5D6WA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 23
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6wA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6wA02
1XNIA 3L2UA 5KE3A 2EQUA 3OA6A 3EAEA 2X4WA 2K3XA 3QJ6A 2QQSA 4A4HA 4E7HA 3CEYA 3L2WA 3H8ZA 2DAQA 3ASKA 3S6WA 3MEWA 3LH0A 4A4FA 4BDYA 4BD3A 3ZEHA 2X4YA 1OZ3A 4QW2A 4NS5A 4X34A 2LCCA 3OY9A 2NLUA 4PLIA 4A4GA 3OYEA 4FU6A 3P8HA 4GY5A 5D6XA 3OYKA 3FC3A 4FL6A 3PMTA 1MHNA 2DIQA 4IURA 4QQ6A 5KH6A 2L3RA 3OYJA 5KCOA 3META 2X35A 3NTIA 2M1HA 3OYBA 3L2RA 3S3NA 4ZTJA 5KCHA 2IG0A 4C5GA 3OS2A 4ZTFA 2XDPA 5J26A 3S3OA 3NTKA 5C6SA 3L2QA 4PL6A 1WJQA 3DLMA 2X4XA 2R5AA 3F70A 3LLRA 4BACA 3OYFA 1OYXA 2EQJA 2JTFA 3E9FA 4BDZA 4IKFA 3O8VA 2F5KA 2MWPA 3OQ5A 4Z02A 1OI1A 2M0OA 5FROA 3OYAA 2EKOA 4E7JA 2R58A 2FHDA 3LGLA 4QQGA 2RI3A 3FDRA 1RI0A 3OYHA 4E7IA 2JZ2A 4IUQA 4QQDA 3H6ZA 2BIVA 3OMGA 2K3YA 2D9TA 2LVMA 4IUUA 5FRNA 2EQMA 3E9GA 1OZ2A 2EQKA 3LYIA 3FLGA 1WJSA 4UC4A 4BE1A 2BUDA 3DB3A 4BE2A 4E7LA 2R57A 3MP1A 3NTHA 2EFIA 2QQRA 2LRQA 2HQEA 5M9OA 3P8DA 2E6NA 2HQXA 3GOXA 3LGFA 3OYNA 3L2VA 2LDMA 2RHIA 2RJDA 3MO8A 3KUFA 5IAYA 2R5MA 2RJFA 4HCZA 3UT1A 4OVAA 4C5HA 4EDUA 3OYLA 3OYDA 4BE0A 5CIUA 1WJRA 3QKJA 4PLLA 2O4XA 3BDLA 5IN1A 2GFAA 4N4HA 3OS0A 2L89A 3UWNA 1WGSA 1G5VA 2YRVA 2O4XB 4L59A 2E5QA 2M16A 2RJEA 3FEOA 3MEAA 3PFSA 2MWOA 4IUPA 2L8DA 3OYIA 4II1A 2RI5A 3OB9A 3ME9A 2WACA 3OYGA 5D6YA 2BKDN 4C5EA 1SSFA 4QVZA 4B9XA 3OYCA 4E7KA 1N27A 2P0KA 2GF7A 3QIIA 2RJCA 4N4GA 5FRMA 3MP6A 3PMIA 5KE2A 3OS1A 4CRIA 2DIGA 3SD4A 2RHYA 4LD6A 2RO0A 5C0MA 2CKKA 2RHUA 3MEUA 4B9WA 3QBYA 2RHZA 4IUVA 2G3RA 4A4EA 2XK0A 2B8AA 2RI2A 5D6WA 1KHCA 3M9QA 5J39A 1H3ZA 3Q1JA 4Q5WA 3OMCA 4C5IA 2LTOA 3LX7A 3OYMA 3DB4A 3L42A 4RG2A 4N4IA 3C4SA 3MEVA 2GFUA 2VYTA 3PNWC 2RHXA 3S3MA 2PQWA 4IUTA 3MP8A
chains in the Genus database with same CATH superfamily
2AT1B 3BFMA 3MPUB 5KE3A 1YN8A 2LT1A 3EAEA 2X4WA 1YHQT 1Q7YC 4KDLA 2QXFA 4A4HA 1MUZA 1VQOQ 3CCVT 4AFQC 1K0SA 4MMLA 1EX4A 2M0YA 1H3HA 4F7UA 4BI8B 4JUVA 4IURA 4LE9A 1TU0B 2KK4A 2OAUA 1R0BG 5KH6A 4Z89A 4LXCA 8AT1B 1VQ4Q 1CKBA 1VUBA 1TUDA 2VGNA 1I07A 2O88A 4EMKB 3JCMJ 1YNZA 1M1KU 1RLQC 1QLYA 3M5AA 4C8QF 2R58A 2LJ3A 3OYHA 2P4TA 2EW3A 2OTJA 4OMNA 1YIJQ 2EAYA 3SHWA 3FLGA 1M90U 2HZYA 2BZ8A 1UECA 2LQNA 2QQRA 3EFOA 2HQEA 4CC4B 2LQWA 1VQ8T 3BDUA 2HMAA 4M7AE 1SG5A 1D0XA 1WNLA 4M77D 4Z8AA 1W2BS 1GRIA 4M78E 2RNAA 5GAMe 4MDXA 5A2QE 1JJ2P 2L89A 1ZHIA 5I21A 3BE3A 3JB9G 1UUEA 2DRKA 3HPWA 2RK2A 4PJOC 2Q1DX 2MWOA 2D6FA 3I55Q 2H3EB 1X6GA 1X6OA 1IZ6A 1UGSB 1H8KA 4JJNK 4JLGA 1FMVA 2ZAEA 1HSQA 3OS1A 4C8QA 4LDYA 3I5SA 2E3IA 3THKA 2RHUA 3QBYA 2RHZA 2FEIA 3NFCA 1Q86R 2J7IA 3M0UA 2NYSA 3CMAT 2ED1A 4WCIA 3OYMA 3RKYA 1LJOA 4X9CA 1Q81R 4RG2A 1WLPB 2KDSA 4KDIA 2PVDB 2CP7A 3MP8A 1ZA2B 1M3BA 1O54A 4KT0E 3G71A 2DXUA 1YHQQ 4DBRA 4J9FA 4M78G 2YUPA 3HFNA 3SDZA 2PU9B 1K76A 4P5NA 4XQ3A 2XDDA 2EGCA 2QI2A 4XU3A 3CBOA 2L3RA 2D8JA 2RQUA 2IG0A 1PRLC 5GANf 2JN0A 4LDUA 1X2KA 3CCQA 2RQWA 2X4XA 3G1JA 5FLXE 2J06A 2RM4A 4JDSA 2DK3A 3VS2A 1VQ5T 2MMPA 1G3WA 5CKEA 1IRXA 4C8QE 4OB3B 2PVGB 1PG5B 1RACB 2FL7A 4QQDA 4ANJA 3EGDB 2JOYA 4C92G 3CXCA 1WXBA 3M0TA 4BE1A 2M51A 1PCXA 5GAN2 3I35A 2EQIA 3P8DA 4C0ZA 3MO8A 4J7IA 1B7TA 5LJ3g 4BE0A 3M55A 3JV3A 3TU4K 4N4HA 1JEGA 1YJWA 2O4XB 1QVGP 2KRSA 1C0MA 1UJ0A 2K79A 3EG9A 5DY9A 2FB7A 2DIGA 2O01E 2RH2A 4M7AD 4J5YA 1VQNT 1UB4A 4F14A 5GMKi 4M78D 5LJ3j 3JCMe 4CI0C 3VU3C 1K1ZA 3JCMP 4A53A 2YDLA 4FYVB 3PNWC 4OMMA 2JV2A 5FU6B 2FZKB 1Q82C 3OBYA 2X51A 1NPPA 3ZJTA 1VQ6A 2DXBA 2QQSA 1QVGA 3CCVQ 3ASKA 3E19A 4HCKA 1YJ9Q 3NMZC 4AG1C 1LOJA 2QASA 4RTVA 3FPRA 5LJ5d 1M1GA 4J9IA 1YWPA 3JCMf 4HVVA 5HY6A 2E64A 1AWJA 2K57A 4X1VA 4PJOG 4C5GA 2F5TX 3SB2A 5C6SA 1K9MU 2YHTA 1VOMA 2F1LA 4ZNXA 1M2VA 2MF2A 3A8LB 4JLIA 1M9SA 1OI1A 5GAN5 2EKOA 3VJPA 1D0ZA 1VIEA 4E7IA 1KIKA 1RI0A 4IUQA 1N8RR 4IUUA 1AHJB 1VQPT 5HCKA 3JB9D 1VYTA 4JJDA 3I55T 1YJNQ 3VYHB 1RL2A 3GF5A 4M7AG 3GOXA 3LGFA 2KE9A 2L3SA 2DZCA 3V8JA 5LJ5j 2B86A 4VUBA 4OMPA 4PLLA 4QVDA 5IN1A 1FMKA 3GIBA 3UPUA 3PVLA 2QGFB 1WHKA 3ZL7C 2CREA 3FEOA 4AFZC 3T9NA 3JRZA 4A54A 1D1CA 3KXTA 3OB9A 1QVGS 1HYOA 4J9DA 1H92A 1SPKA 2G6FX 4DQ2A 1Q7YU 2RO0A 1MNEA 2DBKA 1W70A 2SEMA 1KD1C 3ZJVA 1Q81U 4KGZB 4K11A 3M58A 4ELZC 1QWFA 3JCMh 4IIMA 1H3ZA 4C5IA 1M8MA 2P0QA 2DMOA 5GAMj 3MJXA 1NEBA 4CC7A 2MOXA 2PQWA 4IUTA 2RD1A 3L2UA 2LMJA 2OX7A 1WHLA 1M8VA 3VYGA 4PJOD 5KYUB 2V26A 4A4FA 5DYGA 1FYNA 2V8IA 4PNOA 1KC8C 3J7AF 3EGDA 3OYKA 4E7ZA 4M77C 4JRIA 2DTOA 1WFWA 2LP5A 5DLQE 2D1XA 5CCBA 3CCRQ 3EH2A 4OGCA 2A7YA 3LH5A 4LUEA 1VYUA 3PVQA 2R5AA 3CC4Q 1TWBA 1ZUYA 3ZGZA 2FPEA 1SKUB 1K8AU 4BB7A 3EH1A 3E9FA 1YI2A 1S1NA 2DKGA 3OQ5A 3TSWA 4M7DB 1KQ2A 1RLPC 4PJOB 3CCQT 4DEYA 4XTWA 2J6OA 3RNJA 1OPLA 1K9MC 3DB3A 2XG8D 3HRUA 3RESA 1ZQ1A 3CXCP 2L0AA 2RHIA 2DNUA 2ZPHB 1YI2T 2CH4A 2L2PA 1ZA1B 1JBMA 1I1JA 4M7AA 2DLPA 5LJ5e 3CCSQ 2RJEA 2QQBA 3QJYA 3HU3A 3OW2S 1WA7A 1JB0E 2X3XD 2KROA 1AVZC 4PJNA 3A5ZB 3JCMb 3LHDA 1M3CA 3CCET 2PNIA 4RTTA 3VS0A 2E6ZA 3MEUA 4RCCA 1NLPC 3M9QA 1VQNQ 1J3TA 2B25A 2DO3A 3Q1JA 1Q86C 2JW4A 3G7ZA 1B34A 1M3AA 2AZVA 2OTLQ 3MEVA 3LW5E 3V8KA 3CCUA 2IVWA 5LJ5f 5GAN7 1D3BA 2E70A 2KMTA 1SEMA 1QKXA 4J9HA 1I8FA 4FSSA 4LNPA 5D7UA 4Y28E 1UJYA 1KK7A 3HRSA 4M75C 4QW2A 2GNCA 2CH4W 5GMKm 5GAN8 4RKUE 3M59A 1HD3A 1AWXA 3META 1U5SA 3EG2A 2FRYA 3RIRA 5LJ3e 1MMGA 3RDVA 4DA4A 2SRCA 4Z88A 5CKDA 3NTKA 3CC7T 5A0DA 4BY6B 1N6AA 5FWCA 4XU2A 1K4US 4BACA 2DD4A 3RKXA 3M53A 1NJIU 3CMAQ 5FWBA 3I56Q 1RAFB 5GANj 2C06A 4L5GA 4B6MA 3QXEB 4R0KA 2E5KA 3FJPA 3PIPA 4KH0B 1PKTA 2Q1CX 3RUXA 5IHIA 2WSFE 4HT9A 3CMAA 2A0FB 3OYNA 4ZN1A 5IAYA 1W1FA 2CZ1B 2H3JA 2ZPEB 4LDXA 4PK4A 2AHJB 5KYYB 4J9CA 4JRPA 3E2UA 3OSVA 4LD9K 3G6ET 4FT2A 5GANg 2BE9B 1M30A 2MCNA 1S72T 1VQMT 3O5ZA 3ME9A 1YFNA 3OYCA 2M02A 1R0CB 3QIIA 2RJCA 2OTJT 3HHTB 1XOVA 1U06A 2AKLA 4J9EA 2QTVA 3CCLT 4BUGA 5J39A 4M77A 3CCUQ 2Z0WA 2VB6A 4PFOA 2OTLT 1KD1R 1SF9A 3X20B 2P4RA 5GLFA 2CYZB 1FX7A 2PUKB 2JMCA 2K6DA 1UEBA 3FIFA 1K9AA 2VWFA 3E1SA 4NL2A 3PE0A 5CQYA 4AS1A 4M75G 4BD3A 4X34A 3RERA 2DVJA 2AIRB 4RTZA 1GCQC 1ZUKA 1IHWA 3CCSA 5LJ3f 3OYBA 3HTRA 2K9GA 2XDBA 3NGPA 4Y91A 5IHKA 1R7RA 4M4ZA 4ZGDB 3VS3A 3CC2A 1YITT 2LZ6B 1OYXA 4KULA 4E6RA 2MWPA 4C92A 2MPXC 2XHCA 4C92B 5FTKA 2RI3A 2JZ2A 5FW9A 4F17A 1RUWA 2BIVA 4LUDA 3QYGB 1W2BA 5FRNA 5GAOl 3E9GA 2ESWA 3G4SA 1X75C 1M90C 2BZXA 5CCXA 4XTUA 2EBPA 2QTXA 3EFOB 5AYFA 4RG8A 2GQIA 2HSPA 1V76A 2EIFA 2MAMA 2RF0A 2HL5C 3G6EQ 2KY9A 1JXOA 3CCST 5AT1B 1VQKT 2DBMA 2DJZA 1I5LA 3OYYA 1N27A 2L5QA 4ZGJB 2LX7A 2XU8A 3CCEQ 1YWOA 2CKKA 4M77B 4IUVA 4MZPA 2RMOA 5D6WA 2PJHB 4FCYA 2JM9A 5GMKe 1QDNA 2GFUA 2RK1A 2EYWA 3G4ST 3QSUA 2A3LA 2DM1A 1KQSS 4AT1B 1NBEB 2PZ1A 2DERA 1BB9A 4OGEA 3GPLA 4M7DD 5GAN4 2DYIA 4C0GA 4PLIA 4EMGA 3BY7A 3CPWS 3JCMW 1ZSZB 2DVEA 2NUTA 1M1KC 2K2MA 2C0OA 2X35A 4V2SA 1IO6A 2CT3A 4KBMB 1K8AR 4BI3A 5I11A 5GANe 1OX9A 2VUBA 2YLCA 4PL6A 2LCSA 1GL5A 1H641 3H0HA 