 4LD6A 1HSQA 1KD1U 1IGQA 3VJPA 1PKTA 4RTTA 3HFNA 3DKMA 2CREA 4M7DE 2LCSA 4CC3A 1AWWA 2DIQA 2DL5A 1YITQ 3UATA 1QVPA 2DNUA 1VQ8T 4IURA 4QQDA 1JXMA 4JZ4A 5CD1A 4BD3A 4IKFA 1BB9A 4ZN3A 1T3LA 1ZSZA 2YT6A 2MCNA 2EQKA 4B9WA 3FC3A 4HA8A 4FYVB 3EH2A 4M77C 4C0DB 2X35A 3EG9B 1UGRB 4FSSA 5CKEA 1VQKQ 1WHLA 2EKOA 4DBFA 2XMFA 4JRPA 2K7AA 2KXCA 4BY6B 2PZ1A 5IHKA 3SWNA 1GBQA 1WZOA 1VQ4A 4IUVA 4M78A 2DX1A 4ZTFA 4FYWB 3ZJVA 3NTKA 1WJRA 1GCPA 4XTVA 2B8AA 3CCRQ 2RI3A 1YCSB 3JB9J 1TXQA 1KQSP 1M90R 1PCXA 2DEQA 2PJHB 3E19A 1U1SA 1M3CA 2CSQA 5KYWB 2AK5A 3CCLA 8ATCB 2KEAA 2K5FA 3EFOB 1NBEB 3CCMA 3CCQT 1YIJA 2JTMA 1RACB 1FMVA 5LJ3j 1ABQA 7AT1B 5DLQE 4M7AG 1S72Q 4JDSA 2E5QA 1U8RA 4CC2A 2FZGB 1KQ1A 1YJ9A 1OPLA 3KUFA 4M77F 2FZKB 4RUGA 4JS4A 3I55T 1UEBA 4PFOA 5IT9E 1EZZB 3EG9A 5GAN5 2BZ8A 3LHDA 1PD1A 2RA2A 3LH0A 3BQBA 2P84A 3CC2T 2O4XB 3CC7A 1Z9QA 3M58A 4E7SA 1VYUA 2FYKA 2JS0A 2LRQA 1X2QA 1H3ZA 3FJPA 2XK0A 4IUUA 1U1TA 2K9GA 1VQ5A 5GAOl 3EH1A 3V7CA 3M55A 1WHGA 2L8DA 1QVGA 3OYNA 1YNZA 2CDTA 2JJ9A 5EG2A 1PHTA 3M0PA 3IQLA 1JRIA 1RAIB 4J83A 1CKBA 4OMPA 1UGQB 4PFPA 2D0QB 5KYWA 1SRMA 1OV3A 1IRXA 3EFOA 1TS9A 1QVFS 2KE9A 4KULA 4QQ6A 2Y4YA 1WXTA 2A08A 3QBYA 2Q18X 1XOVA 5LJ3d 3MEVA 4M7AA 1WJQA 3QQ7A 3FDRA 1IHVA 4E7ZA 3OYLA 1Y96B 2A37A 3X24B 3GNGA 4HVUA 3J80E 4FT4A 2P4TA 5LJ5d 2VGMA 2DL3A 2CP6A 3CPWS 2FPEA 1PKSA 4Q5WA 2MM2A 1U3OA 3ZBDA 5HK0A 1HYOA 1K0XA 1JEGA 3OYDA 4C8QG 2QEXQ 4B9XA 3OW2A 2FL7A 3VS6A 2LJ1A 4AG2C 1TUCA 4EDUA 4DEXA 5D7UA 1UGSB 1RABB 1RAEB 4A63B 3JSCA 3JB9H 4AFZC 1QQJA 2QG9B 1MMGA 1EIFA 1NZ9A 1WQ7A 2YDLA 2EWNA 1S1NA 5IAYA 3URGA 2FG0A 4A4HA 1X69A 1K9AA 1NM7A 4M75D 1M2OA 5GAOq 2GTJA 3VUBA 1MV0B 2GFAA 2ZPEB 3RMQA 3WVEB 2F5TX 3CQTA 2OTLT 3LYIA 3QYGB 3I56A 4F7UB 2ZPBB 2R5MA 2MWOA 4X1VA 2DLPA 3SEMA 4OMQA 8AT1B 4M77E 1OULA 1Y96A 5I2MA 2E64A 4C5IA 2RJFA 3MCAB 4HKEA 4M75B 1M2VB 3GBQA 1VQ9T 1K8AR 4LDVA 1JJ2S 2LX9A 4GBQA 2KAFA 1TUDA 3N5BB 4A4EA 1QDNA 4C8QA 5CCBA 3SD4A 4FM4B 2DEUA 1IB8A 2LVMA 2RNAA 3FPUA 2LNVA 1VQ4Q 3CXCS 5GMKm 1GBRA 2QDYB 2QTXA 5GAMj 1IHWA 5B6CA 4DEYA 3OYAA 2ROTA 2OTJT 3HRSA 2RQTA 3QWZA 4Z88A 2DXTA 2O01E 3E1SA 4FSXA 4XQ3A 2OI3A 5FRMA 3VS5A 4JJBA 2YUJA 2VXFA 1QWEA 2CT4A 2XDBA 1CZ5A 3M0UA 5KCHA 3GOXA 3LW5E 3CCLQ 3JB9D 3OYEA 1B34B 2E70A 3CCMQ 1YIJQ 3CMAT 2E12A 2X4XA 3L2QA 1K0SA 4JS5A 1QVFP 4R56A 3CD6T 1NE8A 1J3TA 3PIOA 3HP9A 5FTMA 3P8DA 1Q7YR 1K9MC 3EGUA 3EG0A 1XQHA 2HSEB 1YJ9Q 1OOTA 2PVGB 5GANg 5A2QE 2COYA 1KJWA 2XDDA 1M1KC 2K2VA 2V1QA 4M75A 5J39A 2KNBB 2GQIA 1PNJA 2LT4A 2HL5C 1YI2A 3E9GA 5GAOm 2XKOC 3CPWP 3VRZA 1NJIC 1QCFA 1C1AA 2MF2A 4C0GA 4M7DC 1D1BA 2CZ7B 2KGTA 1HJDA 3UDCA 2V8IA 2YUOA 1SEMA 3QKJA 2HD0A 3CC7Q 2DPPB 1BIAA 1AEYA 3JCMd 4MDWA 2KYMA 2COWA 2DE0X 1HD3A 2LCCA 2ROLA 4J7FA 1ZSZC 5KE3A 5CKHA 4KDLA 1M3BA 1K9MU 1N9RA 1Q86R 4FU6A 5GAN6 2EYZA 2VXEA 4C5GA 1M1KU 5C6SA 5GMKi 5ERGB 2O2OA 3JCMP 4E7IA 1YJWA 2A36A 2CP3A 1YITT 4XU2A 2HAXA 3HU3A 2QAZA 3SDZA 3EG2A 2JTFA 4HT8A 3OYHA 5IH2A 4N0AC 3CC4A 2CSIA 2A28A 2FPFA 1VQNA 1DJ7B 2GGRA 1UUEA 3AT1B 3OYBA 3G71T 3OYJA 3G1JA 4M78C 3M57A 5CQYA 2YUPA 2ESWA 1VQ7A 3META 3AHUA 4D8DA 3X28B 3MJXA 3TQ7P 2E4HA 2BE7D 4ZN1A 1JJ2P 3U23A 2PVDB 1T0JA 4QQGA 3A8OB 2Q19X 2DD4A 4RTWA 4JJNK 2BE9B 2VKNA 3MPUB 3VKIA 1VQOA 4HVVA 1UJ0A 1YWOA 2Z0WA 1SSHA 5FWBA 2DTHA 3A1PA 1VQLQ 4WCIA 2M9UA 2R57A 2L3QA 1X43A 2H3JA 1D1CA 2QA4A 5LJ3h 2DXBA 3EG3A 3H8ZA 1S3SA 2FB7A 3CCRT 3SFMA 1NYFA 4C92D 3M56A 3VU3C 5C0MA 2BTTA 4A54A 1W70A 3QPHA 1KFZA 3LH5A 4PK4A 4L5GA 5LJ5h 1CR5A 5GJWB 3I56Q 4BE2A 3TSZA 2QDLA 2KT1A 3EHRA 3JCMg 2ATCB 2MPXC 4HCZA 1M90U 4J6WA 2XD0A 3ME9A 1WLPB 1BCOA 2CZ1B 2DRKA 2XIDA 2XU8A 4BACA 5GAN7 1RAGB 1V1CA 5FTLA 4UC4A 4M78F 4C92B 2KYBA 4M4ZA 3QO3A 1WXBA 1RI0A 1O54A 3M0RA 1RL2A 1ZBXA 4KO8A 2XDPA 4RTUA 2NUPB 4RTYA 2LT1A 4LDWA 1VA7A 3HFOA 5KYYB 2JZ2A 1SKUB 2CZ0B 3HL8A 2ZPIB 3BY7A 1KD1C 1XJWB 2LQWA 4ELYC 1VUBA 2YXYA 2RH2A 3OS1A 1NPRA 2LP5A 4M7DB 3C95A 5CR2A 2DTIA 4M7AC 1D0ZA 2X51A 3FRNA 3UA7A 2BZYA 3G6EA 2MOXA 1YN8A 3CCVT 1AD5A 5LJ3f 3QHSA 4AG1C 4PJOD 2JNGA 1Q82C 1ARKA 1RLQC 3H0HA 3HSBA 3ZL7C 4JZ3A 4Z02A 3G4SA 3TEEA 2RQWA 1W6XA 2QQBA 3VS1A 3TREA 2GFUA 2ECZA 3MP6A 1K73R 2IVWA 5DM7R 2MMPA 5LJ5f 3X26B 5M9OA 2AT1B 5CKFA 2JV2A 1SSFA 3C94A 3MEWA 2QI2A 1NYGA 1M27C 2X4JA 4PJLA 2HQHA 2EPDA 5FU7C 2COZA 3M53A 2VB6A 3SB2A 4PJOB 1FWZA 2F69A 1W4SA 4KGXB 2E6ZA 4C92A 3JCMV 3OYYA 1N9SA 1YI2Q 5FU6B 4WTOB 2LC4A 3QC8A 1W2BA 4LUDA 1QVGS 2VUBA 3QSUA 2D8HA 4IUTA 1Q82U 2EFIA 4DOWA 3C12A 4AFUC 1B07A 2KBTA 5KYXA 4LUEA 3FEOA 2V1RA 4N4GA 1M9SA 4JRQA 1HXDA 2KXDA 2DKGA 1X6BA 4BI3A 4YTLA 2RD1A 1M5Q1 2ABLA 4M7AF 2YHTA 2CP7A 2AZSA 2HDAA 2Y90A 1NEBA 5LJ3e 1WA7A 4PLLA 3CCUT 1YJNT 1RLPC 5CAIA 3OS5A 1YHQQ 1YJWQ 4O5VA 2NUTB 2WSCE 4J9EA 2EQMA 2DF6A 2LCLA 1E32A 2PWYA 3OBWA 4DOVA 3MHXA 4XTZA 1BKBA 3CBMA 2V8KA 3JCMJ 1VYVA 4C8QC 1X01A 1KIKA 3M4GA 3CC4Q 4CI0C 1TUGB 1VQNQ 2JOYA 3OW2S 4M78E 5DY9A 2R58A 3EG1A 1LVKA 2ENMA 4PJOA 2YRCA 4KH1B 4QVDA 5CCAA 1I5LA 3BDUA 2HBWA 3FLGA 2IG0A 1MNEA 3A8LB 4FYXB 2GQVA 4OP0A 1VQ7Q 3CCQA 3NFCA 3KFVA 1C0MA 2OAWA 5I2SA 3H6ZA 2GCXA 4LDXA 5GAMh 2RJDA 3RUXA 3HTRA 2MWPA 1X2KA 4KLNA 5DYGA 4OMLA 2JMAA 3L1AA 1FYNA 4XTUA 3RERA 3OYIA 1VQOQ 5GJVB 1QLYA 3CCET 4BI4A 3CCJT 1VQ6T 3OY9A 3RNJA 3UPUA 5AT1B 2QA4Q 2J6OA 1MMDA 2L2PA 5LJ5j 1Q7YC 3CC2A 4J9IA 2RPNA 2DL8A 4E7LA 1JO8A 5CIUA 4EMKB 4KRTA 1D0YA 4KBMB 4Z89A 2NUTA 3WVDB 3MKDA 1MMNA 9ATCB 3L2ZA 1YIJT 1I0CA 2XG8D 1HK9A 4C8QF 1GFCA 2EYXA 4BB7A 1BI3A 1G83A 2WSEE 4PLIA 1K1ZA 2DZCA 2DAQA 1WPYA 2DVEA 1FMWA 3CBOA 2K3BA 4AFQC 5GANj 4HVWA 1O75A 4QKUA 3RKYA 1JB0E 2LQNA 4F04B 3M0TA 5GAMf 2WACA 3M59A 1CZ4A 3JCMb 1Q7YU 3PE0A 5KYNA 2RHUA 3RKXA 1Q86C 1QVGP 4OMFB 2DYIA 1EX4A 2DZ9A 2DJZA 3I5SA 4AQ7A 4B6MA 2EW3A 4M7AE 2RI2A 3QYHB 1I5OB 4M77D 1KSWA 2GTOA 1IGUA 1VYTA 2AKKA 2PQWA 3VS4A 1VQ5T 2HSPA 3EHQA 3G6EQ 1PSFA 2QGFB 3FIFA 2FRYA 1OQKA 1H8KA 2DJQA 4CC7A 1JQQA 3EGDB 4IUQA 4R0KA 2DK3A 5J26A 2L3SA 3G4SQ 2RJCA 3VS3A 3GNFB 4RG8A 4EMKA 2VYTA 3MEAA 4M77B 4OMNA 4OB2B 2O4XA 1Q86U 1Q95G 3S3MA 1G5VA 3RBBB 3L2UA 1GL5A 2C0IA 2M0OA 4ELZC 2DBMA 3X20B 4BE0A 3OW2P 1VQLA 1BI2A 1KQ2A 2J06A 3QJ6A 3PTAA 3A8GB 5GANd 2LMJA 1XNIA 1Y0MA 1I4K1 2DBKA 2O9SA 4OGEA 1UTIA 1VQ8Q 2HZYA 1VQMA 2CP2A 