5D6WA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 23
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6wA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6wA02
4E7LA 2L89A 5KE3A 4ZTJA 4IKFA 2GF7A 4LD6A 2BKDN 3OYNA 4BDYA 3L2UA 2K3YA 2X4XA 4E7HA 4IUQA 2XDPA 2RI5A 3LYIA 2RHIA 5FRMA 1N27A 2PQWA 3L2QA 2RJCA 3OYKA 2RJFA 4RG2A 4BE1A 4OVAA 2QQSA 2RHYA 1WGSA 2RO0A 3PMIA 3GOXA 1SSFA 3H6ZA 1WJRA 3OQ5A 1OZ3A 3PNWC 3DB3A 3MP1A 5J26A 3OS0A 3OYFA 3EAEA 3NTHA 3H8ZA 3ME9A 4FU6A 2EKOA 3PMTA 4II1A 4A4EA 3ASKA 2M0OA 2G3RA 2DAQA 2L3RA 3KUFA 3LH0A 3OYLA 3S3MA 3NTKA 1H3ZA 2L8DA 5FROA 2MWOA 3MEAA 5J39A 1RI0A 3L2WA 4E7JA 4IUVA 2LCCA 2R57A 2NLUA 4PLIA 4L59A 3OYJA 4BACA 2X4WA 4A4HA 2P0KA 3F70A 2GFAA 2RI3A 3OYDA 2LDMA 5CIUA 2WACA 3S3OA 2EQJA 3CEYA 3MEVA 4C5EA 4N4IA 1OYXA 2RHZA 2LTOA 4QQ6A 4IUTA 3FDRA 4BDZA 4IURA 3MEWA 2CKKA 2JTFA 3MEUA 5D6XA 3SD4A 3OYCA 1OZ2A 3P8HA 3L42A 2M16A 3OYGA 2YRVA 4CRIA 3LGLA 3OYBA 3S3NA 3DLMA 1G5VA 4IUUA 2GFUA 2EFIA 3OYEA 3UWNA 3FLGA 2HQEA 2LVMA 3LGFA 3OYAA 4HCZA 2EQUA 4PLLA 2E6NA 4C5HA 2LRQA 4B9WA 2E5QA 3QJ6A 3MO8A 4E7IA 4A4GA 4Z02A 4FL6A 5D6YA 2XK0A 2QQRA 3QBYA 1KHCA 1OI1A 2R58A 5D6WA 4A4FA 2RI2A 4PL6A 3M9QA 2MWPA 3BDLA 4BD3A 1XNIA 3OMCA 2VYTA 3OA6A 2IG0A 2BUDA 5C0MA 5KH6A 3OY9A 3OYIA 5KE2A 2DIQA 2X35A 4C5IA 2RHXA 5C6SA 4GY5A 4IUPA 3OS2A 2RHUA 3DB4A 4EDUA 2RJEA 3FC3A 3P8DA 1WJSA 4X34A 1MHNA 3NTIA 3L2RA 1WJQA 4BE2A 2R5MA 2EQKA 2F5KA 2M1HA 3LX7A 4QQGA 5IN1A 5KCHA 3OYHA 3META 3MP6A 2HQXA 3UT1A 4B9XA 3MP8A 2B8AA 3FEOA 4UC4A 2EQMA 4ZTFA 3LLRA 3E9FA 4N4HA 2D9TA 5IAYA 4E7KA 3QIIA 2DIGA 3ZEHA 3L2VA 3QKJA 4BE0A 2JZ2A 4QW2A 3E9GA 3OS1A 2O4XB 5KCOA 4QVZA 3OB9A 2O4XA 2BIVA 2X4YA 4QQDA 3O8VA 3PFSA 2RJDA 3S6WA 2R5AA 4C5GA 5M9OA 4NS5A 5FRNA 3OYMA 3C4SA 3OMGA 3Q1JA 4Q5WA 2K3XA 4N4GA 2FHDA
chains in the Genus database with same CATH superfamily