2RQRA 2KR3A 2EYYA 4IIOA 4M77F 2DETA 3JCMX 1NE8A 3DLLA 4M7DF 2M0OA 4M78B 2V1QA 3LWIA 3QUIA 1LVKA 1TUGB 5DLOA 3FDRA 3H41A 4JZ3A 2EJGA 4KRTA 2EQMA 3LYIA 2EJFA 4UC4A 4F7UB 4KLNA 1RI9A 1BK2A 1K9MR 2CSIA 4J6YA 3L2VA 1QVFA 2OAWA 4HCZA 2CP2A 3HU2A 1XQHA 2GBQA 3VS7A 2O4XA 3AT1B 1TOVA 4RTUA 4R56A 2F2XA 1U1TA 2QYZA 5DM7R 3CCEA 1XJWB 3JAME 3MEAA 1EIFA 2EJ9A 1SSFA 2CZ7B 4QVZA 1I81A 5CO7A 3CCVA 3PMIA 3QPHA 3G6EA 3JB9J 4RTYA 1B34B 1D1AA 3VRZA 3VS6A 1VQ6Q 5CKBA 1X6BA 4HA8A 3EFSA 4OP0A 1ZSZA 1FMWA 2E1HA 5GANd 4OMQA 5A0GA 2KI7A 4N4IA 1UGPB 4FYXB 1N8RC 4C0DB 2HQHA 5GAOn 2E10A 2ED0A 4HXJA 3G4SQ 1Y71A 3QJ6A 1RADB 4XTXA 4F7UF 1WX6A 2ZCFB 3ZEHA 1TS9A 1T3SA 5LJ5h 5GJVB 5EG2A 2AZSA 1ZSZC 1MHNA 2V8JA 1UGQB 2CDTA 5KCOA 3A8HB 1YJWQ 3HFOA 3CC2Q 2OJ2A 3QZ5B 4J7FA 2XDPA 2DD5A 1M2OA 3UA6A 3L2QA 5IT9E 1WJQA 1SHFA 1MV3A 1PHTA 9ATCB 1VIFA 2QAZA 2DXTA 4M77E 4PJOA 2JMAA 1VQ7T 2F5KA 2CS7A 4M7DE 4ELYC 1T0HA 1WHGA 3VRYA 3FJ5A 5L8RE 5CK9A 3H6ZA 5HK0A 2K3YA 5J3BA 3QWZA 4RUGA 5FU7C 1WJSA 2HCKA 3NTHA 2CSQA 4L6V5 2BE7D 3KUFA 1W2BP 2XICA 4EDUA 4M7AF 4PJMA 1WIEA 4DOWA 4M78F 2LJ1A 3GP8A 5C1BA 4ESRA 2H8HA 4L59A 4MDWA 4C8QG 3LGAA 3UDCA 2L8DA 2YUOA 1NJIC 4RV0A 2BKDN 1EZZB 1K73C 2QQ9A 1QW1A 4C92E 1YHQA 5KYNA 2Y90A 5LJ3h 4CRIA 2BZYA 3HKSA 1RAEB 3UATA 2ZPFB 2B8AA 3FRNA 1PM3A 2COYA 3C95A 2RB6A 5IHNA 3L42A 4C92C 4HCCA 3C4SA 4C0FA 2J6FA 4EMKA 4XK8E 3ZFJA 4F7UG 1KG1A 1E32A 3REBB 1AZGB 4RCBA 3S6WA 1BI2A 1Y07A 3OY9A 3P8HA 1GCQA 4NL3A 3I56A 1A0NB 5CAIA 5GAOp 2HBWA 1QCNA 4FW1A 1G83A 3OS2A 1AD5A 4ZTFA 2JTMA 4M75E 2C0TA 3QYHB 1BKBA 1M5Q1 3V7SA 3R6NA 3CCUT 4FW2A 4BY6C 1UGVA 2VXEA 2LQ8A 1YJWT 1TSFA 3TSZA 1YIJA 3RMSA 3CD6T 3X26B 5I22A 2JS0A 3ER0A 1FXXA 4ZGEB 4M75B 2OTLA 2HQXA 1B07A 2XD0A 3MCAB 1F1BB 2GGRA 2RJDA 4OVAA 2KSSA 3OYDA 3JCMc 5IH2A 1VQNA 3CF2A 2YUQA 1YIJT 1LCKA 5GAMh 2YRVA 3X28B 3TCJA 5FTLA 5CCAA 3OYIA 4FSXA 2RI5A 3EG0A 3TREA 4PJOF 2P0KA 4C92F 2GF7A 3JB9H 2DTHA 4F04B 1RABB 3SD4A 3C12A 4B9WA 4ARCA 2CUDA 4QVCA 4XTYA 2DEQA 3ULRB 1UDLA 2O9SA 1ZX6A 2K3BA 2D0NA 2KXCA 3CBPA 4PFZA 2VYTA 4O6JA 1Q82R 2ECZA 2K5FA 1K73U 4LDVA 2CP3A 1X69A 3CCRT 1UE9A 4RMOA 2DA9A 1PD1A 3VUZA 1D3BB 3CEYA 3H8ZA 1W4SA 4C92D 2RQVA 2FVUA 1WDXA 1S72A 2NLUA 4M78C 1WPYA 3FC3A 1GBQA 1ABQA 1IGQA 4HVWA 1VQMA 1YI2Q 2ZGWA 2GTOA 4JZ4A 4OMOA 4PJLA 3L2ZA 3JCMQ 3CC4A 1RAAB 1M1KR 4M75A 4C8QB 3REAB 3CCRA 5EQJB 5J26A 4M75F 1VQ9A 4OB0B 2K5IA 2M9UA 2OI3A 4J9GA 1Y57A 2QQAA 4BDZA 2E3HA 2LC4A 2KRNA 3TEEA 3M0RA 4N0AA 5L23A 5GAOr 2DPPB 4FIBA 2FZGB 2LVMA 3OW2P 1OZ2A 5FU7B 2X4JA 1PSEA 2EKHA 2KYMA 1KC8U 2R57A 1RAHB 2LRQA 2J6KA 5M9OA 4RTWA 2DF6A 2LDMA 1O75A 1VQ5A 3UT1A 1WJRA 2LW6A 2HKNA 2MI6A 1QVPA 4BI4A 1PKSA 3KFVA 2L3PA 2LNVA 4DBQA 2E4HA 3I9QA 1QVFS 1WXTA 4LN2A 2D8HA 4II1A 3CMET 2VV5A 4PJOE 5FRMA 3MP6A 2AK5A 3VS5A 3CCMT 3UA7A 1C1AA 4LD6A 1YJ9T 4A4EA 1V1CA 2XK0A 1W6XA 1LPLA 1M2VB 3OMCA 3MB5A 2GQVA 4OB2B 2VASA 2HDAA 2KRMA 4XTZA 1YJNA 5FTNA 1Z9QA 2DILA 2EQUA 4E7SA 2E41A 5IXFA 4D8DA 4JJBA 3CCMA 4Y92A 2XI9A 2QA4A 3WVDB 1OZ3A 3OYEA 1VQLQ 4JPBW 1VQKQ 1UG1A 2WSEE 2A08A 5GAOq 3HRTA 1Q95G 1YJNT 5EC7A 2E12A 1VYVA 2KEAA 3A8OB 2YRDA 1VQ6T 3OW2A 4C0DC 2Y4XA 1KSWA 3VV0A 1I5OB 2EQJA 2RQTA 3GLXA 1AOJA 4GLMA 4IKFA 3OYAA 3D7SB 2CZ0B 3DKMA 4CC3A 1YJ9A 2E65A 3LGLA 1SHGA 2FPDA 3L1AA 2KT8A 2YVLA 2I0NA 4PJJA 3J80E 2BUDA 4AQ7A 4BE2A 2ATCB 5GAMd 2EFIA 2BTTA 1YCSB 4J8OA 1OV3A 2EYQA 1KFZA 1IREB 1JU5C 1KJWA 1GFCA 5CIUA 1OOTA 3J81E 3BDLA 2ZPIB 3AHUA 2DEUA 4C8QD 3IQLA 4GBQA 1BI1A 5ERGB 2FYKA 4KGXB 1OX8A 3CQTA 1AZEA 2CGHA 3M0PA 2DTIA 3TIWA 1K8AC 3CMEQ 3EHQA 1X43A 1VQ7Q 5CR2A 1K73R 2EWNA 4AG2C 2QEXT 1NLOC 2VXFA 1MGQA 2LJ0A 1NYGA 2G3RA 3M54A 5A0LA 1KQSA 3NHNA 2PUOB 4Q5WA 1TUCA 2DL7A 5ECAA 4AFSC 2VKNA 5KYXB 3EG1A 2ROLA 5CQXA 2A37A 2FZCB 4PKCC 2ABLA 1O9SA 4D8KA 2KQWA 7AT1B 1KC8R 1YITQ 4E7HA 1TTHB 1XTDA 1ZUUA 2DFUA 2LCLA 2X3WD 3LH0A 1JJ2A 5GMKl 1AT1B 3M57A 1BIBA 4OF1A 1ZBXA 1ZLMA 3HP9A 4FU6A 1WI7A 4LDWA 4WF2A 2IIMA 3OYJA 2Q19X 3CCQQ 1I4K1 2YXYA 2PVOB 3NTIA 4WTOB 3L2RA 2MM2A 2COZA 1TXQA 1CSKA 2O2OA 3HL8A 1GXIE 4ORZA 3S3OA 1HK9A 3JB9I 5GAMg 1QP3A 3UF4A 3CC4T 3OYFA 2XKOC 1G3TA 1QCFA 4GLKA 4ARIA 5IXBA 1VQ9T 3SFMA 1U3OA 5CKFA 3G71Q 5GAN6 2D9TA 1Y96B 1G2BA 1Q81C 1AEYA 5FTJA 2MM0A 3WVEB 5HK3A 2XMFA 4DBFA 2V1RA 3JCMV 4KGVB 2DXCA 2R5MA 3X24B 4C5HA 3VS4A 1S3SA 3QKJA 3SWNC 3QC8A 3N5BB 2LQKA 2HKQB 2JUFA 4FYYB 2KYBA 5FTMA 2Q18X 1PRMC 2L3QA 5B6CA 3I55A 3OYGA 1IHVA 1M1FA 4OMFB 3QWYA 5CVIA 2LX9A 1ABOA 1E6GA 1JXMA 1N5ZA 2W10A 4MZTA 3P8BB 4JRKA 3H0FA 1VQLT 4N0AC 4J6XA 1K0XA 4M7DA 2DRMA 2LNHB 2NUPA 2D0QB 2DX1A 1C6VX 2XIDA 2HD0A 3EG9B 4D6WA 5EPPA 3M0QA 3S3MA 2YUJA 2KBTA 1XNIA 2HBPA 3OSSC 3BW1A 1VQ4T 3QDRB 2HAXA 2K3XA 1M90R 2OTJQ 1N9SA 2HNIA 3L2WA 3CC7Q 1MMAA 4BDYA 2LCCA 3SWNB 1TG0A 2YWWA 4M7DC 1WHJA 4FL6A 1WQWA 1Z9ZA 2QGGA 4QQ6A 5I2SA 3R6OA 3EGXB 1T3LA 2QA4T 4ZTJA 4FT4A 5KCHA 3RR6A 2WSCE 1VQ4A 1UHCA 3TQ7P 1R77A 1ACMB 3V8LA 2JTFA 1OPKA 2EYXA 4FYWB 1LNXA 2NUPB 4MMKA 3QHSA 4Z02A 2VC8A 2FHDA 1V29B 4A4KA 4M7AC 1VQOA 4XU0A 3OMGA 4KUIA 3MKDA 2VGMA 3SWNA 2PTKA 2EVRA 4ZN3A 2QG9B 1I9GA 3MP1A 1OULA 1BCOA 3GNGA 5GJWB 4M75D 2RN8A 2J05A 2RJFA 3BQBA 1OEBA 4M7AB 2EYZA 1BYMA 1NM7A 3OBWA 1AWOA 1GBRA 1NYFA 3CCLA 1VQOT 4PFPA 3UWNA 1PSFA 1QP2A 3A98A 4R55A 3EFRA 1X27A 1GFDA 2E5QA 3QZ9B 4KODA 4FM4B 1MV0B 1X2QA 2ZPBB 1NEGA 1UFFA 2WACA 5D6YA 3CC2T 3INZA 3CC7A 3CD6A 2CT4A 2KXDA 2JNGA 2A28A 3LX7A 2QEXA 2O9VA 1IXDA 2K5LA 3ZBDA 2RHXA 2JXBA 4E47A 1SRMA 1UHFA 1BBZA 4TVRA 2QDLA 4AMCA 5GANh 3KBGA 3MEWA 2X4YA 4KH1B 4NS5A 3V7CA 1B3QA 3QWXX 3M4YA 1ARKA 3PMTA 1WLFA 1SRLA 3V7RA 1QVFP 5KYWB 2EPDA 1KQSP 3I5RA 4JRQA 5I2MA 1NJIR 2DL5A 1PWTA 3RMQA 4RTXA 2YLBA 2ROTA 2NUZA 3OS5A 2DE0X 3DLMA 3F70A 1JO8A 4X9DA 4EMKC 8ATCB 3O8VA 5CD1A 5KYXA 2KT1A 1MMNA 5LJ5g 1JQQA 3CXCS 1BU1A 3CPFA 3G71T 3CPWA 2X9HA 1BI3A 2YUNA 2AKKA 2EQKA 5GAN3 4HVUA 1WHMA 2DYBA 1YCYA 3A8GB 4O5VA 2JTEA 5KYYA 4E7LA 2CZ6B 2JT4A 2FPFA 2E6NA 3VUBA 3FPTA 3OYLA 2HSEB 1NPRA 1VA7A 2O31A 2YRCA 3HU1A 1HXDA 2VVKA 1VQPQ 2RA2A 1VQ8A 3PFSA 2CP5A 3URGA 5KYUA 3EHRA 1G3SA 3ZJUA 1NG2A 1HJDA 4MZMA 1YITA 1QQJA 5C0MA 5CKHA 2CP0A 3M4GA 2RPNA 1KHCA 1RAIB 2Y4YA 2ZZDA 2LTOA 1OU8A 1Y0MA 2LT4A 4JS4A 1R8OB 1WZOA 2ENMA 1BI0A 3VKIA 4A63B 3JCMd 3CCJA 1Q7YR 5LJ3d 3U23A 3H0IA 3PTAA 4QKUA 1MNDA 2NWMA 4F7UE 1VQ7A 1YBYA 3FB9A 4EPCA 4YTLA 4DOVA 4A4GA 4GY5A 3CMEA 1QCOA 2FRWA 1D0YA 4M78A 3WXMB 4CC2A 3QDFA 3S3NA 2DJQA 3MHXA 3RKWA 5GMKj 2YSQA 1WYXA 4XTVA 3LLRA 4HT8A 4EMHA 2MYSA 1DJ7B 1N8RU 4E2FB 4CQNA 4J9BA 4E7JA 6AT1B 4QQGA 1QWEA 5HKCA 3GNFB 1QCSA 1ZSGA 2ZPGB 3VS1A 1G3YA 1WXUA 2K7AA 2HEQA 2JVVA 3C94A 1EFNA 4C8QC 2EGEA 3CCJQ 3TVTA 2CUBA 1D1BA 3SEMA 4ATOA 1UGRB 3NPFA 1E6HA 2M16A 1T0JA 1VQKA 3A1PA 3CBMA 4IUPA 3H9NA 1RAGB 1PNJA 4JS5A 1VQLA 5C18A 1CZ5A 4DBHA 2QA4Q 1TH7A 4B9XA 2KGTA 2K4YA 1VQ8Q 3CCMQ 1CKAA 4XU1A 2HL3A 1VQPA 3QQ7A 1D09B 1FWZA 3JSCA 5GMKh 2V8KA 1KD1U 2RI2A 1MMDA 5GAOm 3QQ8A 2KVQG 4F16A 3HSBA 2QDYB 1UTIA 3CCJT 1P92A 2I2LA 2KNBB 2YT6A 1JJ2S 2P0PA 1U8RA 2F69A 3OA6A 1NZ9A 2DAQA 1Y7XA 3PGGA 1CR5A 3EGXA 1WQ7A 2FG0A 5D6XA 3JCMg 3I56T 1Y96A 2COWA 2DIQA 1PD0A 1M27C 1IGUA 2M1HA 3GBQA 3M56A 2F2VA 1QKWA 5FU6C 1ZC1A 2GTJA 4KO8A 4DEXA 1N9RA 2QK0A 1VQ5Q 4NOYA 2K2VA 1E7OA 5FROA 2P84A 3PT9A 1KHIA 1AWWA 2IPOB 4OB1B 1I0CA 3M0SA 2DL8A 3FPUA 4HCBA 2MK5A 4AFUC 4J6WA 5DYIA 2GCXA 2JJ9A 4QT7A 1SSHA 1U1SA 2QEXQ 2MIOA 1OU9A 2EGAA 3EGUA 4OMLA 2A36A 3A8MB 4XAXB 3CPWP 1VQ9Q 1OQKA 1IB8A 3QO3A 4JJCA 4J83A 2GFAA 2DL3A 3OS0A 1WGSA 3X25B 1G5VA 5GAMf 1M4ZA 1JRIA 3CD6Q 3LWHA 2DL4A 1G8XA 2JM8A 1VQMQ 3JB9F 2CP6A 2W0ZA 3PIOA 1S72Q 1CZ4A 4C5EA 4M77G 4E7KA 1PC0A 2FO0A 4HKEA 1ZBJA 2KAFA 4N4GA 2PWYA 5KE2A 1Q82U 4M7DG 2DZ9A 2JS2A 3QG1A 1WHHA 2RHYA 4EIKA 3C0CA 3CCLQ 2C0IA 5KYWA 1QMCA 4KUDK 2NUTB 3EG3A 1X01A 5LL6S 1Q86U 3RBBB 2Q1AX 2F2WA 3DB4A 4ME7A 1KQ1A 1BIAA 1YP5A 1GCPA 1BCMA