1N8RR 5GAMe 2I0NA 3VS0A 3QDFA 3M54A 4KH0B 4DA4A 4HT9A 1I1JA 3NTHA 5KYUB 2NWMA 4Z8AA 2KRSA 2B86A 2EJ9A 4F7UG 4KGVB 1VQ9A 1D0XA 1G3SA 1BU1A 4GY5A 1I07A 4FYYB 2BIVA 4E2FB 5GAOr 2AZVA 2YLBA 3CMET 4M75G 2JM8A 1C6VX 1G3YA 2LTOA 3EGDA 3RKWA 5L8RE 3JB9I 4PKCC 4IIMA 2X4YA 2D0NA 5KH6A 1MNDA 4C0FA 2RHZA 4C8QE 2KDSA 2HCKA 3JAME 2JS2A 3PVLA 2QASA 1YP5A 2OTJA 1PWTA 4XU3A 2RK2A 2HBPA 2PUOB 3UA6A 4KT0E 1N5ZA 2O9VA 4AS1A 4NL2A 2X4WA 4HCCA 3EGXB 1G3WA 2PNIA 1M4ZA 2RB6A 3CCQQ 3CMAA 3PIPA 3JCMX 2K57A 3CD6A 2LZ6B 4EMHA 2Q1AX 2DFUA 2M51A 1KC8C 2Q1DX 2DXUA 4FW1A 1ZA1B 4E7JA 3CCST 5KYUA 4LE9A 4F7UA 3M0QA 2BUDA 5CKBA 1K73C 1OU8A 2M16A 1WGSA 2RM4A 1I8FA 2LDMA 1QP2A 1R0BG 1WJSA 2DVJA 5D6YA 4RTZA 2LQKA 1R8OB 4M75E 5KCOA 2JMCA 3OYGA 3BE3A 3DLMA 1M2VA 3JB9G 3CC2Q 4E7KA 1JU5C 2Q1CX 2X3WD 5CKDA 2DMOA 1ACMB 3JRZA 2BKDN 3LGAA 3L2RA 5DYIA 2X3XD 1M8MA 4RKUE 1OZ3A 2VVKA 1QWFA 1Q81R 1KC8U 3HPWA 4MDXA 2EAYA 4DBHA 2FZCB 4LNPA 4Y92A 2QQ9A 4ANJA 3I9QA 1K73U 3A98A 2XICA 1PM3A 2KRMA 3NMZC 3THKA 4HCBA 2J6KA 4AT1B 1RADB 2ZPFB 1YHQA 4FL6A 1B34A 2EJGA 3G71A 2E65A 2K6DA 1UGPB 1UJYA 2FVUA 1WFWA 2EJFA 2ED1A 4A4FA 4V2SA 3EFSA 3QWXX 2HQXA 3H0FA 2L89A 2OAUA 1OI1A 3VRYA 1AHJB 1MUZA 3LGFA 3SWNC 4XTWA 1IZ6A 1BYMA 2F1LA 2EYQA 1D3BB 2CYZB 4OVAA 1M3AA 1N27A 2VWFA 1T0HA 4LD9K 1MGQA 1QCOA 2RQVA 4TVRA 1TOVA 1VQPA 2DILA 4P5NA 4ME7A 1GFDA 1WLFA 1VQKT 2CP0A 2QQRA 5FTJA 1W2BS 5FTNA 1M90C 4RMOA 4MZMA 4QVZA 3PMTA 2X9HA 2HEQA 2BZXA 2KROA 3LLRA 3CXCP 2EQIA 2YSQA 3OYKA 2M1HA 2RHYA 4XTYA 4PJMA 3V8KA 1QKWA 2KQWA 1NEGA 4KODA 2R5AA 4NL3A 2QXFA 4RCBA 1VQMQ 3T9NA 4XU1A 3HRUA 3PT9A 3RR6A 4C0DC 3ZGZA 2LQ8A 1UE9A 1ZUUA 1LCKA 4OGCA 1SPKA 2G3RA 3OSSC 5IHNA 5I11A 1UG1A 1VQ9Q 3HKSA 2J6FA 1S72T 2J05A 4JJDA 1TU0B 2L0AA 4E7HA 2WSFE 2DYBA 2K3YA 2RO0A 2W10A 4BY6C 4ESRA 1PRMC 2QYZA 5IN1A 3UT1A 2EGAA 1D3BA 3ZFJA 4M7DD 4J9DA 4C92G 5A0DA 4RG2A 2HNIA 2V26A 4PNOA 2KK4A 3TSWA 3TU4K 1B3QA 1W1FA 1FMKA 5GANh 5GMKj 1QCSA 1G2BA 2FO0A 2OTJQ 3CBPA 3CCVA 1I81A 3REAB 1E7OA 1I9GA 4JLIA 4XAXB 2C06A 4M7DG 2KMTA 1WDXA 3TCJA 2EKHA 4C0ZA 1UECA 5A0GA 1SF9A 5CO7A 3CMAQ 1GCQA 1G8XA 3CD6Q 5FW9A 3QUIA 1OX8A 2P0PA 3P8BB 2YWWA 1ZSZB 1MHNA 3FB9A 3C4SA 1RAHB 3G7ZA 1OPKA 3GIBA 4M78D 2Y4XA 5EQJB 3V7RA 1TWBA 1KG1A 2RF0A 5DLOA 4LXCA 2KY9A 1V29B 2VV5A 3HU1A 2MAMA 5A0LA 4ZGEB 2EYWA 1SHGA 1AOJA 3G6ET 4PJOG 2DERA 4OF1A 4C92E 2E1HA 4KGZB 2L3RA 1K9MR 1JBMA 2RK1A 2GBQA 1VQ8A 1GXIE 4J6XA 4X9CA 3GP8A 1Z9ZA 2ED0A 4M78B 2NUPA 4NOYA 3DLLA 5GANf 5KYYA 2QEXT 4ATOA 1H641 2CP5A 1N8RC 1W2BP 2OX7A 4RV0A 2CGHA 1NJIR 1LJOA 2RJEA 3CCUA 1YJNA 1OYXA 2HKQB 5GAN2 1MV3A 3DB3A 1LPLA 3MP8A 4EMGA 4M7DA 1PRLC 1WYXA 3M0SA 4J8OA 3MB5A 2A0FB 1TH7A 4EPCA 4QT7A 2DXCA 2KI7A 2KT8A 2H3EB 3FPRA 1IXDA 1X27A 3CEYA 2DIGA 5GAOn 4FW2A 1K8AC 6AT1B 3G71Q 1X6OA 4JLGA 3NTIA 1RAAB 5D6XA 2ZGWA 5LJ5e 3JCMQ 3KBGA 2QQSA 2YLCA 1H92A 1CKAA 1NG2A 2K4YA 1G3TA
chains in the Genus database with same CATH topology
2VYTA 2XDDA 4ARIA 1M1KC 3ZJTA 3MEAA 4M77B 1N8RU 2K2VA 4M75A 5J39A 2HQEA 5D6WA 2RI5A 4PJOE 3JCMc 2V8JA 2LT4A 4JRIA 1YI2A 2JV2A 3E9GA 5GAMg 3OMCA 1WQWA 4OB2B 5GAOm 2XKOC 2O4XA 1Q86U 5HKCA 2D6FA 3S6WA 4N0AA 5FROA 3S3MA 1G5VA 4BUGA 3L2UA 1NJIC 3JCMh 2MF2A 2M0OA 2XHCA 4C0GA 2YVLA 4M7DC 2LW6A 1KQSS 4ELZC 4GLKA 2CZ7B 5CVIA 1PSEA 3RESA 3X20B 3UDCA 4BE0A 3X25B 1BI2A 2PU9B 2V8IA 3QKJA 1VQLA 1KQ2A 2HD0A 3OS0A 1KQSA 2DPPB 1BIAA 3QJ6A 3CCEA 3PTAA 3A8GB 4M7AD 5GANd 4ZGDB 5GANe 3VV0A 5EPPA 3CCJA 1XNIA 1VQ6A 1Y71A 1BI1A 1I4K1 3QZ9B 4OGEA 3JCMd 3VUZA 4MDWA 4N4HA 2PVOB 3F70A 1K8AU 1VQMA 2LCCA 5GAMe 1VQ4T 4EMKA 4J7FA 3M54A 5KE3A 4ZTJA 3QJYA 3I55A 1LNXA 5CKHA 2DO3A 4DA4A 4KDLA 1K9MU 4NS5A 1N9RA 4N4IA 3NTHA 4HT9A 2K5LA 1O9SA 2EJ9A 2KVQG 4FU6A 5GAN6 2VXEA 2KSSA 4C5GA 4F7UG 4QW2A 5C6SA 1M1KU 5GMKi 5ERGB 2ZZDA 4XU0A 4QVCA 1VQ9A 2DTOA 5GMKl 3JCMP 4EMKC 3RMSA 4E7IA 1G3SA 3VYHB 4GY5A 1P92A 4M7AB 1QW1A 1YJWA 3MEUA 3M9QA 4M75C 4XU2A 1YITT 2BIVA 2HAXA 3HU3A 5GAOr 3CCLT 3L2WA 3SDZA 4J6YA 2YLBA 2JTFA 4HT8A 1UB4A 4KDIA 5KE2A 3CMET 3OYHA 4M75G 3CCMT 1G3YA 4C5HA 2JN0A 4N0AC 3ER0A 4XK8E 3CC4A 2A7YA 2LTOA 2PUKB 1VQNA 4CQNA 1DJ7B 5L8RE 3RKWA 3JB9I 4PKCC 1NJIU 3OS2A 3OYBA 3OSVA 2X4YA 3G71T 4L6V5 5KH6A 2QEXA 3PMIA 3OYJA 5FTKA 4C0FA 4MMKA 4M78C 2RHZA 3M57A 2KDSA 3Q1JA 5CQYA 4C8QE 3LWIA 4BE2A 2QQAA 3JAME 3SWNB 3G4ST 1Q81C 1YJ9T 3GLXA 2JVVA 1VQ7A 1ZQ1A 4M78G 3META 4LD6A 3AHUA 2OTJA 4XU3A 3X28B 1KD1U 2RK2A 2XI9A 2HBPA 4KUDK 2PUOB 4ZN1A 2P0QA 5FU7B 3VJPA 2PVDB 3JCMf 3V8JA 3HFNA 4KT0E 4ZGJB 4QQGA 3A8OB 4AS1A 2Q19X 3VYGA 2DD4A 4NL2A 4DQ2A 4JJNK 1M1FA 2X4WA 3DKMA 4HCCA 3L42A 1G3WA 4M7DE 2K3XA 1M4ZA 2RB6A 3VKIA 3P8HA 3OMGA 3CMAA 2EQUA 3PIPA 3OYCA 1VQOA 3JCMX 3CC7T 2DIQA 2K57A 3CD6A 2DTHA 3BDLA 5HK3A 2M9UA 1QVPA 4EMHA 2R57A 2Q1AX 3RIRA 1KC8C 2Q1DX 2H3JA 2DXUA 3PGGA 4A53A 2QA4A 5LJ3h 2DXBA 4A4GA 4E7JA 1VQ8T 4IURA 4QQDA 4F7UF 3CCST 5CD1A 3H8ZA 4BD3A 1S3SA 2FB7A 5HY6A 4IKFA 3OB9A 3CCRT 3SFMA 4ZN3A 5C18A 2CZ6B 4C92D 3M56A 4F7UA 5GLFA 3VU3C 5C0MA 4BDYA 2BUDA 2RHXA 5CKBA 4A54A 1Q81U 1K73C 3QPHA 2EQKA 3GF5A 2CKKA 2M16A 2RM4A 1WGSA 4HA8A 4B9WA 4C8QD 1I8FA 4CRIA 3FC3A 2LDMA 4M75F 4M77C 3A8MB 1QP2A 3M4YA 1WJSA 4L5GA 4C0DB 5LJ5h 1CR5A 4MZTA 5D6YA 2LQKA 5C1BA 1BI0A 1R8OB 2X35A 4M75E 5KCOA 1UGRB 2DD5A 3OYGA 3DLMA 5CKEA 3ASKA 4M77G 3JCMg 5CCXA 1X75C 3OBYA 3JB9G 4FIBA 4MMLA 4HCZA 4E7KA 1M90U 4J6WA 2XD0A 3ME9A 2Q1CX 2AHJB 1NPPA 2CZ1B 2EKOA 5CKDA 2XIDA 3FPTA 4JRPA 2XU8A 4BACA 3JRZA 4JRKA 5GAN7 5FTLA 4BY6B 4UC4A 1R7RA 4M78F 4C92B 2BKDN 3LGAA 3L2RA 3V8LA 5DYIA 4WF2A 3QO3A 3SWNA 4RKUE 1RI0A 4IUVA 1VQ4A 1OZ3A 1O54A 4C8QB 4M78A 1RL2A 3EFRA 3L2VA 1KC8U 1ZBXA 3HPWA 4KO8A 2XDPA 4MDXA 3LX7A 5AYFA 2EAYA 4ZTFA 2LT1A 4LDWA 2OTLA 3HFOA 2I2LA 3JCMe 2JZ2A 4KUIA 3NTKA 3ZJVA 3QG1A 2QQ9A 1WJRA 2CZ0B 3HL8A 4C5EA 2ZPIB 2B8AA 4XTVA 2RI3A 3BY7A 1QP3A 3JB9J 1K73U 1KD1C 5I21A 3INZA 2DEQA 5GAN8 3S3OA 3QIIA 2PJHB 4ELYC 1VUBA 3E19A 1U1SA 2XICA 2RH2A 3OS1A 1NPRA 3CCLA 4M7DB 3C95A 2K5FA 3OQ5A 5CR2A 2DTIA 4HCBA 4Y91A 4M7AC 3FRNA 3CMEA 3CCMA 2ZPFB 3CCQT 1YIJA 3G6EA 3O8VA 1YHQA 3OA6A 4FL6A 3CCVT 2JTMA 5LJ3f 5LJ3j 1B34A 4OB1B 3QHSA 5DLQE 4M7AG 2EJGA 2FHDA 1VQLT 3G71A 2E65A 4PJOD 4JDSA 2JNGA 2E5QA 1Q82C 1U8RA 4M7DA 1IREB 3R6OA 3HSBA 1UGPB 3CF2A 2FVUA 2EJFA 1VIEA 4Z02A 2MI6A 3G4SA 1KQ1A 3TEEA 1YJ9A 1GXIE 4II1A 4A4FA 4V2SA 2QQBA 2HQXA 3EFSA 2GFUA 3TREA 4D6WA 3WXMB 2L89A 3MP6A 2OAUA 1OI1A 5GAN3 1AHJB 2IVWA 3LGFA 4IUPA 2MMPA 5DM7R 3KUFA 5LJ5f 3X26B 4M77F 3SWNC 5M9OA 5GAN4 3GPLA 4XTWA 1IZ6A 5CKFA 3JB9F 2EYQA 1D3BB 2F5KA 1SSFA 2CYZB 1BYMA 4JS4A 4OVAA 3C94A 4BI8B 3MEWA 2QI2A 1UEBA 3I55T 5IT9E 2X4JA 1YCYA 1N27A 5GAN5 4M77A 3LWHA 1BIBA 3QXEB 4BDZA 4LD9K 3LHDA 1MGQA 4TVRA 2ZCFB 2A3LA 3HRTA 5FU7C 3I56T 1VQPA 2RA2A 3UWNA 3LH0A 3M53A 2CS7A 3SB2A 4PJOB 3DB4A 3BQBA 1FWZA 2F69A 1W4SA 4P5NA 4ME7A 3CC2T 1WLFA 1VQKT 2E6ZA 2O4XB 3CC7A 4C92A 2QQRA 3JCMV 3OYYA 5FTJA 1W2BS 5GMKh 5FTNA 1N9SA 1M90C 3M58A 5FU6B 4RMOA 2FYKA 1XTDA 2LC4A 2LRQA 4MZMA 4QVZA 5CQXA 1H3ZA 3FJPA 2P0KA 2XK0A 1W2BA 3QC8A 2E6NA 3MP1A 3PMTA 1U1TA 4IUUA 1VQ5A 5FRNA 3CCSA 4L59A 1QVGS 5LJ3g 5GAOl 2VUBA 3V7CA 3QSUA 1ZC1A 3M55A 4IUTA 1Q82U 2EFIA 2L8DA 1QVGA 3OYNA 4DOWA 3J81E 3C12A 5EG2A 3LLRA 3OYKA 1JRIA 2M1HA 2RHYA 3FEOA 4XTYA 3OYMA 3V8KA 4N4GA 4J83A 2KQWA 4KODA 1UGQB 1M9SA 1KHIA 2D0QB 4JRQA 2R5AA 4NL3A 5LJ5g 2QXFA 1HXDA 4RCBA 4F7UE 2DKGA 4BI3A 4YTLA 3T9NA 2RD1A 1M5Q1 1QVFS 4XU1A 4KULA 4M7AF 1M8VA 3HRUA 3PT9A 2Y4YA 4QQ6A 4C0DC 3ZGZA 2YHTA 1M1GA 2LQ8A 1LOJA 3QBYA 1QVFA 2Q18X 1XOVA 5LJ3d 2Y90A 5LJ3e 3MEVA 4M7AA 1WJQA 3QQ7A 3BFMA 2D9TA 2ZPGB 3FDRA 4PLLA 3CCUT 1YJNT 2MM0A 3M5AA 4OGCA 3OYLA 2G3RA 3OSSC 4RCCA 5CAIA 1Y96B 1FXXA 3OS5A 4BE1A 3HKSA 3X24B 3GNGA 1S72T 4E7HA 4O5VA 3J80E 2WSFE 3J7AF 4FT4A 2WSCE 4BY6C 2EQMA 2RO0A 2K3YA 2LCLA 2P4TA 4C92C 2E41A 1E32A 3OBWA 4DOVA 2PWYA 3MHXA 3ZEHA 4XTZA 5LJ5d 1BKBA 2VGMA 3CPWS 5IN1A 1FX7A 3UT1A 3CBMA 2V8KA 1D3BA 3JCMJ 3ZFJA 4C8QC 1VQMT 1X01A 4A4KA 4C92G 4Q5WA 5A0DA 3M4GA 2EIFA 4M7DD 3ZBDA 4O6JA 4CI0C 3CPWA 5HK0A 2MM2A 2GF7A 2JOYA 1Y7XA 5GAOp 4M78E 3OW2S 3QZ5B 4RG2A 3OYDA 2HNIA 4X34A 4C8QG 1KHCA 5DY9A 2R58A 2KK4A 4PNOA 4B9XA 3OW2A 1YBYA 3QQ8A 3TU4K 2FL7A 4PJOA 4EDUA 4QVDA 5CCAA 1I5LA 1UGSB 3BDUA 3FLGA 2IG0A 3A8LB 4OP0A 3JSCA 2GQVA 5GMKj 5GANh 3JB9H 1QCSA 3CCQA 3NFCA 3CBPA 3CCVA 1I81A 1EIFA 5I2SA 3H6ZA 2GCXA 1NZ9A 1YITA 5GAMh 4LDXA 1WQ7A 1I9GA 3PFSA 1YI2T 2NLUA 2EWNA 2RJDA 4JLIA 3RUXA 4XAXB 2C06A 4M7DG 2MWPA 2KMTA 4E47A 3HHTB 3TCJA 3URGA 5IAYA 4KLNA 5DYGA 4C0ZA 4A4HA 5A0GA 3L1AA 1VQNT 4M75D 3CPFA 5CO7A 5GAMd 5GAOq 4XTUA 3JCMW 3RERA 3OYIA 4XTXA 4ARCA 3CCET 3QUIA 3VUBA 2GFAA 3BW1A 3HU2A 4BI4A 2ZPEB 2P0PA 3P8BB 2F5TX 4OB0B 3RMQA 3WVEB 3OY9A 3CCJT 1VQ6T 5CCBA 2OTLT 3UPUA 1MHNA 3LYIA 3QYGB 3I56A 4F7UB 3LGLA 4OB3B 2ZPBB 2R5MA 5GANg 5LJ5j 3FB9A 2MWOA 3C4SA 1Q7YC 3G7ZA 3GIBA 4M78D 3CC2A 1VIFA 2Y4XA 1VQKA 5EQJB 2YRVA 3V7RA 4E7LA 4M77E 2VC8A 5DLOA 1KG1A 5CIUA 1Y96A 1OZ2A 5I2MA 4EMKB 4PJOC 2KY9A 2B25A 2E64A 4C5IA 1V29B 2VV5A 3HU1A 2ZPHB 4KBMB 2RJFA 3MCAB 2MAMA 4HKEA 4M75B 3EAEA 3WVDB 4Y28E 4ZGEB 5A0LA 4C92F 2EQJA 3L2ZA 1VQ9T 1YIJT 3G6ET 2JUFA 4PJOG 4LDVA 1YHQT 1JJ2S 2XG8D 4MZPA 4OF1A 5FU6C 1ZHIA 2LX9A 5FLXE 1YJWT 2KAFA 4C92E 1HK9A 3E9FA 4C8QF 2E1HA 3N5BB 4BB7A 2L3RA 1BI3A 4A4EA 1JJ2A 4JUVA 1JBMA 2RK1A 2WSEE 1QDNA 4PLIA 4C8QA 2DZCA 1VQ8A 2DAQA 4FT2A 3CC4T 1WPYA 4J6XA 4FM4B 4X9CA 2DVEA 3QDRB 3SD4A 4M78B 3V7SA 3CBOA 4NOYA 4R55A 3GP8A 3CCRA 3DLLA 2LVMA 5GANf 2QEXT 5GANj 4ATOA 3FPUA 2LNVA 5GMKe 1O75A 3RKYA 1JB0E 1H641 3CXCS 1N8RC 4RV0A 1N6AA 5GMKm 2CGHA 4M7DF 5GAMf 2WACA 1LJOA 2QTXA 2QDYB 2RJEA 2VGNA 3M59A 5GAMj 3OYAA 3CCUA 1CZ4A 3CXCA 5B6CA 1YJNA 1OYXA 3JCMb 1VQPT 1VQ7T 1Q7YU 5GAN2 3HRSA 4J5YA 2OTJT 2E10A 3DB3A 3MP8A 4LDUA 3QWZA 4EMGA 2RHUA 3RKXA 3A8HB 1Q86C 2DXTA 2O01E 3E1SA 4FSXA 4OMFB 5CK9A 4XQ3A 2DZ9A 2K5IA 5FRMA 2DJZA 1Y07A 4AQ7A 1S72A 2YUJA 2VXFA 2XDBA 4J8OA 1WNLA 4VUBA 4M7AE 3MB5A 1CZ5A 2RI2A 3QYHB 1TH7A 4M77D 5KCHA 3GOXA 4EPCA 3LW5E 3JB9D 5J3BA 2DXCA 3S3NA 3OYEA 1B34B 2E70A 2L5QA 3FPRA 2PQWA 1VQ5T 4J7IA 3MO8A 3CEYA 4X9DA 3CMAT 2E12A 2X4XA 3L2QA 3TIWA 3KXTA 1PSFA 1VQOT 2DIGA 4JS5A 3ZJUA 3FIFA 5GAOn 4R56A 3CD6T 1NE8A 3OYFA 1K8AC 3PNWC 1X6OA 4IUQA 3PIOA 3HP9A 3NTIA 4JLGA 5D6XA 2ZGWA 5LJ5e 3JCMQ 5FTMA 2DK3A 3KBGA 2QQSA 2YLCA 2QA4T 3P8DA 4LDYA 4PL6A 5J26A 1K9MC 2K4YA 1G3TA 1XQHA 2RJCA 5LL6S 2RHIA 4PJOF 2PVGB 3GNFB 5A2QE 4RG8A 3A5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIQ A;  2VYT A;  3BDL A;  4BDZ A;  4A4H A;  3MEA A;  5J39 A;  2HQE A;  5D6W A;  2R57 A;  2RI5 A;  3UWN A;  3LH0 A;  3E9G A;  3OYI A;  3DB4 A;  4A4G A;  4E7J A;  3OMC A;  4IUR A;  4QQD A;  3H8Z A;  4BD3 A;  4IKF A;  2O4X A;  3OB9 A;  2GFA A;  3S6W A;  5FRO A;  2O4X B;  2QQR A;  3S3M A;  3L2U A;  3OY9 A;  1G5V A;  2M0O A;  4B9W A;  1MHN A;  3LYI A;  5C0M A;  4BDY A;  2LRQ A;  3LGL A;  4QVZ A;  2BUD A;  2RHX A;  4IUU A;  4BE0 A;  1H3Z A;  2P0K A;  2XK0 A;  3QKJ A;  2E6N A;  2EQK A;  2CKK A;  2M16 A;  2R5M A;  1WGS A;  3MP1 A;  2MWO A;  3PMT A;  3C4S A;  4CRI A;  3OS0 A;  2LDM A;  3QJ6 A;  4L59 A;  5FRN A;  1WJS A;  2YRV A;  4IUT A;  5D6Y A;  4E7L A;  1XNI A;  2EFI A;  2L8D A;  5CIU A;  1OZ2 A;  3OYN A;  5KCO A;  2X35 A;  3OYG A;  4BE2 A;  3LLR A;  3DLM A;  4C5I A;  3ASK A;  4N4H A;  3F70 A;  2RJF A;  3OYK A;  2M1H A;  2RHY A;  3EAE A;  2LCC A;  4HCZ A;  3FEO A;  2EQJ A;  4E7K A;  3ME9 A;  3OYM A;  4N4G A;  2EKO A;  4ZTJ A;  5KE3 A;  2R5A A;  3E9F A;  4NS5 A;  4BAC A;  4N4I A;  3NTH A;  2L3R A;  4A4E A;  4UC4 A;  2BKD N;  3L2R A;  4FU6 A;  4QQ6 A;  4C5G A;  5C6S A;  4PLI A;  4QW2 A;  1RI0 A;  4IUV A;  3QBY A;  1OZ3 A;  2DAQ A;  3SD4 A;  3MEV A;  3L2V A;  1WJQ A;  3FDR A;  2D9T A;  4PLL A;  4E7I A;  4GY5 A;  2XDP A;  3MEU A;  3M9Q A;  3OYL A;  2LVM A;  3LX7 A;  2BIV A;  2G3R A;  4ZTF A;  3L2W A;  2JZ2 A;  3NTK A;  4BE1 A;  2JTF A;  1WJR A;  4C5E A;  5KE2 A;  3OYH A;  4E7H A;  2B8A A;  2RI3 A;  4C5H A;  2WAC A;  2EQM A;  2K3Y A;  2LTO A;  2RJE A;  2RO0 A;  3OYA A;  3ZEH A;  1OYX A;  3S3O A;  3QII A;  3OS2 A;  3DB3 A;  5IN1 A;  3MP8 A;  3OYB A;  2X4Y A;  2RHU A;  3UT1 A;  5KH6 A;  3OS1 A;  3PMI A;  3OYJ A;  3FC3 A;  4Q5W A;  3OQ5 A;  5FRM A;  2RHZ A;  3Q1J A;  2GF7 A;  4RG2 A;  3OYD A;  3O8V A;  2RI2 A;  4X34 A;  1KHC A;  4FL6 A;  5KCH A;  3OA6 A;  3GOX A;  2R58 A;  3MET A;  4LD6 A;  4B9X A;  3S3N A;  2FHD A;  3OYE A;  4EDU A;  2PQW A;  2E5Q A;  3MO8 A;  3CEY A;  3FLG A;  2IG0 A;  2X4X A;  3L2Q A;  2DIG A;  4QQG A;  4Z02 A;  3OYF A;  3PNW C;  4II1 A;  4A4F A;  2X4W A;  2HQX A;  2GFU A;  4IUQ A;  3NTI A;  2L89 A;  3H6Z A;  3L42 A;  1OI1 A;  3MP6 A;  3LGF A;  4IUP A;  2K3X A;  5D6X A;  3PFS A;  2QQS A;  3KUF A;  2NLU A;  5M9O A;  3P8D A;  4PL6 A;  2RJD A;  3P8H A;  5J26 A;  2F5K A;  1SSF A;  3OMG A;  2MWP A;  2EQU A;  2RJC A;  4OVA A;  3MEW A;  2RHI A;  3OYC A;  5IAY A;  1N27 A; 