chains in the Genus database with same CATH topology
1XNIA 2HBPA 2KMTA 3BFMA 3OSSC 3BW1A 5KE3A 4F7UG 1KG1A 2LT1A 1E32A 1VQ4T 3EAEA 1I8FA 2X4WA 3QDRB 1YHQT 2HAXA 1Q7YC 2K3XA 4KDLA 1N9SA 2QXFA 4A4HA 2HNIA 3L2WA 4RCBA 3S6WA 4Y28E 3CCVT 3HRSA 4MMLA 4BDYA 1BI2A 1Y07A 4M75C 3OY9A 4QW2A 2LCCA 3SWNB 5GMKm 3P8HA 4M7DC 4F7UA 4NL3A 3I56A 5GAN8 4FL6A 4RKUE 3M59A 1WQWA 4BI8B 4JUVA 5CAIA 5GAOp 4IURA 4QQ6A 5KH6A 2KK4A 2OAUA 5I2SA 3META 3R6OA 2QA4T 3RIRA 4ZTJA 4FT4A 5KCHA 5LJ3e 3OS2A 4DA4A 4ZTFA 2WSCE 2JTMA 1VUBA 1VQ4A 5CKDA 4M75E 3NTKA 3QYHB 5A0DA 3CC7T 1BKBA 1M5Q1 2VGNA 4BY6B 3V7SA 1N6AA 4XU2A 4EMKB 4BACA 3JCMJ 2DD4A 3V8LA 3CCUT 3RKXA 3M53A 1NJIU 2JTFA 4BY6C 1M1KU 4MMKA 1LNXA 4Z02A 3QHSA 3M5AA 4C8QF 2VC8A 5GANj 2R58A 2FHDA 2C06A 2VXEA 1V29B 2LQ8A 4L5GA 4A4KA 3OYHA 1YJWT 2P4TA 4M7AC 1VQOA 1YIJA 4XU0A 3RMSA 3OMGA 3QXEB 4KUIA 3SWNA 2VGMA 3CD6T 3X26B 2OTJA 2EAYA 3FJPA 3PIPA 3FLGA 3ER0A 2Q1CX 3RUXA 4ZN3A 1M90U 2WSFE 4HT9A 1I9GA 3MP1A 3CMAA 3GNGA 1FXXA 2QQRA 2HQEA 4ZGEB 4M75B 4M75D 2HQXA 2OTLA 5LJ5f 3OYNA 2XD0A 1VQ8T 3MCAB 4ZN1A 2RJDA 5IAYA 3BDUA 2RJFA 2CZ1B 2H3JA 2ZPEB 2KSSA 4OVAA 3OYDA 4LDXA 4M7AE 3BQBA 3JCMc 2AHJB 1WNLA 4M7AB 4M77D 1W2BS 1VQNA 3OBWA 1BYMA 4M78E 4JRPA 3CF2A 5GAMe 4MDXA 5A2QE 1VQOT 3CCLA 2L89A 1ZHIA 3UWNA 1YIJT 5I21A 1PSFA 1QP2A 5GAMh 2YRVA 3EFRA 3OSVA 4R55A 3X28B 2E5QA 3QZ9B 3TCJA 3JB9G 4LD9K 4KODA 3HPWA 3G6ET 2RK2A 4FT2A 5GANg 4PJOC 2Q1DX 5FTLA 4FM4B 2MWOA 5CCAA 2D6FA 3OYIA 1S72T 1X6OA 4FSXA 1IZ6A 2ZPBB 2RI5A 1VQMT 1UGSB 3ME9A 2WACA 3TREA 5D6YA 4JLGA 3INZA 4JJNK 3CC2T 3OYCA 4PJOF 2P0KA 4C92F 2GF7A 3QIIA 2RJCA 3CC7A 2DTHA 3CD6A 3OS1A 3JB9H 2OTJT 4C8QA 3HHTB 1XOVA 4LDYA 3SD4A 3C12A 4B9WA 2RHUA 4ARCA 3QBYA 2JNGA 4QVCA 4XTYA 2RHZA 2DEQA 3CCLT 3NFCA 4BUGA 5J39A 4M77A 3CMAT 3LX7A 3OYMA 2QEXA 2OTLT 3CBPA 3RKYA 1LJOA 4X9CA 4RG2A 3X20B 2KDSA 2K5LA 4KDIA 2VYTA 5GLFA 2CYZB 3ZBDA 2PVDB 2RHXA 4O6JA 2K5FA 2PUKB 1FX7A 3MP8A 4LDVA 1K73U 1UEBA 3FIFA 4E47A 3CCRT 4RMOA 1O54A 5GAN7 3E1SA 4TVRA 4NL2A 4KT0E 3G71A 2DXUA 3VUZA 1D3BB 3CEYA 5GANh 3H8ZA 1W4SA 4M78G 4C92D 5CQYA 2FVUA 3KBGA 3MEWA 4AS1A 4M75G 3HFNA 3SDZA 2X4YA 4X34A 4BD3A 4NS5A 3V7CA 1S72A 3RERA 2NLUA 2PU9B 4M78C 1WPYA 4P5NA 4XQ3A 3M4YA 2XDDA 3FC3A 1VQMA 2QI2A 2ZGWA 4XU3A 3PMTA 1WLFA 3CBOA 3V7RA 2L3RA 3L2ZA 3CCSA 3JCMQ 5LJ3f 3CC4A 4M75A 3OYBA 4JRQA 5I2MA 2XDBA 2IG0A 3RMQA 4C8QB 4Y91A 3CCRA 5EQJB 2YLBA 5J26A 1R7RA 4M75F 2JN0A 4LDUA 5GANf 4ZGDB 1VQ9A 3OS5A 3CC2A 3CCQA 3DLMA 2X4XA 3F70A 5FLXE 2RM4A 4JDSA 1YITT 4OB0B 2DK3A 4X9DA 4EMKC 2K5IA 2M9UA 1VQ5T 1OYXA 4KULA 2MMPA 2QQAA 4BDZA 3O8VA 2MWPA 4C92A 1G3WA 5CKEA 5CD1A 5LJ5g 2XHCA 4C8QE 2LC4A 3CXCS 4C92B 4OB3B 2PVGB 3CPFA 2RI3A 4N0AA 3TEEA 5FTKA 2JZ2A 3G71T 2FL7A 4QQDA 3CPWA 5GAOr 2BIVA 2DPPB 3QYGB 4FIBA 1W2BA 1BI3A 2LVMA 5GAOl 5FRNA 3E9GA 1OZ2A 2EQKA 2JOYA 4C92G 5GAN3 3CXCA 1X75C 3G4SA 5FU7B 1M90C 5CCXA 2X4JA 1PSEA 4BE1A 1YCYA 3A8GB 4O5VA 4E7LA 2CZ6B 5GAN2 2R57A 1KC8U 4XTUA 2LRQA 5M9OA 3P8DA 2E6NA 3VUBA 4C0ZA 2LDMA 1O75A 1VQ5A 3MO8A 2QTXA 4J7IA 3FPTA 5AYFA 3UT1A 4RG8A 5LJ3g 3OYLA 4BE0A 1WJRA 3M55A 1NPRA 2LW6A 2EIFA 2MAMA 2MI6A 3TU4K 4N4HA 3HU1A 1HXDA 1QVPA 4BI4A 1YJWA 2O4XB 2KY9A 2RA2A 2LNVA 1VQ8A 3CCST 3PFSA 1QVFS 3URGA 1VQKT 1G3SA 2DJZA 4II1A 3ZJUA 3CMET 1I5LA 2VV5A 3OYYA 4PJOE 2YUJA 1N27A 4CQNA 4MZMA 2L5QA 4ZGJB 5FRMA 3MP6A 2XU8A 1YITA 5DY9A 2FB7A 3CCMT 2DIGA 2O01E 4LD6A 2RH2A 2CKKA 5C0MA 4M77B 5CKHA 4M7AD 3M4GA 4J5YA 1YJ9T 4IUVA 4MZPA 4A4EA 1VQNT 1UB4A 2XK0A 5D6WA 1KHCA 5GMKi 2Y4YA 4M78D 5LJ3j 2PJHB 3JCMe 2ZZDA 3OMCA 2LTOA 4CI0C 3MB5A 3VU3C 2LT4A 4JS4A 5GMKe 1QDNA 1R8OB 3JCMP 2GQVA 4OB2B 4A53A 2GFUA 1BI0A 3VKIA 3PNWC 3JCMd 2RK1A 3CCJA 2JV2A 5LJ3d 4XTZA 5FU6B 3G4ST 3QSUA 1YJNA 5FTNA 1Q82C 2EQUA 3OBYA 1NPPA 2A3LA 2E41A 3PTAA 1VQ6A 3ZJTA 2DXBA 2QQSA 1QVGA 3CCMA 1KQSS 4F7UE 3ASKA 3E19A 1VQ7A 1YBYA 2XI9A 3FB9A 4OGEA 3GPLA 2QA4A 4M7DD 3WVDB 5GAN4 1OZ3A 3OYEA 4EPCA 4YTLA 4C0GA 4DOVA 4PLIA 4A4GA 4EMGA 3BY7A 4GY5A 3CMEA 3CPWS 1LOJA 3JCMW 2DVEA 3FPRA 1M1KC 4M78A 3WXMB 5LJ5d 2WSEE 2X35A 4V2SA 1M1GA 3JCMf 4KBMB 3S3NA 4BI3A 5HY6A 3HRTA 5GAOq 2E64A 4PJOG 2K57A 4C5GA 5GANe 2VUBA 1YJNT 3MHXA 2E12A 2F5TX 3A8OB 3RKWA 2YLCA 3SB2A 5GMKj 3OW2A 5C6SA 1VQ6T 4PL6A 4C0DC 1K9MU 2Y4XA 2YHTA 1H641 4XTVA 3LLRA 3VV0A 4HT8A 2EQJA 4M77F 3GLXA 2MF2A 4EMHA 3JCMX 3A8LB 1NE8A 4JLIA 3DLLA 4IKFA 1DJ7B 3OYAA 2CZ0B 1N8RU 1M9SA 1OI1A 2M0OA 3DKMA 2EKOA 4M78B 5GAN5 4E7JA 3VJPA 3LWIA 2E65A 1YJ9A 3QUIA 1VIEA 5DLOA 3LGLA 4QQGA 3FDRA 4E7IA 1RI0A 4IUQA 5HKCA 3GNFB 2EJGA 3L1AA 1QCSA 2ZPGB 4IUUA 1AHJB 2YVLA 2EQMA 1VQPT 3JB9D 1G3YA 3LYIA 2EJFA 4UC4A 2JVVA 3C94A 4C8QC 4F7UB 3I55T 3VYHB 3J80E 4KLNA 2BUDA 4AQ7A 1RL2A 4BE2A 5GAMd 3GF5A 4M7DF 2EFIA 4M7AG 4J6YA 3GOXA 3LGFA 3L2VA 1QVFA 4J8OA 2EYQA 4HCZA 1IREB 2DZCA 3V8JA 4ATOA 5CIUA 5LJ5j 3HU2A 4VUBA 1XQHA 4PLLA 3J81E 2O4XA 4QVDA 3BDLA 2ZPIB 5IN1A 1UGRB 4R56A 3AHUA 3GIBA 4C8QD 1U1TA 3UPUA 1BI1A 5DM7R 3CCEA 5ERGB 2M16A 3FEOA 2FYKA 3T9NA 3MEAA 3JAME 3JRZA 1VQKA 2CGHA 2DTIA 3CBMA 4IUPA 4A54A 3TIWA 1K8AC 3KXTA 1EIFA 2EJ9A 3OB9A 1QVGS 4JS5A 1VQLA 5C18A 1CZ5A 1TH7A 1SSFA 2CZ7B 4QVZA 4B9XA 1I81A 5CR2A 3S3MA 4DQ2A 2K4YA 5CO7A 2EWNA 3PMIA 3QPHA 3G6EA 2QEXT 4XU1A 3CCVA 3JB9J 1VQPA 1B34B 1Q7YU 2VXFA 1MGQA 3QQ7A 5CKBA 2RO0A 4HA8A 3EFSA 1FWZA 3JSCA 4OP0A 1KD1C 1Q81U 5GMKh 2G3RA 3ZJVA 2V8KA 3M58A 2RI2A 3M54A 5A0LA 5GAOm 1KD1U 4ELZC 2E1HA 3JCMh 1KQSA 1H3ZA 2PUOB 4Q5WA 5GANd 4C5IA 2KVQG 3QQ8A 5A0GA 3HSBA 2QDYB 4N4IA 1UGPB 2P0QA 5CQXA 3CCJT 1P92A 1N8RC 5GAMj 4PKCC 4C0DB 2I2LA 2PQWA 4IUTA 1JJ2S 5GAOn 2RD1A 1O9SA 2E10A 3L2UA 2P0PA 2KQWA 1U8RA 2F69A 3OA6A 1Y71A 3QJ6A 1M8VA 3VYGA 4E7HA 4PJOD 1XTDA 1NZ9A 2DAQA 2LCLA 1Y7XA 3PGGA 4XTXA 4F7UF 2ZCFB 3LH0A 1JJ2A 4A4FA 5DYGA 5GMKl 3ZEHA 1CR5A 1WQ7A 1BIBA 2V8IA 3M57A 4OF1A 4PNOA 1ZBXA 1KC8C 3J7AF 3HP9A 4FU6A 5D6XA 5LJ5h 3OYKA 5EG2A 4LDWA 4WF2A 3JCMg 3I56T 1Y96A 4M77C 1MHNA 2DIQA 2DTOA 2V8JA 4JRIA 3OYJA 1UGQB 5KCOA 3A8HB 5DLQE 2Q19X 3HFOA 1I4K1 3NTIA 2PVOB 2M1HA 3L2RA 2MM2A 