#chains in the Genus database with same CATH topology
 4ARI A;  2E3I A;  3R6N A;  3ZJT A;  1N8R U;  4PFZ A;  2RI5 A;  4PJO E;  2V8J A;  1E6G A;  3JV3 A;  1WQW A;  2JTE A;  1VOM A;  5HKC A;  3S6W A;  4N0A A;  5FRO A;  1D09 B;  1V76 A;  1ZSG A;  2EGC A;  1VQP Q;  4BUG A;  4HCK A;  3JCM h;  1ZUY A;  2E5K A;  2XHC A;  3UF4 A;  2LW6 A;  4GLK A;  5CVI A;  2P4R A;  1PSE A;  3RES A;  3FPT A;  2PU9 B;  1KQS A;  3CCE A;  1TTH B;  4M7A D;  4ZGD B;  5GAN e;  3VV0 A;  1OEB A;  3H41 A;  5EPP A;  2CH4 W;  3CCJ A;  1VQ6 A;  1BI1 A;  2YUQ A;  2CH4 A;  4RTX A;  4N4H A;  1K8A U;  1VQ4 T;  1YFN A;  2C0O A;  2ZAE A;  4ZTJ A;  3I55 A;  2DO3 A;  4NS5 A;  4J9F A;  4N4I A;  1AWX A;  1O9S A;  2KRN A;  2KSS A;  2RMO A;  4XU0 A;  2DTO A;  3QWY A;  5GMK l;  3RMS A;  4M7A B;  1QW1 A;  1UHF A;  1RUW A;  3MEU A;  3M9Q A;  4M75 C;  2AIR B;  1ZUK A;  3I35 A;  3CCL T;  5FWC A;  4J6Y A;  4KDI A;  5KE2 A;  4ORZ A;  3CCM T;  1SRL A;  2H8H A;  4XK8 E;  2PUK B;  1OU9 A;  4CQN A;  2DL4 A;  3OS2 A;  2VAS A;  4L6V 5;  4MMK A;  1QCN A;  3LWI A;  2JW4 A;  2RN8 A;  2YRD A;  1Q81 C;  1YJ9 T;  4D8K A;  1U06 A;  1ZQ1 A;  2XI9 A;  1F1B B;  4KUD K;  2P0Q A;  5FU7 B;  3E2U A;  2FPD A;  3JCM f;  3V8J A;  4DBR A;  4ZGJ B;  1OX9 A;  2O88 A;  3VYG A;  1M30 A;  4DQ2 A;  1B7T A;  1M1F A;  2QGG A;  3RDV A;  2AKL A;  3L42 A;  2K3X A;  2JT4 A;  4JJC A;  3P8H A;  2FRW A;  3OMG A;  1WXU A;  2EQU A;  3CCV Q;  3OYC A;  3CC7 T;  3BDL A;  4OMO A;  5HK3 A;  3VS7 A;  1WHK A;  3RIR A;  3VS2 A;  3PGG A;  4A53 A;  4A4G A;  4F7U F;  1KD1 R;  5HY6 A;  3OB9 A;  5C18 A;  2CZ6 B;  2E3H A;  1K4U S;  5GLF A;  4BDY A;  2RHX A;  1Q81 U;  2YUN A;  1NLP C;  1RI9 A;  3GF5 A;  2CKK A;  4CRI A;  4C8Q D;  4M75 F;  3A8M B;  3M4Y A;  4J9B A;  4MZT A;  1ABO A;  5C1B A;  1BI0 A;  2F2V A;  2DD5 A;  1Q82 R;  3ASK A;  4M77 G;  5CCX A;  1X75 C;  3OBY A;  4FIB A;  4MML A;  1AWO A;  1YWP A;  2AHJ B;  4J9G A;  1NPP A;  4PJN A;  1UFF A;  4JRK A;  1R7R A;  2HKN A;  1A0N B;  3H9N A;  3V8L A;  4WF2 A;  2GNC A;  4C8Q B;  3EFR A;  3O5Z A;  4F16 A;  3L2V A;  4AFS C;  5L23 A;  2SEM A;  1H3H A;  3LX7 A;  5AYF A;  2EVR A;  2OTL A;  2I2L A;  3JCM e;  4KUI A;  3QG1 A;  2OJ2 A;  5HCK A;  4C5E A;  3C0C A;  1WHJ A;  1QP3 A;  1BK2 A;  3INZ A;  5I21 A;  5GAN 8;  3S3O A;  3QII A;  3NHN A;  2F2W A;  3OQ5 A;  4Y91 A;  3CME A;  3CCU Q;  1YJN Q;  3O8V A;  3OA6 A;  4OB1 B;  2FHD A;  1VQL T;  3FJ5 A;  2MK5 A;  1UHC A;  5I22 A;  1IRE B;  3R6O A;  3CF2 A;  1VIE A;  4E6R A;  2MI6 A;  4II1 A;  1ZA2 B;  2L3P A;  4D6W A;  3TVT A;  3WXM B;  4DBQ A;  2LJ0 A;  1RAF B;  5GAN 3;  4IUP A;  1VQM T;  5GAN 4;  1PD0 A;  3GPL A;  3JB9 F;  2F5K A;  1AT1 B;  4BI8 B;  1X6G A;  1YCY A;  4M77 A;  3LWH A;  4FCY A;  1BIB A;  3QXE B;  4BDZ A;  1WHH A;  2ZCF B;  2A3L A;  3HRT A;  5EC7 A;  3I56 T;  3UWN A;  2CS7 A;  3DB4 A;  4HXJ A;  1ZLM A;  4OMM A;  5GMK h;  4IIO A;  2JXB A;  2O31 A;  1XTD A;  5CQX A;  3NPF A;  2P0K A;  2E6N A;  3MP1 A;  4CC4 B;  1PC0 A;  5FRN A;  3CCS A;  4L59 A;  5LJ3 g;  1ZC1 A;  2M0Y A;  3J81 E;  1QKX A;  5ECA A;  1GCQ C;  3CCE Q;  1ZBJ A;  3OYM A;  3CCJ Q;  1VQ6 Q;  1KHI A;  5LJ5 g;  4GLM A;  2K79 A;  4F7U E;  1M8V A;  2D1X A;  5IXF A;  2CUB A;  1M1G A;  1LOJ A;  1QVF A;  3I55 Q;  2JM9 A;  3BFM A;  2D9T A;  2ZPG B;  2F2X A;  3H0I A;  2MM0 A;  3M5A A;  2LNH B;  4RCC A;  1AVZ C;  1FXX A;  4BE1 A;  1PG5 B;  4F14 A;  3J7A F;  1GRI A;  4C92 C;  2E41 A;  1WI7 A;  2QK0 A;  3ZEH A;  1U5S A;  1FX7 A;  4A4K A;  2EIF A;  4O6J A;  3CPW A;  1Y57 A;  2GF7 A;  5GAO p;  1Y7X A;  1QMC A;  3QZ5 B;  4X34 A;  1KHC A;  3QQ8 A;  1YBY A;  1MMA A;  1AZE A;  1SHF A;  2LJ3 A;  3EGX A;  1YIT A;  3PFS A;  1YI2 T;  1WHM A;  2NLU A;  1WX6 A;  4J9C A;  4E47 A;  3HHT B;  1VQ5 Q;  3CPF A;  5GAM d;  3JCM W;  2RQR A;  2PTK A;  4XTX A;  4ARC A;  3BW1 A;  3HU2 A;  4F17 A;  4OB0 B;  2W0Z A;  3I5R A;  3LGL A;  4OB3 B;  1EFN A;  1VIF A;  1VQK A;  4JPB W;  2YRV A;  2VC8 A;  2B25 A;  1OZ2 A;  4PJO C;  1JXO A;  2ZPH B;  1CSK A;  2EYY A;  1NJI U;  3EAE A;  4Y28 E;  2NYS A;  4C92 F;  2EQJ A;  2JUF A;  1YHQ T;  4MZP A;  5FU6 C;  1YJW T;  1ZHI A;  1ZX6 A;  5FLX E;  2J7I A;  2D8J A;  3E9F A;  1JJ2 A;  3ULR B;  4JUV A;  1BCM A;  2EBP A;  4FT2 A;  3CC4 T;  3V7S A;  2DET A;  3QDR B;  1VQN T;  4R55 A;  3CCR A;  5GMK e;  5IXB A;  1N6A A;  4M7D F;  1NLO C;  4AMC A;  2VGN A;  3CXC A;  2OTL Q;  1VQ7 T;  4LN2 A;  1VQP T;  2IPO B;  4J5Y A;  2E10 A;  4LDU A;  1AZG B;  2M02 A;  2CT3 A;  3A8H B;  5CK9 A;  1UDL A;  4ZNX A;  2K5I A;  4J9H A;  1Y07 A;  3NGP A;  1S72 A;  1SG5 A;  4VUB A;  1WNL A;  1R77 A;  5J3B A;  1UGV A;  3S3N A;  4K11 A;  2L5Q A;  1R0C B;  3CME Q;  4J7I A;  3MO8 A;  4X9D A;  3TIW A;  3KXT A;  1VQO T;  3ZJU A;  3OYF A;  3PNW C;  2DL7 A;  1IO6 A;  2FEI A;  2QTV A;  2QA4 T;  2DRM A;  2HL3 A;  4PL6 A;  4LDY A;  5LL6 S;  2RHI A;  4PJO F;  3A5Z B;  2DA9 A;  2SRC A;  2HQE A;  5D6W A;  3JCM c;  2MYS A;  4JRI A;  1TG0 A;  5GAM g;  3OMC A;  4EIK A;  2D6F A;  3PVQ A;  2CUD A;  2YVL A;  1BBZ A;  1KQS S;  2G6F X;  3X25 B;  3D7S B;  3OS0 A;  2IIM A;  1K76 A;  1TSF A;  1KK7 A;  1Y71 A;  3QZ9 B;  2RQU A;  3VUZ A;  2PVO B;  3F70 A;  3CCS Q;  2DM1 A;  5KYX B;  3QJY A;  1LNX A;  5IHI A;  4PJJ A;  1T3S A;  2K5L A;  4RTV A;  2KVQ G;  2KR3 A;  4QW2 A;  1D1A A;  2EGE A;  2HMA A;  2MIO A;  2ZZD A;  4QVC A;  1WIE A;  4EMK C;  3VYH B;  1P92 A;  1KC8 R;  3REB B;  3L2W A;  1AWJ A;  1UB4 A;  4C5H A;  2JN0 A;  3ER0 A;  2K2M A;  2A7Y A;  3SHW A;  1E6H A;  3OSV A;  2QEX A;  3PMI A;  5FTK A;  3Q1J A;  2C0T A;  2QQA A;  3SWN B;  2LX7 A;  3G4S T;  1M1K R;  3GLX A;  2JVV A;  2NUZ A;  4M78 G;  4LD6 A;  1HSQ A;  1KD1 U;  1IGQ A;  3VJP A;  1PKT A;  4RTT A;  3HFN A;  3DKM A;  2CRE A;  4M7D E;  2LCS A;  4CC3 A;  1AWW A;  2DIQ A;  2DL5 A;  1YIT Q;  3UAT A;  1QVP A;  2DNU A;  1VQ8 T;  4IUR A;  4QQD A;  1JXM A;  4JZ4 A;  5CD1 A;  4BD3 A;  4IKF A;  1BB9 A;  4ZN3 A;  1T3L A;  1ZSZ A;  2YT6 A;  2MCN A;  2EQK A;  4B9W A;  3FC3 A;  4HA8 A;  4FYV B;  3EH2 A;  4M77 C;  4C0D B;  2X35 A;  3EG9 B;  1UGR B;  4FSS A;  5CKE A;  1VQK Q;  1WHL A;  2EKO A;  4DBF A;  2XMF A;  4JRP A;  2K7A A;  2KXC A;  4BY6 B;  2PZ1 A;  5IHK A;  3SWN A;  1GBQ A;  1WZO A;  1VQ4 A;  4IUV A;  4M78 A;  2DX1 A;  4ZTF A;  4FYW B;  3ZJV A;  3NTK A;  1WJR A;  1GCP A;  4XTV A;  2B8A A;  3CCR Q;  2RI3 A;  1YCS B;  3JB9 J;  1TXQ A;  1KQS P;  1M90 R;  1PCX A;  2DEQ A;  2PJH B;  3E19 A;  1U1S A;  1M3C A;  2CSQ A;  5KYW B;  2AK5 A;  3CCL A;  8ATC B;  2KEA A;  2K5F A;  3EFO B;  1NBE B;  3CCM A;  3CCQ T;  1YIJ A;  2JTM A;  1RAC B;  1FMV A;  5LJ3 j;  1ABQ A;  7AT1 B;  5DLQ E;  4M7A G;  1S72 Q;  4JDS A;  2E5Q A;  1U8R A;  4CC2 A;  2FZG B;  1KQ1 A;  1YJ9 A;  1OPL A;  3KUF A;  4M77 F;  2FZK B;  4RUG A;  4JS4 A;  3I55 T;  1UEB A;  4PFO A;  5IT9 E;  1EZZ B;  3EG9 A;  5GAN 5;  2BZ8 A;  3LHD A;  1PD1 A;  2RA2 A;  3LH0 A;  3BQB A;  2P84 A;  3CC2 T;  2O4X B;  3CC7 A;  1Z9Q A;  3M58 A;  4E7S A;  1VYU A;  2FYK A;  2JS0 A;  2LRQ A;  1X2Q A;  1H3Z A;  3FJP A;  2XK0 A;  4IUU A;  1U1T A;  2K9G A;  1VQ5 A;  5GAO l;  3EH1 A;  3V7C A;  3M55 A;  1WHG A;  2L8D A;  1QVG A;  3OYN A;  1YNZ A;  2CDT A;  2JJ9 A;  5EG2 A;  1PHT A;  3M0P A;  3IQL A;  1JRI A;  1RAI B;  4J83 A;  1CKB A;  4OMP A;  1UGQ B;  4PFP A;  2D0Q B;  5KYW A;  1SRM A;  1OV3 A;  1IRX A;  3EFO A;  1TS9 A;  1QVF S;  2KE9 A;  4KUL A;  4QQ6 A;  2Y4Y A;  1WXT A;  2A08 A;  3QBY A;  2Q18 X;  1XOV A;  5LJ3 d;  3MEV A;  4M7A A;  1WJQ A;  3QQ7 A;  3FDR A;  1IHV A;  4E7Z A;  3OYL A;  1Y96 B;  2A37 A;  3X24 B;  3GNG A;  4HVU A;  3J80 E;  4FT4 A;  2P4T A;  5LJ5 d;  2VGM A;  2DL3 A;  2CP6 A;  3CPW S;  2FPE A;  1PKS A;  4Q5W A;  2MM2 A;  1U3O A;  3ZBD A;  5HK0 A;  1HYO A;  1K0X A;  1JEG A;  3OYD A;  4C8Q G;  2QEX Q;  4B9X A;  3OW2 A;  2FL7 A;  3VS6 A;  2LJ1 A;  4AG2 C;  1TUC A;  4EDU A;  4DEX A;  5D7U A;  1UGS B;  1RAB B;  1RAE B;  4A63 B;  3JSC A;  3JB9 H;  4AFZ C;  1QQJ A;  2QG9 B;  1MMG A;  1EIF A;  1NZ9 A;  1WQ7 A;  2YDL A;  2EWN A;  1S1N A;  5IAY A;  3URG A;  2FG0 A;  4A4H A;  1X69 A;  1K9A A;  1NM7 A;  4M75 D;  1M2O A;  5GAO q;  2GTJ A;  3VUB A;  1MV0 B;  2GFA A;  2ZPE B;  3RMQ A;  3WVE B;  2F5T X;  3CQT A;  2OTL T;  3LYI A;  3QYG B;  3I56 A;  4F7U B;  2ZPB B;  2R5M A;  2MWO A;  4X1V A;  2DLP A;  3SEM A;  4OMQ A;  8AT1 B;  4M77 E;  1OUL A;  1Y96 A;  5I2M A;  2E64 A;  4C5I A;  2RJF A;  3MCA B;  4HKE A;  4M75 B;  1M2V B;  3GBQ A;  1VQ9 T;  1K8A R;  4LDV A;  1JJ2 S;  2LX9 A;  4GBQ A;  2KAF A;  1TUD A;  3N5B B;  4A4E A;  1QDN A;  4C8Q A;  5CCB A;  3SD4 A;  4FM4 B;  2DEU A;  1IB8 A;  2LVM A;  2RNA A;  3FPU A;  2LNV A;  1VQ4 Q;  3CXC S;  5GMK m;  1GBR A;  2QDY B;  2QTX A;  5GAM j;  1IHW A;  5B6C A;  4DEY A;  3OYA A;  2ROT A;  2OTJ T;  3HRS A;  2RQT A;  3QWZ A;  4Z88 A;  2DXT A;  2O01 E;  3E1S A;  4FSX A;  4XQ3 A;  2OI3 A;  5FRM A;  3VS5 A;  4JJB A;  2YUJ A;  2VXF A;  1QWE A;  2CT4 A;  2XDB A;  1CZ5 A;  3M0U A;  5KCH A;  3GOX A;  3LW5 E;  3CCL Q;  3JB9 D;  3OYE A;  1B34 B;  2E70 A;  3CCM Q;  1YIJ Q;  3CMA T;  2E12 A;  2X4X A;  3L2Q A;  1K0S A;  4JS5 A;  1QVF P;  4R56 A;  3CD6 T;  1NE8 A;  1J3T A;  3PIO A;  3HP9 A;  5FTM A;  3P8D A;  1Q7Y R;  1K9M C;  3EGU A;  3EG0 A;  1XQH A;  2HSE B;  1YJ9 Q;  1OOT A;  2PVG B;  5GAN g;  5A2Q E;  2COY A;  1KJW A;  2XDD A;  1M1K C;  2K2V A;  2V1Q A;  4M75 A;  5J39 A;  2KNB B;  2GQI A;  1PNJ A;  2LT4 A;  2HL5 C;  1YI2 A;  3E9G A;  5GAO m;  2XKO C;  3CPW P;  3VRZ A;  1NJI C;  1QCF A;  1C1A A;  2MF2 A;  4C0G A;  4M7D C;  1D1B A;  2CZ7 B;  2KGT A;  1HJD A;  3UDC A;  2V8I A;  2YUO A;  1SEM A;  3QKJ A;  2HD0 A;  3CC7 Q;  2DPP B;  1BIA A;  1AEY A;  3JCM d;  4MDW A;  2KYM A;  2COW A;  2DE0 X;  1HD3 A;  2LCC A;  2ROL A;  4J7F A;  1ZSZ C;  5KE3 A;  5CKH A;  4KDL A;  1M3B A;  1K9M U;  1N9R A;  1Q86 R;  4FU6 A;  5GAN 6;  2EYZ A;  2VXE A;  4C5G A;  1M1K U;  5C6S A;  5GMK i;  5ERG B;  2O2O A;  3JCM P;  4E7I A;  1YJW A;  2A36 A;  2CP3 A;  1YIT T;  4XU2 A;  2HAX A;  3HU3 A;  2QAZ A;  3SDZ A;  3EG2 A;  2JTF A;  4HT8 A;  3OYH A;  5IH2 A;  4N0A C;  3CC4 A;  2CSI A;  2A28 A;  2FPF A;  1VQN A;  1DJ7 B;  2GGR A;  1UUE A;  3AT1 B;  3OYB A;  3G71 T;  3OYJ A;  3G1J A;  4M78 C;  3M57 A;  5CQY A;  2YUP A;  2ESW A;  1VQ7 A;  3MET A;  3AHU A;  4D8D A;  3X28 B;  3MJX A;  3TQ7 P;  2E4H A;  2BE7 D;  4ZN1 A;  1JJ2 P;  3U23 A;  2PVD B;  1T0J A;  4QQG A;  3A8O B;  2Q19 X;  2DD4 A;  4RTW A;  4JJN K;  2BE9 B;  2VKN A;  3MPU B;  3VKI A;  1VQO A;  4HVV A;  1UJ0 A;  1YWO A;  2Z0W A;  1SSH A;  5FWB A;  2DTH A;  3A1P A;  1VQL Q;  4WCI A;  2M9U A;  2R57 A;  2L3Q A;  1X43 A;  2H3J A;  1D1C A;  2QA4 A;  5LJ3 h;  2DXB A;  3EG3 A;  3H8Z A;  1S3S A;  2FB7 A;  3CCR T;  3SFM A;  1NYF A;  4C92 D;  3M56 A;  3VU3 C;  5C0M A;  2BTT A;  4A54 A;  1W70 A;  3QPH A;  1KFZ A;  3LH5 A;  4PK4 A;  4L5G A;  5LJ5 h;  1CR5 A;  5GJW B;  3I56 Q;  4BE2 A;  3TSZ A;  2QDL A;  2KT1 A;  3EHR A;  3JCM g;  2ATC B;  2MPX C;  4HCZ A;  1M90 U;  4J6W A;  2XD0 A;  3ME9 A;  1WLP B;  1BCO A;  2CZ1 B;  2DRK A;  2XID A;  2XU8 A;  4BAC A;  5GAN 7;  1RAG B;  1V1C A;  5FTL A;  4UC4 A;  4M78 F;  4C92 B;  2KYB A;  4M4Z A;  3QO3 A;  1WXB A;  1RI0 A;  1O54 A;  3M0R A;  1RL2 A;  1ZBX A;  4KO8 A;  2XDP A;  4RTU A;  2NUP B;  4RTY A;  2LT1 A;  4LDW A;  1VA7 A;  3HFO A;  5KYY B;  2JZ2 A;  1SKU B;  2CZ0 B;  3HL8 A;  2ZPI B;  3BY7 A;  1KD1 C;  1XJW B;  2LQW A;  4ELY C;  1VUB A;  2YXY A;  2RH2 A;  3OS1 A;  1NPR A;  2LP5 A;  4M7D B;  3C95 A;  5CR2 A;  2DTI A;  4M7A C;  1D0Z A;  2X51 A;  3FRN A;  3UA7 A;  2BZY A;  3G6E A;  2MOX A;  1YN8 A;  3CCV T;  1AD5 A;  5LJ3 f;  3QHS A;  4AG1 C;  4PJO D;  2JNG A;  1Q82 C;  1ARK A;  1RLQ C;  3H0H A;  3HSB A;  3ZL7 C;  4JZ3 A;  4Z02 A;  3G4S A;  3TEE A;  2RQW A;  1W6X A;  2QQB A;  3VS1 A;  3TRE A;  2GFU A;  2ECZ A;  3MP6 A;  1K73 R;  2IVW A;  5DM7 R;  2MMP A;  5LJ5 