5CCBA 3QZ5B 4J7FA 3M56A 3HL8A 4OGCA 1GXIE 2A7YA 5FU6C 2XDPA 2DD5A 3S3OA 1ZC1A 1HK9A 3L2QA 5IT9E 3JB9I 1WJQA 1QP3A 5GAMg 4KO8A 2R5AA 1N9RA 1VIFA 3CC4T 3ZGZA 4NOYA 2K2VA 2DXTA 3OYFA 4M77E 2XKOC 1K8AU 4BB7A 3E9FA 1YI2A 4PJOA 1VQ7T 1G3TA 2F5KA 2DKGA 2CS7A 3OQ5A 5FROA 4M7DB 4M7DE 4GLKA 4ELYC 4ARIA 3PT9A 1VQ9T 1KHIA 1KQ2A 4OB1B 5L8RE 4PJOB 3CCQT 5CK9A 3SFMA 3H6ZA 5CKFA 5HK0A 2K3YA 4XTWA 5GAN6 2D9TA 5J3BA 1Y96B 4HCBA 3FPUA 1Q81C 4J6WA 3QWZA 5FU7C 1WJSA 5FTJA 2MM0A 1K9MC 3WVEB 3DB3A 5HK3A 2XG8D 3HRUA 5DYIA 2GCXA 3RESA 3NTHA 3JCMV 1ZQ1A 4L6V5 2DXCA 1U1SA 2RHIA 2ZPHB 3KUFA 2R5MA 2XICA 1YI2T 3X24B 3A8MB 4C5HA 4EDUA 4M7AF 4XAXB 1S3SA 3QO3A 3QKJA 4DOWA 3SWNC 1JBMA 4J83A 4M78F 3N5BB 3QC8A 3GP8A 5C1BA 2GFAA 2LQKA 4M7AA 3OS0A 1WGSA 2JUFA 3X25B 1G5VA 5GAMf 1M4ZA 1JRIA 5LJ5e 4L59A 2RJEA 4MDWA 2QQBA 3LWHA 5FTMA 4C8QG 3LGAA 2Q18X 3QJYA 3HU3A 3OW2S 3UDCA 2L8DA 1NJIC 1JB0E 3ZFJA 3JB9F 5B6CA 3PIOA 3I55A 3OYGA 1CZ4A 4RV0A 2BKDN 3A5ZB 4C5EA 3JCMb 4M77G 1M1FA 4E7KA 1K73C 3LHDA 2QQ9A 4OMFB 1QW1A 2KAFA 4HKEA 4N4GA 5CVIA 4C92E 1YHQA 5KE2A 1Q82U 2LX9A 2Y90A 3CCET 4M7DG 2DZ9A 2E6ZA 3QG1A 4MZTA 5LJ3h 4CRIA 2RHYA 3HKSA 3P8BB 3MEUA 4JRKA 2ZPFB 4RCCA 2B8AA 4KUDK 3FRNA 3M9QA 2B25A 2DO3A 1VQLT 1X01A 3C95A 3Q1JA 4J6XA 4N0AC 5LL6S 1Q86C 2RB6A 3G7ZA 1Q86U 1B34A 4M7DA 2Q1AX 3DB4A 2D0QB 4ME7A 1KQ1A 3L42A 4C92C 4HCCA 3C4SA 2XIDA 1BIAA 2HD0A 3LW5E 3MEVA 3V8KA 4C0FA 4D6WA 3CCUA 5EPPA 2PWYA 2IVWA 4EMKA 4XK8E 1D3BA 2E70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNI A;  3L2U A;  5KE3 A;  2EQU A;  3OA6 A;  3EAE A;  2X4W A;  2K3X A;  3QJ6 A;  2QQS A;  4A4H A;  4E7H A;  3CEY A;  3L2W A;  3H8Z A;  2DAQ A;  3ASK A;  3S6W A;  3MEW A;  3LH0 A;  4A4F A;  4BDY A;  4BD3 A;  3ZEH A;  2X4Y A;  1OZ3 A;  4QW2 A;  4NS5 A;  4X34 A;  2LCC A;  3OY9 A;  2NLU A;  4PLI A;  4A4G A;  3OYE A;  4FU6 A;  3P8H A;  4GY5 A;  5D6X A;  3OYK A;  3FC3 A;  4FL6 A;  3PMT A;  1MHN A;  2DIQ A;  4IUR A;  4QQ6 A;  5KH6 A;  2L3R A;  3OYJ A;  5KCO A;  3MET A;  2X35 A;  3NTI A;  2M1H A;  3OYB A;  3L2R A;  3S3N A;  4ZTJ A;  5KCH A;  2IG0 A;  4C5G A;  3OS2 A;  4ZTF A;  2XDP A;  5J26 A;  3S3O A;  3NTK A;  5C6S A;  3L2Q A;  4PL6 A;  1WJQ A;  3DLM A;  2X4X A;  2R5A A;  3F70 A;  3LLR A;  4BAC A;  3OYF A;  1OYX A;  2EQJ A;  2JTF A;  3E9F A;  4BDZ A;  4IKF A;  3O8V A;  2F5K A;  2MWP A;  3OQ5 A;  4Z02 A;  1OI1 A;  2M0O A;  5FRO A;  3OYA A;  2EKO A;  4E7J A;  2R58 A;  2FHD A;  3LGL A;  4QQG A;  2RI3 A;  3FDR A;  1RI0 A;  3OYH A;  4E7I A;  2JZ2 A;  4IUQ A;  4QQD A;  3H6Z A;  2BIV A;  3OMG A;  2K3Y A;  2D9T A;  2LVM A;  4IUU A;  5FRN A;  2EQM A;  3E9G A;  1OZ2 A;  2EQK A;  3LYI A;  3FLG A;  1WJS A;  4UC4 A;  4BE1 A;  2BUD A;  3DB3 A;  4BE2 A;  4E7L A;  2R57 A;  3MP1 A;  3NTH A;  2EFI A;  2QQR A;  2LRQ A;  2HQE A;  5M9O A;  3P8D A;  2E6N A;  2HQX A;  3GOX A;  3LGF A;  3OYN A;  3L2V A;  2LDM A;  2RHI A;  2RJD A;  3MO8 A;  3KUF A;  5IAY A;  2R5M A;  2RJF A;  4HCZ A;  3UT1 A;  4OVA A;  4C5H A;  4EDU A;  3OYL A;  3OYD A;  4BE0 A;  5CIU A;  1WJR A;  3QKJ A;  4PLL A;  2O4X A;  3BDL A;  5IN1 A;  2GFA A;  4N4H A;  3OS0 A;  2L89 A;  3UWN A;  1WGS A;  1G5V A;  2YRV A;  2O4X B;  4L59 A;  2E5Q A;  2M16 A;  2RJE A;  3FEO A;  3MEA A;  3PFS A;  2MWO A;  4IUP A;  2L8D A;  3OYI A;  4II1 A;  2RI5 A;  3OB9 A;  3ME9 A;  2WAC A;  3OYG A;  5D6Y A;  2BKD N;  4C5E A;  1SSF A;  4QVZ A;  4B9X A;  3OYC A;  4E7K A;  1N27 A;  2P0K A;  2GF7 A;  3QII A;  2RJC A;  4N4G A;  5FRM A;  3MP6 A;  3PMI A;  5KE2 A;  3OS1 A;  4CRI A;  2DIG A;  3SD4 A;  2RHY A;  4LD6 A;  2RO0 A;  5C0M A;  2CKK A;  2RHU A;  3MEU A;  4B9W A;  3QBY A;  2RHZ A;  4IUV A;  2G3R A;  4A4E A;  2XK0 A;  2B8A A;  2RI2 A;  5D6W A;  1KHC A;  3M9Q A;  5J39 A;  1H3Z A;  3Q1J A;  4Q5W A;  3OMC A;  4C5I A;  2LTO A;  3LX7 A;  3OYM A;  3DB4 A;  3L42 A;  4RG2 A;  4N4I A;  3C4S A;  3MEV A;  2GFU A;  2VYT A;  3PNW C;  2RHX A;  3S3M A;  2PQW A;  4IUT A;  3MP8 A; 
#chains in the Genus database with same CATH topology
 2AT1 B;  3BFM A;  3MPU B;  5KE3 A;  1YN8 A;  2LT1 A;  3EAE A;  2X4W A;  1YHQ T;  1Q7Y C;  4KDL A;  2QXF A;  4A4H A;  1MUZ A;  1VQO Q;  3CCV T;  4AFQ C;  1K0S A;  4MML A;  1EX4 A;  2M0Y A;  1H3H A;  4F7U A;  4BI8 B;  4JUV A;  4IUR A;  4LE9 A;  1TU0 B;  2KK4 A;  2OAU A;  1R0B G;  5KH6 A;  4Z89 A;  4LXC A;  8AT1 B;  1VQ4 Q;  1CKB A;  1VUB A;  1TUD A;  2VGN A;  1I07 A;  2O88 A;  4EMK B;  3JCM J;  1YNZ A;  1M1K U;  1RLQ C;  1QLY A;  3M5A A;  4C8Q F;  2R58 A;  2LJ3 A;  3OYH A;  2P4T A;  2EW3 A;  2OTJ A;  4OMN A;  1YIJ Q;  2EAY A;  3SHW A;  3FLG A;  1M90 U;  2HZY A;  2BZ8 A;  1UEC A;  2LQN A;  2QQR A;  3EFO A;  2HQE A;  4CC4 B;  2LQW A;  1VQ8 T;  3BDU A;  2HMA A;  4M7A E;  1SG5 A;  1D0X A;  1WNL A;  4M77 D;  4Z8A A;  1W2B S;  1GRI A;  4M78 E;  2RNA A;  5GAM e;  4MDX A;  5A2Q E;  1JJ2 P;  2L89 A;  1ZHI A;  5I21 A;  3BE3 A;  3JB9 G;  1UUE A;  2DRK A;  3HPW A;  2RK2 A;  4PJO C;  2Q1D X;  2MWO A;  2D6F A;  3I55 Q;  2H3E B;  1X6G A;  1X6O A;  1IZ6 A;  1UGS B;  1H8K A;  4JJN K;  4JLG A;  1FMV A;  2ZAE A;  1HSQ A;  3OS1 A;  4C8Q A;  4LDY A;  3I5S A;  2E3I A;  3THK A;  2RHU A;  3QBY A;  2RHZ A;  2FEI A;  3NFC A;  1Q86 R;  2J7I A;  3M0U A;  2NYS A;  3CMA T;  2ED1 A;  4WCI A;  3OYM A;  3RKY A;  1LJO A;  4X9C A;  1Q81 R;  4RG2 A;  1WLP B;  2KDS A;  4KDI A;  2PVD B;  2CP7 A;  3MP8 A;  1ZA2 B;  1M3B A;  1O54 A;  4KT0 E;  3G71 A;  2DXU A;  1YHQ Q;  4DBR A;  4J9F A;  4M78 G;  2YUP A;  3HFN A;  3SDZ A;  2PU9 B;  1K76 A;  4P5N A;  4XQ3 A;  2XDD A;  2EGC A;  2QI2 A;  4XU3 A;  3CBO A;  2L3R A;  2D8J A;  2RQU A;  2IG0 A;  1PRL C;  5GAN f;  2JN0 A;  4LDU A;  1X2K A;  3CCQ A;  2RQW A;  2X4X A;  3G1J A;  5FLX E;  2J06 A;  2RM4 A;  4JDS A;  2DK3 A;  3VS2 A;  1VQ5 T;  2MMP A;  1G3W A;  5CKE A;  1IRX A;  4C8Q E;  4OB3 B;  2PVG B;  1PG5 B;  1RAC B;  2FL7 A;  4QQD A;  4ANJ A;  3EGD B;  2JOY A;  4C92 G;  3CXC A;  1WXB A;  3M0T A;  4BE1 A;  2M51 A;  1PCX A;  5GAN 2;  3I35 A;  2EQI A;  3P8D A;  4C0Z A;  3MO8 A;  4J7I A;  1B7T A;  5LJ3 g;  4BE0 A;  3M55 A;  3JV3 A;  3TU4 K;  4N4H A;  1JEG A;  1YJW A;  2O4X B;  1QVG P;  2KRS A;  1C0M A;  1UJ0 A;  2K79 A;  3EG9 A;  5DY9 A;  2FB7 A;  2DIG A;  2O01 E;  2RH2 A;  4M7A D;  4J5Y A;  1VQN T;  1UB4 A;  4F14 A;  5GMK i;  4M78 D;  5LJ3 j;  3JCM e;  4CI0 C;  3VU3 C;  1K1Z A;  3JCM P;  4A53 A;  2YDL A;  4FYV B;  3PNW C;  4OMM A;  2JV2 A;  5FU6 B;  2FZK B;  1Q82 C;  3OBY A;  2X51 A;  1NPP A;  3ZJT A;  1VQ6 A;  2DXB A;  2QQS A;  1QVG A;  3CCV Q;  3ASK A;  3E19 A;  4HCK A;  1YJ9 Q;  3NMZ C;  4AG1 C;  1LOJ A;  2QAS A;  4RTV A;  3FPR A;  5LJ5 d;  1M1G A;  4J9I A;  1YWP A;  3JCM f;  4HVV A;  5HY6 A;  2E64 A;  1AWJ A;  2K57 A;  4X1V A;  4PJO G;  4C5G A;  2F5T X;  3SB2 A;  5C6S A;  1K9M U;  2YHT A;  1VOM A;  2F1L A;  4ZNX A;  1M2V A;  2MF2 A;  3A8L B;  4JLI A;  1M9S A;  1OI1 A;  5GAN 5;  2EKO A;  3VJP A;  1D0Z A;  1VIE A;  4E7I A;  1KIK A;  1RI0 A;  4IUQ A;  1N8R R;  4IUU A;  1AHJ B;  1VQP T;  5HCK A;  3JB9 D;  1VYT A;  4JJD A;  3I55 T;  1YJN Q;  3VYH B;  1RL2 A;  3GF5 A;  4M7A G;  3GOX A;  3LGF A;  2KE9 A;  2L3S A;  2DZC A;  3V8J A;  5LJ5 j;  2B86 A;  4VUB A;  4OMP A;  4PLL A;  4QVD A;  5IN1 A;  1FMK A;  3GIB A;  3UPU A;  3PVL A;  2QGF B;  1WHK A;  3ZL7 C;  2CRE A;  3FEO A;  4AFZ C;  3T9N A;  3JRZ A;  4A54 A;  1D1C A;  3KXT A;  3OB9 A;  1QVG S;  1HYO A;  4J9D A;  1H92 A;  1SPK A;  2G6F X;  4DQ2 A;  1Q7Y U;  2RO0 A;  1MNE A;  2DBK A;  1W70 A;  2SEM A;  1KD1 C;  3ZJV A;  1Q81 U;  4KGZ B;  4K11 A;  3M58 A;  4ELZ C;  1QWF A;  3JCM h;  4IIM A;  1H3Z A;  4C5I A;  1M8M A;  2P0Q A;  2DMO A;  5GAM j;  3MJX A;  1NEB A;  4CC7 A;  2MOX A;  2PQW A;  4IUT A;  2RD1 A;  3L2U A;  2LMJ A;  2OX7 A;  1WHL A;  1M8V A;  3VYG A;  4PJO D;  5KYU B;  2V26 A;  4A4F A;  5DYG A;  1FYN A;  2V8I A;  4PNO A;  1KC8 C;  3J7A F;  3EGD A;  3OYK A;  4E7Z A;  4M77 C;  4JRI A;  2DTO A;  1WFW A;  2LP5 A;  5DLQ E;  2D1X A;  5CCB A;  3CCR Q;  3EH2 A;  4OGC A;  2A7Y A;  3LH5 A;  4LUE A;  1VYU A;  3PVQ A;  2R5A A;  3CC4 Q;  1TWB A;  1ZUY A;  3ZGZ A;  2FPE A;  1SKU B;  1K8A U;  4BB7 A;  3EH1 A;  3E9F A;  1YI2 A;  1S1N A;  2DKG A;  3OQ5 A;  3TSW A;  4M7D B;  1KQ2 A;  1RLP C;  4PJO B;  3CCQ T;  4DEY A;  4XTW A;  2J6O A;  3RNJ A;  1OPL A;  1K9M C;  3DB3 A;  2XG8 D;  3HRU A;  3RES A;  1ZQ1 A;  3CXC P;  2L0A A;  2RHI A;  2DNU A;  2ZPH B;  1YI2 T;  2CH4 A;  2L2P A;  1ZA1 B;  1JBM A;  1I1J A;  4M7A A;  2DLP A;  5LJ5 e;  3CCS Q;  2RJE A;  2QQB A;  3QJY A;  3HU3 A;  3OW2 S;  1WA7 A;  1JB0 E;  2X3X D;  2KRO A;  1AVZ C;  4PJN A;  3A5Z B;  3JCM b;  3LHD A;  1M3C A;  3CCE T;  2PNI A;  4RTT A;  3VS0 A;  2E6Z A;  3MEU A;  4RCC A;  1NLP C;  3M9Q A;  1VQN Q;  1J3T A;  2B25 A;  2DO3 A;  3Q1J A;  1Q86 C;  2JW4 A;  3G7Z A;  1B34 A;  1M3A A;  2AZV A;  2OTL Q;  3MEV A;  3LW5 E;  3V8K A;  3CCU A;  2IVW A;  5LJ5 f;  5GAN 7;  1D3B A;  2E70 A;  2KMT A;  1SEM A;  1QKX A;  4J9H A;  1I8F A;  4FSS A;  4LNP A;  5D7U A;  4Y28 E;  1UJY A;  1KK7 A;  3HRS A;  4M75 C;  4QW2 A;  2GNC A;  2CH4 W;  5GMK m;  5GAN 8;  4RKU E;  3M59 A;  1HD3 A;  1AWX A;  3MET A;  1U5S A;  3EG2 A;  2FRY A;  3RIR A;  5LJ3 e;  1MMG A;  3RDV A;  4DA4 A;  2SRC A;  4Z88 A;  5CKD A;  3NTK A;  3CC7 T;  5A0D A;  4BY6 B;  1N6A A;  5FWC A;  4XU2 A;  1K4U S;  4BAC A;  2DD4 A;  3RKX A;  3M53 A;  1NJI U;  3CMA Q;  5FWB A;  3I56 Q;  1RAF B;  5GAN j;  2C06 A;  4L5G A;  4B6M A;  3QXE B;  4R0K A;  2E5K A;  3FJP A;  3PIP A;  4KH0 B;  1PKT A;  2Q1C X;  3RUX A;  5IHI A;  2WSF E;  4HT9 A;  3CMA A;  2A0F B;  3OYN A;  4ZN1 A;  5IAY A;  1W1F A;  2CZ1 B;  2H3J A;  2ZPE B;  4LDX A;  4PK4 A;  2AHJ B;  5KYY B;  4J9C A;  4JRP A;  3E2U A;  3OSV A;  4LD9 K;  3G6E T;  4FT2 A;  5GAN g;  2BE9 B;  1M30 A;  2MCN A;  1S72 T;  1VQM T;  3O5Z A;  3ME9 A;  1YFN A;  3OYC A;  2M02 A;  1R0C B;  3QII A;  2RJC A;  2OTJ T;  3HHT B;  1XOV A;  1U06 A;  2AKL A;  4J9E A;  2QTV A;  3CCL T;  4BUG A;  5J39 A;  4M77 A;  3CCU Q;  2Z0W A;  2VB6 A;  4PFO A;  2OTL T;  1KD1 R;  1SF9 A;  3X20 B;  2P4R A;  5GLF A;  2CYZ B;  1FX7 A;  2PUK B;  2JMC A;  2K6D A;  1UEB A;  3FIF A;  1K9A A;  2VWF A;  3E1S A;  4NL2 A;  3PE0 A;  5CQY A;  4AS1 A;  4M75 G;  4BD3 A;  4X34 A;  3RER A;  2DVJ A;  2AIR B;  4RTZ A;  1GCQ C;  1ZUK A;  1IHW A;  3CCS A;  5LJ3 f;  3OYB A;  3HTR A;  2K9G A;  2XDB A;  3NGP A;  4Y91 A;  5IHK A;  1R7R A;  4M4Z A;  4ZGD B;  3VS3 A;  3CC2 A;  1YIT T;  2LZ6 B;  1OYX A;  4KUL A;  4E6R A;  2MWP A;  4C92 A;  2MPX C;  2XHC A;  4C92 B;  5FTK A;  2RI3 A;  2JZ2 A;  5FW9 A;  4F17 A;  1RUW A;  2BIV A;  4LUD A;  3QYG B;  1W2B A;  5FRN A;  5GAO l;  3E9G A;  2ESW A;  3G4S A;  1X75 C;  1M90 C;  2BZX A;  5CCX A;  4XTU A;  2EBP A;  2QTX A;  3EFO B;  5AYF A;  4RG8 A;  2GQI A;  2HSP A;  1V76 A;  2EIF A;  2MAM A;  2RF0 A;  2HL5 C;  3G6E Q;  2KY9 A;  1JXO A;  3CCS T;  5AT1 B;  1VQK T;  2DBM A;  2DJZ A;  1I5L A;  3OYY A;  1N27 A;  2L5Q A;  4ZGJ B;  2LX7 A;  2XU8 A;  3CCE Q;  1YWO A;  2CKK A;  4M77 B;  4IUV A;  4MZP A;  2RMO A;  5D6W A;  2PJH B;  4FCY A;  2JM9 A;  5GMK e;  1QDN A;  2GFU A;  2RK1 A;  2EYW A;  3G4S T;  3QSU A;  2A3L A;  2DM1 A;  1KQS S;  4AT1 B;  1NBE B;  2PZ1 A;  2DER A;  1BB9 A;  4OGE A;  3GPL A;  4M7D D;  5GAN 4;  2DYI A;  4C0G A;  4PLI A;  4EMG A;  3BY7 A;  3CPW S;  3JCM W;  1ZSZ B;  2DVE A;  2NUT A;  1M1K C;  2K2M A;  2C0O A;  2X35 A;  4V2S A;  1IO6 A;  2CT3 A;  4KBM B;  1K8A R;  4BI3 A;  5I11 A;  5GAN e;  1OX9 A;  2VUB A;  2YLC A;  4PL6 A;  2LCS A;  1GL5 A;  1H64 1;  3H0H A;  2RQR A;  2KR3 A;  2EYY A;  4IIO A;  4M77 F;  2DET A;  3JCM X;  1NE8 A;  3DLL A;  4M7D F;  2M0O A;  4M78 B;  2V1Q A;  3LWI A;  3QUI A;  1LVK A;  1TUG B;  5DLO A;  3FDR A;  3H41 A;  4JZ3 A;  2EJG A;  4KRT A;  2EQM A;  3LYI A;  2EJF A;  4UC4 A;  4F7U B;  4KLN A;  1RI9 A;  1BK2 A;  1K9M R;  2CSI A;  4J6Y A;  3L2V A;  1QVF A;  2OAW A;  4HCZ A;  2CP2 A;  3HU2 A;  1XQH A;  2GBQ A;  3VS7 A;  2O4X A;  3AT1 B;  1TOV A;  4RTU A;  4R56 A;  2F2X A;  1U1T A;  2QYZ A;  5DM7 R;  3CCE A;  1XJW B;  3JAM E;  3MEA A;  1EIF A;  2EJ9 A;  1SSF A;  2CZ7 B;  4QVZ A;  1I81 A;  5CO7 A;  3CCV A;  3PMI A;  3QPH A;  3G6E A;  3JB9 J;  4RTY A;  1B34 B;  1D1A A;  3VRZ A;  3VS6 A;  1VQ6 Q;  5CKB A;  1X6B A;  4HA8 A;  3EFS A;  4OP0 A;  1ZSZ A;  1FMW A;  2E1H A;  5GAN d;  4OMQ A;  5A0G A;  2KI7 A;  4N4I A;  1UGP B;  4FYX B;  1N8R C;  4C0D B;  2HQH A;  5GAO n;  2E10 A;  2ED0 A;  4HXJ A;  3G4S Q;  1Y71 A;  3QJ6 A;  1RAD B;  4XTX A;  4F7U F;  1WX6 A;  2ZCF B;  3ZEH A;  1TS9 A;  1T3S A;  5LJ5 h;  5GJV B;  5EG2 A;  2AZS A;  1ZSZ C;  1MHN A;  2V8J A;  1UGQ B;  2CDT A;  5KCO A;  3A8H B;  1YJW Q;  3HFO A;  3CC2 Q;  2OJ2 A;  3QZ5 B;  4J7F A;  2XDP A;  2DD5 A;  1M2O A;  3UA6 A;  3L2Q A;  5IT9 E;  1WJQ A;  1SHF A;  1MV3 A;  1PHT A;  9ATC B;  1VIF A;  2QAZ A;  2DXT A;  4M77 E;  4PJO A;  2JMA A;  1VQ7 T;  2F5K A;  2CS7 A;  4M7D E;  4ELY C;  1T0H A;  1WHG A;  3VRY A;  3FJ5 A;  5L8R E;  5CK9 A;  3H6Z A;  5HK0 A;  2K3Y A;  5J3B A;  3QWZ A;  4RUG A;  5FU7 C;  1WJS A;  2HCK A;  3NTH A;  2CSQ A;  4L6V 5;  2BE7 D;  3KUF A;  1W2B P;  2XIC A;  4EDU A;  4M7A F;  4PJM A;  1WIE A;  4DOW A;  4M78 F;  2LJ1 A;  3GP8 A;  5C1B A;  4ESR A;  2H8H A;  4L59 A;  4MDW A;  4C8Q G;  3LGA A;  3UDC A;  2L8D A;  2YUO A;  1NJI C;  4RV0 A;  2BKD N;  1EZZ B;  1K73 C;  2QQ9 A;  1QW1 A;  4C92 E;  1YHQ A;  5KYN A;  2Y90 A;  5LJ3 h;  4CRI A;  2BZY A;  3HKS A;  1RAE B;  3UAT A;  2ZPF B;  2B8A A;  3FRN A;  1PM3 A;  2COY A;  3C95 A;  2RB6 A;  5IHN A;  3L42 A;  4C92 C;  4HCC A;  3C4S A;  4C0F A;  2J6F A;  4EMK A;  4XK8 E;  3ZFJ A;  4F7U G;  1KG1 A;  1E32 A;  3REB B;  1AZG B;  4RCB A;  3S6W A;  1BI2 A;  1Y07 A;  3OY9 A;  3P8H A;  1GCQ A;  4NL3 A;  3I56 A;  1A0N B;  5CAI