f;  3X26 B;  5M9O A;  2AT1 B;  5CKF A;  2JV2 A;  1SSF A;  3C94 A;  3MEW A;  2QI2 A;  1NYG A;  1M27 C;  2X4J A;  4PJL A;  2HQH A;  2EPD A;  5FU7 C;  2COZ A;  3M53 A;  2VB6 A;  3SB2 A;  4PJO B;  1FWZ A;  2F69 A;  1W4S A;  4KGX B;  2E6Z A;  4C92 A;  3JCM V;  3OYY A;  1N9S A;  1YI2 Q;  5FU6 B;  4WTO B;  2LC4 A;  3QC8 A;  1W2B A;  4LUD A;  1QVG S;  2VUB A;  3QSU A;  2D8H A;  4IUT A;  1Q82 U;  2EFI A;  4DOW A;  3C12 A;  4AFU C;  1B07 A;  2KBT A;  5KYX A;  4LUE A;  3FEO A;  2V1R A;  4N4G A;  1M9S A;  4JRQ A;  1HXD A;  2KXD A;  2DKG A;  1X6B A;  4BI3 A;  4YTL A;  2RD1 A;  1M5Q 1;  2ABL A;  4M7A F;  2YHT A;  2CP7 A;  2AZS A;  2HDA A;  2Y90 A;  1NEB A;  5LJ3 e;  1WA7 A;  4PLL A;  3CCU T;  1YJN T;  1RLP C;  5CAI A;  3OS5 A;  1YHQ Q;  1YJW Q;  4O5V A;  2NUT B;  2WSC E;  4J9E A;  2EQM A;  2DF6 A;  2LCL A;  1E32 A;  2PWY A;  3OBW A;  4DOV A;  3MHX A;  4XTZ A;  1BKB A;  3CBM A;  2V8K A;  3JCM J;  1VYV A;  4C8Q C;  1X01 A;  1KIK A;  3M4G A;  3CC4 Q;  4CI0 C;  1TUG B;  1VQN Q;  2JOY A;  3OW2 S;  4M78 E;  5DY9 A;  2R58 A;  3EG1 A;  1LVK A;  2ENM A;  4PJO A;  2YRC A;  4KH1 B;  4QVD A;  5CCA A;  1I5L A;  3BDU A;  2HBW A;  3FLG A;  2IG0 A;  1MNE A;  3A8L B;  4FYX B;  2GQV A;  4OP0 A;  1VQ7 Q;  3CCQ A;  3NFC A;  3KFV A;  1C0M A;  2OAW A;  5I2S A;  3H6Z A;  2GCX A;  4LDX A;  5GAM h;  2RJD A;  3RUX A;  3HTR A;  2MWP A;  1X2K A;  4KLN A;  5DYG A;  4OML A;  2JMA A;  3L1A A;  1FYN A;  4XTU A;  3RER A;  3OYI A;  1VQO Q;  5GJV B;  1QLY A;  3CCE T;  4BI4 A;  3CCJ T;  1VQ6 T;  3OY9 A;  3RNJ A;  3UPU A;  5AT1 B;  2QA4 Q;  2J6O A;  1MMD A;  2L2P A;  5LJ5 j;  1Q7Y C;  3CC2 A;  4J9I A;  2RPN A;  2DL8 A;  4E7L A;  1JO8 A;  5CIU A;  4EMK B;  4KRT A;  1D0Y A;  4KBM B;  4Z89 A;  2NUT A;  3WVD B;  3MKD A;  1MMN A;  9ATC B;  3L2Z A;  1YIJ T;  1I0C A;  2XG8 D;  1HK9 A;  4C8Q F;  1GFC A;  2EYX A;  4BB7 A;  1BI3 A;  1G83 A;  2WSE E;  4PLI A;  1K1Z A;  2DZC A;  2DAQ A;  1WPY A;  2DVE A;  1FMW A;  3CBO A;  2K3B A;  4AFQ C;  5GAN j;  4HVW A;  1O75 A;  4QKU A;  3RKY A;  1JB0 E;  2LQN A;  4F04 B;  3M0T A;  5GAM f;  2WAC A;  3M59 A;  1CZ4 A;  3JCM b;  1Q7Y U;  3PE0 A;  5KYN A;  2RHU A;  3RKX A;  1Q86 C;  1QVG P;  4OMF B;  2DYI A;  1EX4 A;  2DZ9 A;  2DJZ A;  3I5S A;  4AQ7 A;  4B6M A;  2EW3 A;  4M7A E;  2RI2 A;  3QYH B;  1I5O B;  4M77 D;  1KSW A;  2GTO A;  1IGU A;  1VYT A;  2AKK A;  2PQW A;  3VS4 A;  1VQ5 T;  2HSP A;  3EHQ A;  3G6E Q;  1PSF A;  2QGF B;  3FIF A;  2FRY A;  1OQK A;  1H8K A;  2DJQ A;  4CC7 A;  1JQQ A;  3EGD B;  4IUQ A;  4R0K A;  2DK3 A;  5J26 A;  2L3S A;  3G4S Q;  2RJC A;  3VS3 A;  3GNF B;  4RG8 A;  4EMK A;  2VYT A;  3MEA A;  4M77 B;  4OMN A;  4OB2 B;  2O4X A;  1Q86 U;  1Q95 G;  3S3M A;  1G5V A;  3RBB B;  3L2U A;  1GL5 A;  2C0I A;  2M0O A;  4ELZ C;  2DBM A;  3X20 B;  4BE0 A;  3OW2 P;  1VQL A;  1BI2 A;  1KQ2 A;  2J06 A;  3QJ6 A;  3PTA A;  3A8G B;  5GAN d;  2LMJ A;  1XNI A;  1Y0M A;  1I4K 1;  2DBK A;  2O9S A;  4OGE A;  1UTI A;  1VQ8 Q;  2HZY A;  1VQM A;  2CP2 A;  1N8R R;  5GAM e;  2I0N A;  3VS0 A;  3QDF A;  3M54 A;  4KH0 B;  4DA4 A;  4HT9 A;  1I1J A;  3NTH A;  5KYU B;  2NWM A;  4Z8A A;  2KRS A;  2B86 A;  2EJ9 A;  4F7U G;  4KGV B;  1VQ9 A;  1D0X A;  1G3S A;  1BU1 A;  4GY5 A;  1I07 A;  4FYY B;  2BIV A;  4E2F B;  5GAO r;  2AZV A;  2YLB A;  3CME T;  4M75 G;  2JM8 A;  1C6V X;  1G3Y A;  2LTO A;  3EGD A;  3RKW A;  5L8R E;  3JB9 I;  4PKC C;  4IIM A;  2X4Y A;  2D0N A;  5KH6 A;  1MND A;  4C0F A;  2RHZ A;  4C8Q E;  2KDS A;  2HCK A;  3JAM E;  2JS2 A;  3PVL A;  2QAS A;  1YP5 A;  2OTJ A;  1PWT A;  4XU3 A;  2RK2 A;  2HBP A;  2PUO B;  3UA6 A;  4KT0 E;  1N5Z A;  2O9V A;  4AS1 A;  4NL2 A;  2X4W A;  4HCC A;  3EGX B;  1G3W A;  2PNI A;  1M4Z A;  2RB6 A;  3CCQ Q;  3CMA A;  3PIP A;  3JCM X;  2K57 A;  3CD6 A;  2LZ6 B;  4EMH A;  2Q1A X;  2DFU A;  2M51 A;  1KC8 C;  2Q1D X;  2DXU A;  4FW1 A;  1ZA1 B;  4E7J A;  3CCS T;  5KYU A;  4LE9 A;  4F7U A;  3M0Q A;  2BUD A;  5CKB A;  1K73 C;  1OU8 A;  2M16 A;  1WGS A;  2RM4 A;  1I8F A;  2LDM A;  1QP2 A;  1R0B G;  1WJS A;  2DVJ A;  5D6Y A;  4RTZ A;  2LQK A;  1R8O B;  4M75 E;  5KCO A;  2JMC A;  3OYG A;  3BE3 A;  3DLM A;  1M2V A;  3JB9 G;  3CC2 Q;  4E7K A;  1JU5 C;  2Q1C X;  2X3W D;  5CKD A;  2DMO A;  1ACM B;  3JRZ A;  2BKD N;  3LGA A;  3L2R A;  5DYI A;  2X3X D;  1M8M A;  4RKU E;  1OZ3 A;  2VVK A;  1QWF A;  1Q81 R;  1KC8 U;  3HPW A;  4MDX A;  2EAY A;  4DBH A;  2FZC B;  4LNP A;  4Y92 A;  2QQ9 A;  4ANJ A;  3I9Q A;  1K73 U;  3A98 A;  2XIC A;  1PM3 A;  2KRM A;  3NMZ C;  3THK A;  4HCB A;  2J6K A;  4AT1 B;  1RAD B;  2ZPF B;  1YHQ A;  4FL6 A;  1B34 A;  2EJG A;  3G71 A;  2E65 A;  2K6D A;  1UGP B;  1UJY A;  2FVU A;  1WFW A;  2EJF A;  2ED1 A;  4A4F A;  4V2S A;  3EFS A;  3QWX X;  2HQX A;  3H0F A;  2L89 A;  2OAU A;  1OI1 A;  3VRY A;  1AHJ B;  1MUZ A;  3LGF A;  3SWN C;  4XTW A;  1IZ6 A;  1BYM A;  2F1L A;  2EYQ A;  1D3B B;  2CYZ B;  4OVA A;  1M3A A;  1N27 A;  2VWF A;  1T0H A;  4LD9 K;  1MGQ A;  1QCO A;  2RQV A;  4TVR A;  1TOV A;  1VQP A;  2DIL A;  4P5N A;  4ME7 A;  1GFD A;  1WLF A;  1VQK T;  2CP0 A;  2QQR A;  5FTJ A;  1W2B S;  5FTN A;  1M90 C;  4RMO A;  4MZM A;  4QVZ A;  3PMT A;  2X9H A;  2HEQ A;  2BZX A;  2KRO A;  3LLR A;  3CXC P;  2EQI A;  2YSQ A;  3OYK A;  2M1H A;  2RHY A;  4XTY A;  4PJM A;  3V8K A;  1QKW A;  2KQW A;  1NEG A;  4KOD A;  2R5A A;  4NL3 A;  2QXF A;  4RCB A;  1VQM Q;  3T9N A;  4XU1 A;  3HRU A;  3PT9 A;  3RR6 A;  4C0D C;  3ZGZ A;  2LQ8 A;  1UE9 A;  1ZUU A;  1LCK A;  4OGC A;  1SPK A;  2G3R A;  3OSS C;  5IHN A;  5I11 A;  1UG1 A;  1VQ9 Q;  3HKS A;  2J6F A;  1S72 T;  2J05 A;  4JJD A;  1TU0 B;  2L0A A;  4E7H A;  2WSF E;  2DYB A;  2K3Y A;  2RO0 A;  2W10 A;  4BY6 C;  4ESR A;  1PRM C;  2QYZ A;  5IN1 A;  3UT1 A;  2EGA A;  1D3B A;  3ZFJ A;  4M7D D;  4J9D A;  4C92 G;  5A0D A;  4RG2 A;  2HNI A;  2V26 A;  4PNO A;  2KK4 A;  3TSW A;  3TU4 K;  1B3Q A;  1W1F A;  1FMK A;  5GAN h;  5GMK j;  1QCS A;  1G2B A;  2FO0 A;  2OTJ Q;  3CBP A;  3CCV A;  1I81 A;  3REA B;  1E7O A;  1I9G A;  4JLI A;  4XAX B;  2C06 A;  4M7D G;  2KMT A;  1WDX A;  3TCJ A;  2EKH A;  4C0Z A;  1UEC A;  5A0G A;  1SF9 A;  5CO7 A;  3CMA Q;  1GCQ A;  