A;  5GAO p;  2HBW A;  1QCN A;  4FW1 A;  1G83 A;  3OS2 A;  1AD5 A;  4ZTF A;  2JTM A;  4M75 E;  2C0T A;  3QYH B;  1BKB A;  1M5Q 1;  3V7S A;  3R6N A;  3CCU T;  4FW2 A;  4BY6 C;  1UGV A;  2VXE A;  2LQ8 A;  1YJW T;  1TSF A;  3TSZ A;  1YIJ A;  3RMS A;  3CD6 T;  3X26 B;  5I22 A;  2JS0 A;  3ER0 A;  1FXX A;  4ZGE B;  4M75 B;  2OTL A;  2HQX A;  1B07 A;  2XD0 A;  3MCA B;  1F1B B;  2GGR A;  2RJD A;  4OVA A;  2KSS A;  3OYD A;  3JCM c;  5IH2 A;  1VQN A;  3CF2 A;  2YUQ A;  1YIJ T;  1LCK A;  5GAM h;  2YRV A;  3X28 B;  3TCJ A;  5FTL A;  5CCA A;  3OYI A;  4FSX A;  2RI5 A;  3EG0 A;  3TRE A;  4PJO F;  2P0K A;  4C92 F;  2GF7 A;  3JB9 H;  2DTH A;  4F04 B;  1RAB B;  3SD4 A;  3C12 A;  4B9W A;  4ARC A;  2CUD A;  4QVC A;  4XTY A;  2DEQ A;  3ULR B;  1UDL A;  2O9S A;  1ZX6 A;  2K3B A;  2D0N A;  2KXC A;  3CBP A;  4PFZ A;  2VYT A;  4O6J A;  1Q82 R;  2ECZ A;  2K5F A;  1K73 U;  4LDV A;  2CP3 A;  1X69 A;  3CCR T;  1UE9 A;  4RMO A;  2DA9 A;  1PD1 A;  3VUZ A;  1D3B B;  3CEY A;  3H8Z A;  1W4S A;  4C92 D;  2RQV A;  2FVU A;  1WDX A;  1S72 A;  2NLU A;  4M78 C;  1WPY A;  3FC3 A;  1GBQ A;  1ABQ A;  1IGQ A;  4HVW A;  1VQM A;  1YI2 Q;  2ZGW A;  2GTO A;  4JZ4 A;  4OMO A;  4PJL A;  3L2Z A;  3JCM Q;  3CC4 A;  1RAA B;  1M1K R;  4M75 A;  4C8Q B;  3REA B;  3CCR A;  5EQJ B;  5J26 A;  4M75 F;  1VQ9 A;  4OB0 B;  2K5I A;  2M9U A;  2OI3 A;  4J9G A;  1Y57 A;  2QQA A;  4BDZ A;  2E3H A;  2LC4 A;  2KRN A;  3TEE A;  3M0R A;  4N0A A;  5L23 A;  5GAO r;  2DPP B;  4FIB A;  2FZG B;  2LVM A;  3OW2 P;  1OZ2 A;  5FU7 B;  2X4J A;  1PSE A;  2EKH A;  2KYM A;  1KC8 U;  2R57 A;  1RAH B;  2LRQ A;  2J6K A;  5M9O A;  4RTW A;  2DF6 A;  2LDM A;  1O75 A;  1VQ5 A;  3UT1 A;  1WJR A;  2LW6 A;  2HKN A;  2MI6 A;  1QVP A;  4BI4 A;  1PKS A;  3KFV A;  2L3P A;  2LNV A;  4DBQ A;  2E4H A;  3I9Q A;  1QVF S;  1WXT A;  4LN2 A;  2D8H A;  4II1 A;  3CME T;  2VV5 A;  4PJO E;  5FRM A;  3MP6 A;  2AK5 A;  3VS5 A;  3CCM T;  3UA7 A;  1C1A A;  4LD6 A;  1YJ9 T;  4A4E A;  1V1C A;  2XK0 A;  1W6X A;  1LPL A;  1M2V B;  3OMC A;  3MB5 A;  2GQV A;  4OB2 B;  2VAS A;  2HDA A;  2KRM A;  4XTZ A;  1YJN A;  5FTN A;  1Z9Q A;  2DIL A;  2EQU A;  4E7S A;  2E41 A;  5IXF A;  4D8D A;  4JJB A;  3CCM A;  4Y92 A;  2XI9 A;  2QA4 A;  3WVD B;  1OZ3 A;  3OYE A;  1VQL Q;  4JPB W;  1VQK Q;  1UG1 A;  2WSE E;  2A08 A;  5GAO q;  3HRT A;  1Q95 G;  1YJN T;  5EC7 A;  2E12 A;  1VYV A;  2KEA A;  3A8O B;  2YRD A;  1VQ6 T;  3OW2 A;  4C0D C;  2Y4X A;  1KSW A;  3VV0 A;  1I5O B;  2EQJ A;  2RQT A;  3GLX A;  1AOJ A;  4GLM A;  4IKF A;  3OYA A;  3D7S B;  2CZ0 B;  3DKM A;  4CC3 A;  1YJ9 A;  2E65 A;  3LGL A;  1SHG A;  2FPD A;  3L1A A;  2KT8 A;  2YVL A;  2I0N A;  4PJJ A;  3J80 E;  2BUD A;  4AQ7 A;  4BE2 A;  2ATC B;  5GAM d;  2EFI A;  2BTT A;  1YCS B;  4J8O A;  1OV3 A;  2EYQ A;  1KFZ A;  1IRE B;  1JU5 C;  1KJW A;  1GFC A;  5CIU A;  1OOT A;  3J81 E;  3BDL A;  2ZPI B;  3AHU A;  2DEU A;  4C8Q D;  3IQL A;  4GBQ A;  1BI1 A;  5ERG B;  2FYK A;  4KGX B;  1OX8 A;  3CQT A;  1AZE A;  2CGH A;  3M0P A;  2DTI A;  3TIW A;  1K8A C;  3CME Q;  3EHQ A;  1X43 A;  1VQ7 Q;  5CR2 A;  1K73 R;  2EWN A;  4AG2 C;  2QEX T;  1NLO C;  2VXF A;  1MGQ A;  2LJ0 A;  1NYG A;  2G3R A;  3M54 A;  5A0L A;  1KQS A;  3NHN A;  2PUO B;  4Q5W A;  1TUC A;  2DL7 A;  5ECA A;  4AFS C;  2VKN A;  5KYX B;  3EG1 A;  2ROL A;  5CQX A;  2A37 A;  2FZC B;  4PKC C;  2ABL A;  1O9S A;  4D8K A;  2KQW A;  7AT1 B;  1KC8 R;  1YIT Q;  4E7H A;  1TTH B;  1XTD A;  1ZUU A;  2DFU A;  2LCL A;  2X3W D;  3LH0 A;  1JJ2 A;  5GMK l;  1AT1 B;  3M57 A;  1BIB A;  4OF1 A;  1ZBX A;  1ZLM A;  3HP9 A;  4FU6 A;  1WI7 A;  4LDW A;  4WF2 A;  2IIM A;  3OYJ A;  2Q19 X;  3CCQ Q;  1I4K 1;  2YXY A;  2PVO B;  3NTI A;  4WTO B;  3L2R A;  2MM2 A;  2COZ A;  1TXQ A;  1CSK A;  2O2O A;  3HL8 A;  1GXI E;  4ORZ A;  3S3O A;  1HK9 A;  3JB9 I;  5GAM g;  1QP3 A;  3UF4 A;  3CC4 T;  3OYF A;  2XKO C;  1G3T A;  1QCF A;  4GLK A;  4ARI A;  5IXB A;  1VQ9 T;  3SFM A;  1U3O A;  5CKF A;  3G71 Q;  5GAN 6;  2D9T A;  1Y96 B;  1G2B A;  1Q81 C;  1AEY A;  5FTJ A;  2MM0 A;  3WVE B;  5HK3 A;  2XMF A;  4DBF A;  2V1R A;  3JCM V;  4KGV B;  2DXC A;  2R5M A;  3X24 B;  4C5H A;  3VS4 A;  1S3S A;  3QKJ A;  3SWN C;  3QC8 A;  3N5B B;  2LQK A;  2HKQ B;  2JUF A;  4FYY B;  2KYB A;  5FTM A;  2Q18 X;  1PRM C;  2L3Q A;  5B6C A;  3I55 A;  3OYG A;  1IHV A;  1M1F A;  4OMF B;  3QWY A;  5CVI A;  2LX9 A;  1ABO A;  1E6G A;  1JXM A;  1N5Z A;  2W10 A;  4MZT A;  3P8B B;  4JRK A;  3H0F A;  1VQL T;  4N0A C;  4J6X A;  1K0X A;  4M7D A;  2DRM A;  2LNH B;  2NUP A;  2D0Q B;  2DX1 A;  1C6V X;  2XID A;  2HD0 A;  3EG9 B;  4D6W A;  5EPP A;  3M0Q A;  3S3M A;  2YUJ A;  2KBT A;  1XNI A;  2HBP A;  3OSS C;  3BW1 A;  1VQ4 T;  3QDR B;  2HAX A;  2K3X A;  1M90 R;  2OTJ Q;  1N9S A;  2HNI A;  3L2W A;  3CC7 Q;  1MMA A;  4BDY A;  2LCC A;  3SWN B;  1TG0 A;  2YWW A;  4M7D C;  1WHJ A;  4FL6 A;  1WQW A;  1Z9Z A;  2QGG A;  4QQ6 A;  5I2S A;  3R6O A;  3EGX B;  1T3L A;  2QA4 T;  4ZTJ A;  4FT4 A;  5KCH A;  3RR6 A;  2WSC E;  1VQ4 A;  1UHC A;  3TQ7 P;  1R77 A;  1ACM B;  3V8L A;  2JTF A;  1OPK A;  2EYX A;  4FYW B;  1LNX A;  2NUP B;  4MMK A;  3QHS A;  4Z02 A;  2VC8 A;  2FHD A;  1V29 B;  4A4K A;  4M7A C;  1VQO A;  4XU0 A;  3OMG A;  4KUI A;  3MKD A;  2VGM A;  3SWN A;  2PTK A;  2EVR A;  4ZN3 A;  2QG9 B;  1I9G A;  3MP1 A;  1OUL A;  1BCO A;  3GNG A;  5GJW B;  4M75 D;  2RN8 A;  2J05 A;  2RJF A;  3BQB A;  1OEB A;  4M7A B;  2EYZ A;  1BYM A;  1NM7 A;  3OBW A;  1AWO A;  1GBR A;  1NYF A;  3CCL A;  1VQO T;  4PFP A;  3UWN A;  1PSF A;  1QP2 A;  3A98 A;  4R55 A;  3EFR A;  1X27 A;  1GFD A;  2E5Q A;  3QZ9 B;  4KOD A;  4FM4 B;  1MV0 B;  1X2Q A;  2ZPB B;  1NEG A;  1UFF A;  2WAC A;  5D6Y A;  3CC2 T;  3INZ A;  3CC7 A;  3CD6 A;  2CT4 A;  2KXD A;  2JNG A;  2A28 A;  3LX7 A;  2QEX A;  2O9V A;  1IXD A;  2K5L A;  3ZBD A;  2RHX A;  2JXB A;  4E47 A;  1SRM A;  1UHF A;  1BBZ A;  4TVR A;  2QDL A;  4AMC A;  5GAN h;  3KBG A;  3MEW A;  2X4Y A;  4KH1 B;  4NS5 A;  3V7C A;  1B3Q A;  3QWX X;  3M4Y A;  1ARK A;  3PMT A;  1WLF A;  1SRL A;  3V7R A;  1QVF P;  5KYW B;  2EPD A;  1KQS P;  3I5R A;  4JRQ A;  5I2M A;  1NJI R;  2DL5 A;  1PWT A;  3RMQ A;  4RTX A;  2YLB A;  2ROT A;  2NUZ A;  3OS5 A;  2DE0 X;  3DLM A;  3F70 A;  1JO8 A;  4X9D A;  4EMK C;  8ATC B;  3O8V A;  5CD1 A;  5KYX A;  2KT1 A;  1MMN A;  5LJ5 g;  1JQQ A;  3CXC S;  1BU1 A;  3CPF A;  3G71 T;  3CPW A;  2X9H A;  1BI3 A;  2YUN A;  2AKK A;  2EQK A;  5GAN 3;  4HVU A;  1WHM A;  2DYB A;  1YCY A;  3A8G B;  4O5V A;  2JTE A;  5KYY A;  4E7L A;  2CZ6 B;  2JT4 A;  2FPF A;  2E6N A;  3VUB A;  3FPT A;  3OYL A;  2HSE B;  1NPR A;  1VA7 A;  2O31 A;  2YRC A;  3HU1 A;  1HXD A;  2VVK A;  1VQP Q;  2RA2 A;  1VQ8 A;  3PFS A;  2CP5 A;  3URG A;  5KYU A;  3EHR A;  1G3S A;  3ZJU A;  1NG2 A;  1HJD A;  4MZM A;  1YIT A;  1QQJ A;  5C0M A;  5CKH A;  2CP0 A;  3M4G A;  