1G8X A;  3CD6 Q;  5FW9 A;  3QUI A;  1OX8 A;  2P0P A;  3P8B B;  2YWW A;  1ZSZ B;  1MHN A;  3FB9 A;  3C4S A;  1RAH B;  3G7Z A;  1OPK A;  3GIB A;  4M78 D;  2Y4X A;  5EQJ B;  3V7R A;  1TWB A;  1KG1 A;  2RF0 A;  5DLO A;  4LXC A;  2KY9 A;  1V29 B;  2VV5 A;  3HU1 A;  2MAM A;  5A0L A;  4ZGE B;  2EYW A;  1SHG A;  1AOJ A;  3G6E T;  4PJO G;  2DER A;  4OF1 A;  4C92 E;  2E1H A;  4KGZ B;  2L3R A;  1K9M R;  1JBM A;  2RK1 A;  2GBQ A;  1VQ8 A;  1GXI E;  4J6X A;  4X9C A;  3GP8 A;  1Z9Z A;  2ED0 A;  4M78 B;  2NUP A;  4NOY A;  3DLL A;  5GAN f;  5KYY A;  2QEX T;  4ATO A;  1H64 1;  2CP5 A;  1N8R C;  1W2B P;  2OX7 A;  4RV0 A;  2CGH A;  1NJI R;  1LJO A;  2RJE A;  3CCU A;  1YJN A;  1OYX A;  2HKQ B;  5GAN 2;  1MV3 A;  3DB3 A;  1LPL A;  3MP8 A;  4EMG A;  4M7D A;  1PRL C;  1WYX A;  3M0S A;  4J8O A;  3MB5 A;  2A0F B;  1TH7 A;  4EPC A;  4QT7 A;  2DXC A;  2KI7 A;  2KT8 A;  2H3E B;  3FPR A;  1IXD A;  1X27 A;  3CEY A;  2DIG A;  5GAO n;  4FW2 A;  1K8A C;  6AT1 B;  3G71 Q;  1X6O A;  4JLG A;  3NTI A;  1RAA B;  5D6X A;  2ZGW A;  5LJ5 e;  3JCM Q;  3KBG A;  2QQS A;  2YLC A;  1H92 A;  1CKA A;  1NG2 A;  2K4Y A;  1G3T A; 
#chains in the Genus database with same CATH homology
 2VYT A;  2XDD A;  4ARI A;  1M1K C;  3ZJT A;  3MEA A;  4M77 B;  1N8R U;  2K2V A;  4M75 A;  5J39 A;  2HQE A;  5D6W A;  2RI5 A;  4PJO E;  3JCM c;  2V8J A;  2LT4 A;  4JRI A;  1YI2 A;  2JV2 A;  3E9G A;  5GAM g;  3OMC A;  1WQW A;  4OB2 B;  5GAO m;  2XKO C;  2O4X A;  1Q86 U;  5HKC A;  2D6F A;  3S6W A;  4N0A A;  5FRO A;  3S3M A;  1G5V A;  4BUG A;  3L2U A;  1NJI C;  3JCM h;  2MF2 A;  2M0O A;  2XHC A;  4C0G A;  2YVL A;  4M7D C;  2LW6 A;  1KQS S;  4ELZ C;  4GLK A;  2CZ7 B;  5CVI A;  1PSE A;  3RES A;  3X20 B;  3UDC A;  4BE0 A;  3X25 B;  1BI2 A;  2PU9 B;  2V8I A;  3QKJ A;  1VQL A;  1KQ2 A;  2HD0 A;  3OS0 A;  1KQS A;  2DPP B;  1BIA A;  3QJ6 A;  3CCE A;  3PTA A;  3A8G B;  4M7A D;  5GAN d;  4ZGD B;  5GAN e;  3VV0 A;  5EPP A;  3CCJ A;  1XNI A;  1VQ6 A;  1Y71 A;  1BI1 A;  1I4K 1;  3QZ9 B;  4OGE A;  3JCM d;  3VUZ A;  4MDW A;  4N4H A;  2PVO B;  3F70 A;  1K8A U;  1VQM A;  2LCC A;  5GAM e;  1VQ4 T;  4EMK A;  4J7F A;  3M54 A;  5KE3 A;  4ZTJ A;  3QJY A;  3I55 A;  1LNX A;  5CKH A;  2DO3 A;  4DA4 A;  4KDL A;  1K9M U;  4NS5 A;  1N9R A;  4N4I A;  3NTH A;  4HT9 A;  2K5L A;  1O9S A;  2EJ9 A;  2KVQ G;  4FU6 A;  5GAN 6;  2VXE A;  2KSS A;  4C5G A;  4F7U G;  4QW2 A;  5C6S A;  1M1K U;  5GMK i;  5ERG B;  2ZZD A;  4XU0 A;  4QVC A;  1VQ9 A;  2DTO A;  5GMK l;  3JCM P;  4EMK C;  3RMS A;  4E7I A;  1G3S A;  3VYH B;  4GY5 A;  1P92 A;  4M7A B;  1QW1 A;  1YJW A;  3MEU A;  3M9Q A;  4M75 C;  4XU2 A;  1YIT T;  2BIV A;  2HAX A;  3HU3 A;  5GAO r;  3CCL T;  3L2W A;  3SDZ A;  4J6Y A;  2YLB A;  2JTF A;  4HT8 A;  1UB4 A;  4KDI A;  5KE2 A;  3CME T;  3OYH A;  4M75 G;  3CCM T;  1G3Y A;  4C5H A;  2JN0 A;  4N0A C;  3ER0 A;  4XK8 E;  3CC4 A;  2A7Y A;  2LTO A;  2PUK B;  1VQN A;  4CQN A;  1DJ7 B;  5L8R E;  3RKW A;  3JB9 I;  4PKC C;  1NJI U;  3OS2 A;  3OYB A;  3OSV A;  2X4Y A;  3G71 T;  4L6V 5;  5KH6 A;  2QEX A;  3PMI A;  3OYJ A;  5FTK A;  4C0F A;  4MMK A;  4M78 C;  2RHZ A;  3M57 A;  2KDS A;  3Q1J A;  5CQY A;  4C8Q E;  3LWI A;  4BE2 A;  2QQA A;  3JAM E;  3SWN B;  3G4S T;  1Q81 C;  1YJ9 T;  3GLX A;  2JVV A;  1VQ7 A;  1ZQ1 A;  4M78 G;  3MET A;  4LD6 A;  3AHU A;  2OTJ A;  4XU3 A;  3X28 B;  1KD1 U;  2RK2 A;  2XI9 A;  2HBP A;  4KUD K;  2PUO B;  4ZN1 A;  2P0Q A;  5FU7 B;  3VJP A;  2PVD B;  3JCM f;  3V8J A;  3HFN A;  4KT0 E;  4ZGJ B;  4QQG A;  3A8O B;  4AS1 A;  2Q19 X;  3VYG A;  2DD4 A;  4NL2 A;  4DQ2 A;  4JJN K;  1M1F A;  2X4W A;  3DKM A;  4HCC A;  3L42 A;  1G3W A;  4M7D E;  2K3X A;  1M4Z A;  2RB6 A;  3VKI A;  3P8H A;  3OMG A;  3CMA A;  2EQU A;  3PIP A;  3OYC A;  1VQO A;  3JCM X;  3CC7 T;  2DIQ A;  2K57 A;  3CD6 A;  2DTH A;  3BDL A;  5HK3 A;  2M9U A;  1QVP A;  4EMH A;  2R57 A;  2Q1A X;  3RIR A;  1KC8 C;  2Q1D X;  2H3J A;  2DXU A;  3PGG A;  4A53 A;  2QA4 A;  5LJ3 h;  2DXB A;  4A4G A;  4E7J A;  1VQ8 T;  4IUR A;  4QQD A;  4F7U F;  3CCS T;  5CD1 A;  3H8Z A;  4BD3 A;  1S3S A;  2FB7 A;  5HY6 A;  4IKF A;  3OB9 A;  3CCR T;  3SFM A;  4ZN3 A;  5C18 A;  2CZ6 B;  4C92 D;  3M56 A;  4F7U A;  5GLF A;  3VU3 C;  5C0M A;  4BDY A;  2BUD A;  2RHX A;  5CKB A;  4A54 A;  1Q81 U;  1K73 C;  3QPH A;  2EQK A;  3GF5 A;  2CKK A;  2M16 A;  2RM4 A;  1WGS A;  4HA8 A;  4B9W A;  4C8Q D;  1I8F A;  4CRI A;  3FC3 A;  2LDM A;  4M75 F;  4M77 C;  3A8M B;  1QP2 A;  3M4Y A;  1WJS A;  4L5G A;  4C0D B;  5LJ5 h;  1CR5 A;  4MZT A;  5D6Y A;  2LQK A;  5C1B A;  1BI0 A;  1R8O B;  2X35 A;  4M75 E;  5KCO A;  1UGR B;  2DD5 A;  3OYG A;  3DLM A;  5CKE A;  3ASK A;  4M77 G;  3JCM g;  5CCX A;  1X75 C;  3OBY A;  3JB9 G;  4FIB A;  4MML A;  4HCZ A;  4E7K A;  1M90 U;  4J6W A;  2XD0 A;  3ME9 A;  2Q1C X;  2AHJ B;  1NPP A;  2CZ1 B;  2EKO A;  5CKD A;  2XID A;  3FPT A;  4JRP A;  2XU8 A;  4BAC A;  3JRZ A;  4JRK A;  5GAN 7;  5FTL A;  4BY6 B;  4UC4 A;  1R7R A;  4M78 F;  4C92 B;  2BKD N;  3LGA A;  3L2R A;  3V8L A;  5DYI A;  4WF2 A;  3QO3 A;  3SWN A;  4RKU E;  1RI0 A;  4IUV A;  1VQ4 A;  1OZ3 A;  1O54 A;  4C8Q B;  4M78 A;  1RL2 A;  3EFR A;  3L2V A;  1KC8 U;  1ZBX A;  3HPW A;  4KO8 A;  2XDP A;  4MDX A;  3LX7 A;  5AYF A;  2EAY A;  4ZTF A;  2LT1 A;  4LDW A;  2OTL A;  3HFO A;  2I2L A;  3JCM e;  2JZ2 A;  4KUI A;  3NTK A;  3ZJV A;  3QG1 A;  2QQ9 A;  1WJR A;  2CZ0 B;  3HL8 A;  4C5E A;  2ZPI B;  2B8A A;  4XTV A;  2RI3 A;  3BY7 A;  1QP3 A;  3JB9 J;  1K73 U;  1KD1 C;  5I21 A;  3INZ A;  2DEQ A;  5GAN 8;  3S3O A;  3QII A;  2PJH B;  4ELY C;  1VUB A;  3E19 A;  1U1S A;  2XIC A;  2RH2 A;  3OS1 A;  1NPR A;  3CCL A;  4M7D B;  3C95 A;  2K5F A;  3OQ5 A;  5CR2 A;  2DTI A;  4HCB A;  4Y91 A;  4M7A C;  3FRN A;  3CME A;  3CCM A;  2ZPF B;  3CCQ T;  1YIJ A;  3G6E A;  3O8V A;  1YHQ A;  3OA6 A;  4FL6 A;  3CCV T;  2JTM A;  5LJ3 f;  5LJ3 j;  1B34 A;  4OB1 B;  3QHS A;  5DLQ E;  4M7A G;  2EJG A;  2FHD A;  1VQL T;  3G71 A;  2E65 A;  4PJO D;  4JDS A;  2JNG A;  2E5Q A;  1Q82 C;  1U8R A;  4M7D A;  1IRE B;  3R6O A;  3HSB A;  1UGP B;  3CF2 A;  2FVU A;  2EJF A;  1VIE A;  4Z02 A;  2MI6 A;  3G4S A;  1KQ1 A;  