2RPN A;  1KHC A;  1RAI B;  2Y4Y A;  2ZZD A;  2LTO A;  1OU8 A;  1Y0M A;  2LT4 A;  4JS4 A;  1R8O B;  1WZO A;  2ENM A;  1BI0 A;  3VKI A;  4A63 B;  3JCM d;  3CCJ A;  1Q7Y R;  5LJ3 d;  3U23 A;  3H0I A;  3PTA A;  4QKU A;  1MND A;  2NWM A;  4F7U E;  1VQ7 A;  1YBY A;  3FB9 A;  4EPC A;  4YTL A;  4DOV A;  4A4G A;  4GY5 A;  3CME A;  1QCO A;  2FRW A;  1D0Y A;  4M78 A;  3WXM B;  4CC2 A;  3QDF A;  3S3N A;  2DJQ A;  3MHX A;  3RKW A;  5GMK j;  2YSQ A;  1WYX A;  4XTV A;  3LLR A;  4HT8 A;  4EMH A;  2MYS A;  1DJ7 B;  1N8R U;  4E2F B;  4CQN A;  4J9B A;  4E7J A;  6AT1 B;  4QQG A;  1QWE A;  5HKC A;  3GNF B;  1QCS A;  1ZSG A;  2ZPG B;  3VS1 A;  1G3Y A;  1WXU A;  2K7A A;  2HEQ A;  2JVV A;  3C94 A;  1EFN A;  4C8Q C;  2EGE A;  3CCJ Q;  3TVT A;  2CUB A;  1D1B A;  3SEM A;  4ATO A;  1UGR B;  3NPF A;  1E6H A;  2M16 A;  1T0J A;  1VQK A;  3A1P A;  3CBM A;  4IUP A;  3H9N A;  1RAG B;  1PNJ A;  4JS5 A;  1VQL A;  5C18 A;  1CZ5 A;  4DBH A;  2QA4 Q;  1TH7 A;  4B9X A;  2KGT A;  2K4Y A;  1VQ8 Q;  3CCM Q;  1CKA A;  4XU1 A;  2HL3 A;  1VQP A;  3QQ7 A;  1D09 B;  1FWZ A;  3JSC A;  5GMK h;  2V8K A;  1KD1 U;  2RI2 A;  1MMD A;  5GAO m;  3QQ8 A;  2KVQ G;  4F16 A;  3HSB A;  2QDY B;  1UTI A;  3CCJ T;  1P92 A;  2I2L A;  2KNB B;  2YT6 A;  1JJ2 S;  2P0P A;  1U8R A;  2F69 A;  3OA6 A;  1NZ9 A;  2DAQ A;  1Y7X A;  3PGG A;  1CR5 A;  3EGX A;  1WQ7 A;  2FG0 A;  5D6X A;  3JCM g;  3I56 T;  1Y96 A;  2COW A;  2DIQ A;  1PD0 A;  1M27 C;  1IGU A;  2M1H A;  3GBQ A;  3M56 A;  2F2V A;  1QKW A;  5FU6 C;  1ZC1 A;  2GTJ A;  4KO8 A;  4DEX A;  1N9R A;  2QK0 A;  1VQ5 Q;  4NOY A;  2K2V A;  1E7O A;  5FRO A;  2P84 A;  3PT9 A;  1KHI A;  1AWW A;  2IPO B;  4OB1 B;  1I0C A;  3M0S A;  2DL8 A;  3FPU A;  4HCB A;  2MK5 A;  4AFU C;  4J6W A;  5DYI A;  2GCX A;  2JJ9 A;  4QT7 A;  1SSH A;  1U1S A;  2QEX Q;  2MIO A;  1OU9 A;  2EGA A;  3EGU A;  4OML A;  2A36 A;  3A8M B;  4XAX B;  3CPW P;  1VQ9 Q;  1OQK A;  1IB8 A;  3QO3 A;  4JJC A;  4J83 A;  2GFA A;  2DL3 A;  3OS0 A;  1WGS A;  3X25 B;  1G5V A;  5GAM f;  1M4Z A;  1JRI A;  3CD6 Q;  3LWH A;  2DL4 A;  1G8X A;  2JM8 A;  1VQM Q;  3JB9 F;  2CP6 A;  2W0Z A;  3PIO A;  1S72 Q;  1CZ4 A;  4C5E A;  4M77 G;  4E7K A;  1PC0 A;  2FO0 A;  4HKE A;  1ZBJ A;  2KAF A;  4N4G A;  2PWY A;  5KE2 A;  1Q82 U;  4M7D G;  2DZ9 A;  2JS2 A;  3QG1 A;  1WHH A;  2RHY A;  4EIK A;  3C0C A;  3CCL Q;  2C0I A;  5KYW A;  1QMC A;  4KUD K;  2NUT B;  3EG3 A;  1X01 A;  5LL6 S;  1Q86 U;  3RBB B;  2Q1A X;  2F2W A;  3DB4 A;  4ME7 A;  1KQ1 A;  1BIA A;  1YP5 A;  1GCP A;  1BCM A; 
#chains in the Genus database with same CATH homology
 1XNI A;  2HBP A;  2KMT A;  3BFM A;  3OSS C;  3BW1 A;  5KE3 A;  4F7U G;  1KG1 A;  2LT1 A;  1E32 A;  1VQ4 T;  3EAE A;  1I8F A;  2X4W A;  3QDR B;  1YHQ T;  2HAX A;  1Q7Y C;  2K3X A;  4KDL A;  1N9S A;  2QXF A;  4A4H A;  2HNI A;  3L2W A;  4RCB A;  3S6W A;  4Y28 E;  3CCV T;  3HRS A;  4MML A;  4BDY A;  1BI2 A;  1Y07 A;  4M75 C;  3OY9 A;  4QW2 A;  2LCC A;  3SWN B;  5GMK m;  3P8H A;  4M7D C;  4F7U A;  4NL3 A;  3I56 A;  5GAN 8;  4FL6 A;  4RKU E;  3M59 A;  1WQW A;  4BI8 B;  4JUV A;  5CAI A;  5GAO p;  4IUR A;  4QQ6 A;  5KH6 A;  2KK4 A;  2OAU A;  5I2S A;  3MET A;  3R6O A;  2QA4 T;  3RIR A;  4ZTJ A;  4FT4 A;  5KCH A;  5LJ3 e;  3OS2 A;  4DA4 A;  4ZTF A;  2WSC E;  2JTM A;  1VUB A;  1VQ4 A;  5CKD A;  4M75 E;  3NTK A;  3QYH B;  5A0D A;  3CC7 T;  1BKB A;  1M5Q 1;  2VGN A;  4BY6 B;  3V7S A;  1N6A A;  4XU2 A;  4EMK B;  4BAC A;  3JCM J;  2DD4 A;  3V8L A;  3CCU T;  3RKX A;  3M53 A;  1NJI U;  2JTF A;  4BY6 C;  1M1K U;  4MMK A;  1LNX A;  4Z02 A;  3QHS A;  3M5A A;  4C8Q F;  2VC8 A;  5GAN j;  2R58 A;  2FHD A;  2C06 A;  2VXE A;  1V29 B;  2LQ8 A;  4L5G A;  4A4K A;  3OYH A;  1YJW T;  2P4T A;  4M7A C;  1VQO A;  1YIJ A;  4XU0 A;  3RMS A;  3OMG A;  3QXE B;  4KUI A;  3SWN A;  2VGM A;  3CD6 T;  3X26 B;  2OTJ A;  2EAY A;  3FJP A;  3PIP A;  3FLG A;  3ER0 A;  2Q1C X;  3RUX A;  4ZN3 A;  1M90 U;  2WSF E;  4HT9 A;  1I9G A;  3MP1 A;  3CMA A;  3GNG A;  1FXX A;  2QQR A;  2HQE A;  4ZGE B;  4M75 B;  4M75 D;  2HQX A;  2OTL A;  5LJ5 f;  3OYN A;  2XD0 A;  1VQ8 T;  3MCA B;  4ZN1 A;  2RJD A;  5IAY A;  3BDU A;  2RJF A;  2CZ1 B;  2H3J A;  2ZPE B;  2KSS A;  4OVA A;  3OYD A;  4LDX A;  4M7A E;  3BQB A;  3JCM c;  2AHJ B;  1WNL A;  4M7A B;  4M77 D;  1W2B S;  1VQN A;  3OBW A;  1BYM A;  4M78 E;  4JRP A;  3CF2 A;  5GAM e;  4MDX A;  5A2Q E;  1VQO T;  3CCL A;  2L89 A;  1ZHI A;  3UWN A;  1YIJ T;  5I21 A;  1PSF A;  1QP2 A;  5GAM h;  2YRV A;  3EFR A;  3OSV A;  4R55 A;  3X28 B;  2E5Q A;  3QZ9 B;  3TCJ A;  3JB9 G;  4LD9 K;  4KOD A;  3HPW A;  3G6E T;  2RK2 A;  4FT2 A;  5GAN g;  4PJO C;  2Q1D X;  5FTL A;  4FM4 B;  2MWO A;  5CCA A;  2D6F A;  3OYI A;  1S72 T;  1X6O A;  4FSX A;  1IZ6 A;  2ZPB B;  2RI5 A;  1VQM T;  1UGS B;  3ME9 A;  2WAC A;  3TRE A;  5D6Y A;  4JLG A;  3INZ A;  4JJN K;  3CC2 T;  3OYC A;  4PJO F;  2P0K A;  4C92 F;  2GF7 A;  3QII A;  2RJC A;  3CC7 A;  2DTH A;  3CD6 A;  3OS1 A;  3JB9 H;  2OTJ T;  4C8Q A;  3HHT B;  1XOV A;  4LDY A;  3SD4 A;  3C12 A;  4B9W A;  2RHU A;  4ARC A;  3QBY A;  2JNG A;  4QVC A;  4XTY A;  2RHZ A;  2DEQ A;  3CCL T;  3NFC A;  4BUG A;  5J39 A;  4M77 A;  3CMA T;  3LX7 A;  3OYM A;  2QEX A;  2OTL T;  3CBP A;  3RKY A;  1LJO A;  4X9C A;  4RG2 A;  3X20 B;  2KDS A;  2K5L A;  4KDI A;  2VYT A;  5GLF A;  2CYZ B;  3ZBD A;  2PVD B;  2RHX A;  4O6J A;  2K5F A;  2PUK B;  1FX7 A;  3MP8 A;  4LDV A;  1K73 U;  1UEB A;  3FIF A;  4E47 A;  3CCR T;  4RMO A;  1O54 A;  5GAN 7;  3E1S A;  4TVR A;  4NL2 A;  4KT0 E;  3G71 A;  2DXU A;  3VUZ A;  1D3B B;  3CEY A;  5GAN h;  3H8Z A;  1W4S A;  4M78 G;  4C92 D;  5CQY A;  2FVU A;  3KBG A;  3MEW A;  4AS1 A;  4M75 G;  3HFN A;  3SDZ A;  2X4Y A;  4X34 A;  4BD3 A;  4NS5 A;  3V7C A;  1S72 A;  3RER A;  2NLU A;  2PU9 B;  4M78 C;  1WPY A;  4P5N A;  4XQ3 A;  3M4Y A;  2XDD A;  3FC3 A;  1VQM A;  2QI2 A;  2ZGW A;  4XU3 A;  3PMT A;  1WLF A;  3CBO A;  3V7R A;  2L3R A;  3L2Z A;  3CCS A;  3JCM Q;  5LJ3 f;  3CC4 A;  4M75 A;  3OYB A;  4JRQ A;  5I2M A;  2XDB A;  2IG0 A;  3RMQ A;  4C8Q B;  4Y91 A;  3CCR A;  5EQJ B;  2YLB A;  5J26 A;  1R7R A;  4M75 F;  2JN0 A;  4LDU A;  5GAN f;  4ZGD B;  1VQ9 A;  3OS5 A;  3CC2 A;  3CCQ A;  3DLM A;  2X4X A;  3F70 A;  5FLX E;  2RM4 A;  4JDS A;  1YIT T;  4OB0 B;  2DK3 A;  4X9D A;  4EMK C;  2K5I A;  2M9U A;  1VQ5 T;  1OYX A;  4KUL A;  2MMP A;  2QQA A;  4BDZ A;  3O8V A;  2MWP A;  4C92 A;  1G3W A;  5CKE A;  5CD1 A;  5LJ5 g;  2XHC A;  4C8Q E;  2LC4 A;  3CXC S;  4C92 B;  4OB3 B;  2PVG B;  3CPF A;  2RI3 A;  4N0A A;  3TEE A;  5FTK A;  2JZ2 A;  3G71 T;  2FL7 A;  4QQD A;  3CPW A;  5GAO r;  2BIV A;  2DPP B;  3QYG B;  4FIB A;  1W2B A;  1BI3 A;  2LVM A;  5GAO l;  5FRN A;  3E9G A;  1OZ2 A;  2EQK A;  2JOY A;  4C92 G;  5GAN 3;  3CXC A;  1X75 C;  3G4S A;  5FU7 B;  1M90 C;  5CCX A;  2X4J A;  1PSE A;  4BE1 A;  1YCY A;  3A8G B;  4O5V A;  4E7L A;  2CZ6 B;  5GAN 2;  2R57 A;  1KC8 U;  4XTU A;  2LRQ A;  5M9O A;  3P8D A;  2E6N A;  3VUB A;  4C0Z A;  2LDM A;  1O75 A;  1VQ5 A;  3MO8 A;  2QTX A;  4J7I A;  3FPT A;  5AYF A;  3UT1 A;  4RG8 A;  5LJ3 g;  3OYL A;  4BE0 A;  1WJR A;  3M55 A;  1NPR A;  2LW6 A;  2EIF A;  2MAM A;  2MI6 A;  3TU4 K;  4N4H A;  3HU1 A;  1HXD A;  1QVP A;  4BI4 A;  1YJW A;  2O4X B;  2KY9 A;  2RA2 A;  2LNV A;  1VQ8 A;  3CCS T;  3PFS A;  1QVF S;  3URG A;  1VQK T;  1G3S A;  2DJZ A;  4II1 A;  3ZJU A;  3CME T;  1I5L A;  2VV5 A;  3OYY A;  4PJO E;  2YUJ A;  1N27 A;  4CQN A;  4MZM A;  2L5Q A;  4ZGJ B;  5FRM A;  3MP6 A;  2XU8 A;  1YIT A;  5DY9 A;  2FB7 A;  3CCM T;  2DIG A;  2O01 E;  4LD6 A;  2RH2 A;  2CKK A;  5C0M A;  4M77 B;  5CKH A;  4M7A D;  3M4G A;  4J5Y A;  1YJ9 T;  4IUV A;  4MZP A;  4A4E A;  1VQN T;  1UB4 A;  2XK0 A;  5D6W A;  1KHC A;  5GMK i;  2Y4Y A;  4M78 D;  5LJ3 j;  2PJH B;  3JCM e;  2ZZD A;  3OMC A;  2LTO A;  4CI0 C;  3MB5 A;  3VU3 C;  2LT4 A;  4JS4 A;  5GMK e;  1QDN A;  1R8O B;  3JCM P;  2GQV A;  4OB2 B;  4A53 A;  2GFU A;  1BI0 A;  3VKI A;  3PNW C;  3JCM d;  2RK1 A;  3CCJ A;  2JV2 A;  5LJ3 d;  4XTZ A;  5FU6 B;  3G4S T;  3QSU A;  1YJN A;  5FTN A;  1Q82 C;  2EQU A;  3OBY A;  1NPP A;  2A3L A;  2E41 A;  3PTA A;  1VQ6 A;  3ZJT A;  2DXB A;  2QQS A;  1QVG A;  3CCM A;  1KQS S;  4F7U E;  3ASK A;  3E19 A;  1VQ7 A;  1YBY A;  2XI9 A;  3FB9 A;  4OGE A;  3GPL A;  2QA4 A;  4M7D D;  3WVD B;  5GAN 4;  1OZ3 A;  3OYE A;  4EPC A;  4YTL A;  4C0G A;  4DOV A;  4PLI A;  4A4G A;  4EMG A;  3BY7 A;  4GY5 A;  3CME A;  3CPW S;  1LOJ A;  3JCM W;  2DVE A;  3FPR A;  1M1K C;  4M78 A;  3WXM B;  5LJ5 d;  2WSE E;  2X35 A;  4V2S A;  1M1G A;  3JCM f;  4KBM B;  3S3N A;  4BI3 A;  5HY6 A;  3HRT A;  5GAO q;  2E64 A;  4PJO G;  2K57 A;  4C5G A;  5GAN e;  2VUB A;  1YJN T;  3MHX A;  2E12 A;  2F5T X;  3A8O B;  3RKW A;  2YLC A;  3SB2 A;  5GMK j;  3OW2 A;  5C6S A;  1VQ6 T;  4PL6 A;  4C0D C;  1K9M U;  2Y4X A;  2YHT A;  1H64 1;  4XTV A;  3LLR A;  3VV0 A;  4HT8 A;  2EQJ A;  4M77 F;  3GLX A;  2MF2 A;  4EMH A;  3JCM X;  3A8L B;  1NE8 A;  4JLI A;  3DLL A;  4IKF A;  1DJ7 B;  3OYA A;  2CZ0 B;  1N8R U;  1M9S A;  1OI1 A;  2M0O A;  3DKM A;  2EKO A;  4M78 B;  5GAN 5;  4E7J A;  3VJP A;  3LWI A;  2E65 A;  1YJ9 A;  3QUI A;  1VIE A;  5DLO A;  3LGL A;  4QQG A;  3FDR A;  4E7I A;  1RI0 A;  4IUQ A;  5HKC A;  3GNF B;  2EJG A;  3L1A A;  1QCS A;  2ZPG B;  4IUU A;  1AHJ B;  2YVL A;  2EQM A;  1VQP T;  3JB9 D;  1G3Y A;  3LYI A;  2EJF A;  4UC4 A;  2JVV A;  3C94 A;  4C8Q C;  4F7U B;  3I55 T;  3VYH B;  3J80 E;  4KLN A;  2BUD A;  4AQ7 A;  1RL2 A;  4BE2 A;  5GAM d;  3GF5 A;  4M7D F;  2EFI A;  4M7A G;  4J6Y A;  3GOX A;  3LGF A;  3L2V A;  1QVF A;  4J8O A;  2EYQ A;  4HCZ A;  1IRE B;  2DZC A;  3V8J A;  4ATO A;  5CIU A;  5LJ5 j;  3HU2 A;  4VUB A;  1XQH A;  4PLL A;  3J81 E;  2O4X A;  4QVD A;  3BDL A;  2ZPI B;  5IN1 A;  1UGR B;  4R56 A;  3AHU A;  3GIB A;  4C8Q D;  1U1T A;  3UPU A;  1BI1 A;  5DM7 R;  3CCE A;  5ERG B;  2M16 A;  3FEO A;  2FYK A;  3T9N A;  3MEA A;  3JAM E;  3JRZ A;  1VQK A;  2CGH A;  2DTI A;  3CBM A;  4IUP A;  4A54 A;  3TIW A;  1K8A C;  3KXT A;  1EIF A;  2EJ9 A;  3OB9 A;  1QVG S;  4JS5 A;  1VQL A;  5C18 A;  1CZ5 A;  1TH7 A;  1SSF A;  2CZ7 B;  4QVZ A;  4B9X A;  1I81 A;  5CR2 A;  3S3M A;  4DQ2 A;  2K4Y A;  5CO7 A;  2EWN A;  3PMI A;  3QPH A;  3G6E A;  2QEX T;  4XU1 A;  3CCV A;  3JB9 J;  1VQP A;  1B34 B;  1Q7Y U;  2VXF A;  1MGQ A;  3QQ7 A;  5CKB A;  2RO0 A;  4HA8 A;  3EFS A;  1FWZ A;  3JSC A;  4OP0 A;  1KD1 C;  1Q81 U;  5GMK h;  2G3R A;  3ZJV A;  2V8K A;  3M58 A;  2RI2 A;  3M54 A;  5A0L A;  5GAO m;  1KD1 U;  4ELZ C;  2E1H A;  3JCM h;  1KQS A;  1H3Z A;  2PUO B;  4Q5W A;  5GAN d;  4C5I A;  2KVQ G;  3QQ8 A;  5A0G A;  3HSB A;  2QDY B;  4N4I A;  1UGP B;  2P0Q A;  5CQX A;  3CCJ T;  1P92 A;  1N8R C;  5GAM j;  4PKC C;  4C0D B;  2I2L A;  2PQW A;  4IUT A;  1JJ2 S;  5GAO n;  2RD1 A;  1O9S A;  2E10 A;  3L2U A;  2P0P A;  2KQW A;  1U8R A;  2F69 A;  3OA6 A;  1Y71 A;  3QJ6 A;  1M8V A;  3VYG A;  4E7H A;  4PJO D;  1XTD A;  1NZ9 A;  2DAQ A;  2LCL A;  1Y7X A;  3PGG A;  4XTX A;  4F7U F;  2ZCF B;  3LH0 A;  1JJ2 A;  4A4F A;  5DYG A;  5GMK l;  3ZEH A;  1CR5 A;  1WQ7 A;  1BIB A;  2V8I A;  3M57 A;  4OF1 A;  4PNO A;  1ZBX A;  1KC8 C;  3J7A F;  3HP9 A;  4FU6 A;  5D6X A;  5LJ5 h;  3OYK A;  5EG2 A;  4LDW A;  4WF2 A;  3JCM g;  3I56 T;  1Y96 A;  4M77 C;  1MHN A;  2DIQ A;  2DTO A;  2V8J A;  4JRI A;  3OYJ A;  1UGQ B;  5KCO A;  3A8H B;  5DLQ E;  2Q19 X;  3HFO A;  1I4K 1;  3NTI A;  2PVO B;  2M1H A;  3L2R A;  2MM2 A;  5CCB A;  3QZ5 B;  4J7F A;  3M56 A;  3HL8 A;  4OGC A;  1GXI E;  2A7Y A;  5FU6 C;  2XDP A;  2DD5 A;  3S3O A;  1ZC1 A;  1HK9 A;  3L2Q A;  5IT9 E;  3JB9 I;  1WJQ A;  1QP3 A;  5GAM g;  4KO8 A;  2R5A A;  1N9R A;  1VIF A;  3CC4 T;  3ZGZ A;  4NOY A;  2K2V A;  2DXT A;  3OYF A;  4M77 E;  2XKO C;  1K8A U;  4BB7 A;  3E9F A;  1YI2 A;  4PJO A;  1VQ7 T;  1G3T A;  2F5K A;  2DKG A;  2CS7 A;  3OQ5 A;  5FRO A;  4M7D B;  4M7D E;  4GLK A;  4ELY C;  4ARI A;  3PT9 A;  1VQ9 T;  1KHI A;  1KQ2 A;  4OB1 B;  5L8R E;  4PJO B;  3CCQ T;  5CK9 A;  3SFM A;  3H6Z A;  5CKF A;  5HK0 A;  2K3Y A;  4XTW A;  5GAN 6;  2D9T A;  5J3B A;  1Y96 B;  4HCB A;  3FPU A;  1Q81 C;  4J6W A;  3QWZ A;  5FU7 C;  1WJS A;  5FTJ A;  2MM0 A;  1K9M C;  3WVE B;  3DB3 A;  5HK3 A;  2XG8 D;  3HRU A;  5DYI A;  2GCX A;  3RES A;  3NTH A;  3JCM V;  1ZQ1 A;  4L6V 5;  2DXC A;  1U1S A;  2RHI A;  2ZPH B;  3KUF A;  2R5M A;  2XIC A;  1YI2 T;  3X24 B;  3A8M B;  4C5H A;  4EDU A;  4M7A F;  4XAX B;  1S3S A;  3QO3 A;  3QKJ A;  4DOW A;  3SWN C;  1JBM A;  4J83 A;  4M78 F;  3N5B B;  3QC8 A;  3GP8 A;  5C1B A;  2GFA A;  2LQK A;  4M7A A;  3OS0 A;  1WGS A;  2JUF A;  3X25 B;  1G5V A;  5GAM f;  1M4Z A;  1JRI A;  5LJ5 e;  4L59 A;  2RJE A;  4MDW A;  2QQB A;  3LWH A;  5FTM A;  4C8Q G;  3LGA A;  2Q18 X;  3QJY A;  3HU3 A;  3OW2 S;  3UDC A;  2L8D A;  1NJI C;  1JB0 E;  3ZFJ A;  3JB9 F;  5B6C A;  3PIO A;  3I55 A;  3OYG A;  1CZ4 A;  4RV0 A;  2BKD N;  3A5Z B;  4C5E A;  3JCM b;  4M77 G;  1M1F A;  4E7K A;  1K73 C;  3LHD A;  2QQ9 A;  4OMF B;  1QW1 A;  2KAF A;  4HKE A;  4N4G A;  5CVI A;  4C92 E;  1YHQ A;  5KE2 A;  1Q82 U;  2LX9 A;  2Y90 A;  3CCE T;  4M7D G;  2DZ9 A;  2E6Z A;  3QG1 A;  4MZT A;  5LJ3 h;  4CRI A;  2RHY A;  3HKS A;  3P8B B;  3MEU A;  4JRK A;  2ZPF B;  4RCC A;  2B8A A;  4KUD K;  3FRN A;  3M9Q A;  2B25 A;  2DO3 A;  1VQL T;  1X01 A;  3C95 A;  3Q1J A;  4J6X A;  4N0A C;  5LL6 S;  1Q86 C;  2RB6 A;  3G7Z A;  1Q86 U;  1B34 A;  4M7D A;  2Q1A X;  3DB4 A;  2D0Q B;  4ME7 A;  1KQ1 A;  3L42 A;  4C92 C;  4HCC A;  3C4S A;  2XID A;  1BIA A;  2HD0 A;  3LW5 E;  3MEV A;  3V8K A;  4C0F A;  4D6W A;  3CCU A;  5EPP A;  2PWY A;  2IVW A;  4EMK A;  4XK8 E;  1D3B A;  2E70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...