3TEE A;  1YJ9 A;  1GXI E;  4II1 A;  4A4F A;  4V2S A;  2QQB A;  2HQX A;  3EFS A;  2GFU A;  3TRE A;  4D6W A;  3WXM B;  2L89 A;  3MP6 A;  2OAU A;  1OI1 A;  5GAN 3;  1AHJ B;  2IVW A;  3LGF A;  4IUP A;  2MMP A;  5DM7 R;  3KUF A;  5LJ5 f;  3X26 B;  4M77 F;  3SWN C;  5M9O A;  5GAN 4;  3GPL A;  4XTW A;  1IZ6 A;  5CKF A;  3JB9 F;  2EYQ A;  1D3B B;  2F5K A;  1SSF A;  2CYZ B;  1BYM A;  4JS4 A;  4OVA A;  3C94 A;  4BI8 B;  3MEW A;  2QI2 A;  1UEB A;  3I55 T;  5IT9 E;  2X4J A;  1YCY A;  1N27 A;  5GAN 5;  4M77 A;  3LWH A;  1BIB A;  3QXE B;  4BDZ A;  4LD9 K;  3LHD A;  1MGQ A;  4TVR A;  2ZCF B;  2A3L A;  3HRT A;  5FU7 C;  3I56 T;  1VQP A;  2RA2 A;  3UWN A;  3LH0 A;  3M53 A;  2CS7 A;  3SB2 A;  4PJO B;  3DB4 A;  3BQB A;  1FWZ A;  2F69 A;  1W4S A;  4P5N A;  4ME7 A;  3CC2 T;  1WLF A;  1VQK T;  2E6Z A;  2O4X B;  3CC7 A;  4C92 A;  2QQR A;  3JCM V;  3OYY A;  5FTJ A;  1W2B S;  5GMK h;  5FTN A;  1N9S A;  1M90 C;  3M58 A;  5FU6 B;  4RMO A;  2FYK A;  1XTD A;  2LC4 A;  2LRQ A;  4MZM A;  4QVZ A;  5CQX A;  1H3Z A;  3FJP A;  2P0K A;  2XK0 A;  1W2B A;  3QC8 A;  2E6N A;  3MP1 A;  3PMT A;  1U1T A;  4IUU A;  1VQ5 A;  5FRN A;  3CCS A;  4L59 A;  1QVG S;  5LJ3 g;  5GAO l;  2VUB A;  3V7C A;  3QSU A;  1ZC1 A;  3M55 A;  4IUT A;  1Q82 U;  2EFI A;  2L8D A;  1QVG A;  3OYN A;  4DOW A;  3J81 E;  3C12 A;  5EG2 A;  3LLR A;  3OYK A;  1JRI A;  2M1H A;  2RHY A;  3FEO A;  4XTY A;  3OYM A;  3V8K A;  4N4G A;  4J83 A;  2KQW A;  4KOD A;  1UGQ B;  1M9S A;  1KHI A;  2D0Q B;  4JRQ A;  2R5A A;  4NL3 A;  5LJ5 g;  2QXF A;  1HXD A;  4RCB A;  4F7U E;  2DKG A;  4BI3 A;  4YTL A;  3T9N A;  2RD1 A;  1M5Q 1;  1QVF S;  4XU1 A;  4KUL A;  4M7A F;  1M8V A;  3HRU A;  3PT9 A;  2Y4Y A;  4QQ6 A;  4C0D C;  3ZGZ A;  2YHT A;  1M1G A;  2LQ8 A;  1LOJ A;  3QBY A;  1QVF A;  2Q18 X;  1XOV A;  5LJ3 d;  2Y90 A;  5LJ3 e;  3MEV A;  4M7A A;  1WJQ A;  3QQ7 A;  3BFM A;  2D9T A;  2ZPG B;  3FDR A;  4PLL A;  3CCU T;  1YJN T;  2MM0 A;  3M5A A;  4OGC A;  3OYL A;  2G3R A;  3OSS C;  4RCC A;  5CAI A;  1Y96 B;  1FXX A;  3OS5 A;  4BE1 A;  3HKS A;  3X24 B;  3GNG A;  1S72 T;  4E7H A;  4O5V A;  3J80 E;  2WSF E;  3J7A F;  4FT4 A;  2WSC E;  4BY6 C;  2EQM A;  2RO0 A;  2K3Y A;  2LCL A;  2P4T A;  4C92 C;  2E41 A;  1E32 A;  3OBW A;  4DOV A;  2PWY A;  3MHX A;  3ZEH A;  4XTZ A;  5LJ5 d;  1BKB A;  2VGM A;  3CPW S;  5IN1 A;  1FX7 A;  3UT1 A;  3CBM A;  2V8K A;  1D3B A;  3JCM J;  3ZFJ A;  4C8Q C;  1VQM T;  1X01 A;  4A4K A;  4C92 G;  4Q5W A;  5A0D A;  3M4G A;  2EIF A;  4M7D D;  3ZBD A;  4O6J A;  4CI0 C;  3CPW A;  5HK0 A;  2MM2 A;  2GF7 A;  2JOY A;  1Y7X A;  5GAO p;  4M78 E;  3OW2 S;  3QZ5 B;  4RG2 A;  3OYD A;  2HNI A;  4X34 A;  4C8Q G;  1KHC A;  5DY9 A;  2R58 A;  2KK4 A;  4PNO A;  4B9X A;  3OW2 A;  1YBY A;  3QQ8 A;  3TU4 K;  2FL7 A;  4PJO A;  4EDU A;  4QVD A;  5CCA A;  1I5L A;  1UGS B;  3BDU A;  3FLG A;  2IG0 A;  3A8L B;  4OP0 A;  3JSC A;  2GQV A;  5GMK j;  5GAN h;  3JB9 H;  1QCS A;  3CCQ A;  3NFC A;  3CBP A;  3CCV A;  1I81 A;  1EIF A;  5I2S A;  3H6Z A;  2GCX A;  1NZ9 A;  1YIT A;  5GAM h;  4LDX A;  1WQ7 A;  1I9G A;  3PFS A;  1YI2 T;  2NLU A;  2EWN A;  2RJD A;  4JLI A;  3RUX A;  4XAX B;  2C06 A;  4M7D G;  2MWP A;  2KMT A;  4E47 A;  3HHT B;  3TCJ A;  3URG A;  5IAY A;  4KLN A;  5DYG A;  4C0Z A;  4A4H A;  5A0G A;  3L1A A;  1VQN T;  4M75 D;  3CPF A;  5CO7 A;  5GAM d;  5GAO q;  4XTU A;  3JCM W;  3RER A;  3OYI A;  4XTX A;  4ARC A;  3CCE T;  3QUI A;  3VUB A;  2GFA A;  3BW1 A;  3HU2 A;  4BI4 A;  2ZPE B;  2P0P A;  3P8B B;  2F5T X;  4OB0 B;  3RMQ A;  3WVE B;  3OY9 A;  3CCJ T;  1VQ6 T;  5CCB A;  2OTL T;  3UPU A;  1MHN A;  3LYI A;  3QYG B;  3I56 A;  4F7U B;  3LGL A;  4OB3 B;  2ZPB B;  2R5M A;  5GAN g;  5LJ5 j;  3FB9 A;  2MWO A;  3C4S A;  1Q7Y C;  3G7Z A;  3GIB A;  4M78 D;  3CC2 A;  1VIF A;  2Y4X A;  1VQK A;  5EQJ B;  2YRV A;  3V7R A;  4E7L A;  4M77 E;  2VC8 A;  5DLO A;  1KG1 A;  5CIU A;  1Y96 A;  1OZ2 A;  5I2M A;  4EMK B;  4PJO C;  2KY9 A;  2B25 A;  2E64 A;  4C5I A;  1V29 B;  2VV5 A;  3HU1 A;  2ZPH B;  4KBM B;  2RJF A;  3MCA B;  2MAM A;  4HKE A;  4M75 B;  3EAE A;  3WVD B;  4Y28 E;  4ZGE B;  5A0L A;  4C92 F;  2EQJ A;  3L2Z A;  1VQ9 T;  1YIJ T;  3G6E T;  2JUF A;  4PJO G;  4LDV A;  1YHQ T;  1JJ2 S;  2XG8 D;  4MZP A;  4OF1 A;  5FU6 C;  1ZHI A;  2LX9 A;  5FLX E;  1YJW T;  2KAF A;  4C92 E;  1HK9 A;  3E9F A;  4C8Q F;  2E1H A;  3N5B B;  4BB7 A;  2L3R A;  1BI3 A;  4A4E A;  1JJ2 A;  4JUV A;  1JBM A;  2RK1 A;  2WSE E;  1QDN A;  4PLI A;  4C8Q A;  2DZC A;  1VQ8 A;  2DAQ A;  4FT2 A;  3CC4 T;  1WPY A;  4J6X A;  4FM4 B;  4X9C A;  2DVE A;  3QDR B;  3SD4 A;  4M78 B;  3V7S A;  3CBO A;  4NOY A;  4R55 A;  3GP8 A;  3CCR A;  3DLL A;  2LVM A;  5GAN f;  2QEX T;  5GAN j;  4ATO A;  3FPU A;  2LNV A;  5GMK e;  1O75 A;  3RKY A;  1JB0 E;  1H64 1;  3CXC S;  1N8R C;  4RV0 A;  1N6A A;  5GMK m;  2CGH A;  4M7D F;  5GAM f;  2WAC A;  1LJO A;  2QTX A;  2QDY B;  2RJE A;  2VGN A;  3M59 A;  5GAM j;  3OYA A;  3CCU A;  1CZ4 A;  3CXC A;  5B6C A;  1YJN A;  1OYX A;  3JCM b;  1VQP T;  1VQ7 T;  1Q7Y U;  5GAN 2;  3HRS A;  4J5Y A;  2OTJ T;  2E10 A;  3DB3 A;  3MP8 A;  4LDU A;  3QWZ A;  4EMG A;  2RHU A;  3RKX A;  3A8H B;  1Q86 C;  2DXT A;  2O01 E;  3E1S A;  4FSX A;  4OMF B;  5CK9 A;  4XQ3 A;  2DZ9 A;  2K5I A;  5FRM A;  2DJZ A;  1Y07 A;  4AQ7 A;  1S72 A;  2YUJ A;  2VXF A;  2XDB A;  4J8O A;  1WNL A;  4VUB A;  4M7A E;  3MB5 A;  1CZ5 A;  2RI2 A;  3QYH B;  1TH7 A;  4M77 D;  5KCH A;  3GOX A;  4EPC A;  3LW5 E;  3JB9 D;  5J3B A;  2DXC A;  3S3N A;  3OYE A;  1B34 B;  2E70 A;  2L5Q A;  3FPR A;  2PQW A;  1VQ5 T;  4J7I A;  3MO8 A;  3CEY A;  4X9D A;  3CMA T;  2E12 A;  2X4X A;  3L2Q A;  3TIW A;  3KXT A;  1PSF A;  1VQO T;  2DIG A;  4JS5 A;  3ZJU A;  3FIF A;  5GAO n;  4R56 A;  3CD6 T;  1NE8 A;  3OYF A;  1K8A C;  3PNW C;  1X6O A;  4IUQ A;  3PIO A;  3HP9 A;  3NTI A;  4JLG A;  5D6X A;  2ZGW A;  5LJ5 e;  3JCM Q;  5FTM A;  2DK3 A;  3KBG A;  2QQS A;  2YLC A;  2QA4 T;  3P8D A;  4LDY A;  4PL6 A;  5J26 A;  1K9M C;  2K4Y A;  1G3T A;  1XQH A;  2RJC A;  5LL6 S;  2RHI A;  4PJO F;  2PVG B;  3GNF B;  5A2Q E;  4RG8 A;  3A5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...