2L89A 4M7AC 2VVKA 1YCSB 2NUTA 2V1QA 2RHIA 2Y4XA 4KO8A 1UJ0A 4RG2A 3JCMJ 1Q81R 4QT7A 4C8QC 2HSPA 2DA9A 2E3IA 3X26B 2JM8A 3OYFA 2M0YA 1ZX6A 4M78E 2V26A 4MZMA 1YNZA 2FG0A 5GAOr 5IXFA 1BIBA 2BZ8A 2QG9B 1VQ9A 4EMKA 1YCYA 3CCEQ 1YJ9Q 2EQJA 2NWMA 2LNHB 2LTOA 1MMDA 2EJGA 1B07A 3FDRA 3H41A 3GBQA 1VQOT 2PWYA 3C94A 5CKBA 5KYUB 5HK0A 2K9GA 1KHIA 1QVFA 2KBTA 3VV0A 1VQMT 2E6ZA 1I5OB 2KROA 3CC2Q 4AFZC 1Q7YC 3NGPA 4CC4B 4M77F 3TU4K 3CCUQ 4DEXA 2RI2A 2FEIA 1BKBA 2X35A 1P92A 1IXDA 2EYXA 5EG2A 2FVUA 3BDUA 1ZBXA 4YTLA 1RI9A 3JAME 3QYGB 3CCQA 1N5ZA 2ZZDA 3FPRA 4M77C 2VXFA 3CCSA 3LGAA 5FTJA 1UGSB 2YLCA 3M0SA 2KI7A 4M7AA 1QCSA 3UATA 2DJQA 1ZUKA 5AYFA 1WXUA 2K5FA 2K3YA 1WHGA 2XDPA 1Q81C 3CC4Q 1VQ6Q 3TSWA 3LW5E 2FPEA 1WGSA 1UUEA 2HSEB 1WJRA 2NUPB 1OZ3A 3A98A 1IB8A 2D8JA 2OX7A 4FW2A 3EGXB 1OX8A 1IGUA 3ER0A 1YI2Q 4RTZA 3JCMc 3OYLA 2HL5C 1RAGB 4ARIA 1ZLMA 3M0TA 4LN2A 4E47A 1BB9A 4XU1A 4A4HA 4M75E 3F70A 1V29B 5CIUA 3CXCS 3EGUA 2Q1CX 2FZKB 1PG5B 4F7UE 4QVDA 3JB9H 2P4RA 4E6RA 3OW2P 1Q81U 5GAMg 1TTHB 4M7AB 4GLMA 1PD0A 3CMAA 4JJDA 3G71Q 1WFWA 1HK9A 5FWBA 2HQHA 2LVMA 3LGFA 4WCIA 1O9SA 3EG2A 4BUGA 2QXFA 3GIBA 1Y71A 4LUEA 1OX9A 2QQRA 4Y92A 2R58A 4OGEA 1YHQA 1WHMA 1D09B 2K2VA 3DKMA 3VUBA 1X01A 3MKDA 5FU7B 1I1JA 4D8KA 2RHXA 1VQKT 3CCST 2JXBA 3VRYA 4EDUA 1AOJA 3VU3C 2KYMA 4J6WA 2YLBA 3CMAQ 2BTTA 4RTWA 1YP5A 2V8KA 2MF2A 5IAYA 3QWXX 2WSEE 2QDYB 3VYGA 8AT1B 4FT2A 2HBPA 1HYOA 2RF0A 3CCJA 3UF4A 3RMQA 4ZGDB 4M7AG 1I9GA 4JJCA 2JN0A 2LJ3A 2CGHA 1M5Q1 3M5AA 4E7HA 2XIDA 2X4XA 2ROLA 5GANe 1M4ZA 5DLQE 3M4GA 1WIEA 5EPPA 3GPLA 3H6ZA 1NBEB 3I5SA 2HEQA 3CPWA 3X28B 1CKAA 3NTHA 4DA4A 4FU6A 1K73R 1M3CA 2H3JA 3QSUA 3S3MA 2DAQA 2F2XA 1OV3A 3CMET 2M51A 4KT0E 2KRMA 4OMPA 5GLFA 4BACA 1NZ9A 2EGAA 2K79A 3HPWA 2V8IA 4LDYA 1TG0A 4J9HA 3VUZA 2MM2A 4N4IA 4FT4A 4QQ6A 1AWXA 1VUBA 5GAMh 2DX1A 2ZPHB 1BBZA 2LCLA 4RCCA 4BY6B 2HD0A 2M16A 1VQ7Q 1X2QA 3LGLA 1YHQT 2FRWA 3A1PA 3RBBB 4R55A 1TUCA 2CP2A 2CS7A 2RN8A 1KD1C 6AT1B 2X51A 4XU2A 3OBWA 5KYXA 2EPDA 2VKNA 2VYTA 3OY9A 2RA2A 4WF2A 2DZ9A 2DE0X 1QLYA 1WJSA 2DXUA 2RQTA 1Y96A 4C92B 4M7DG 1WJQA 1VQNT 3I35A 1K9AA 4RTXA 1IHVA 3ZL7C 3PVQA 2KYBA 1C6VX 3CCJT 1M2VA 2QTXA 1X6GA 4F16A 3FPUA 1S3SA 4KH0B 2JZ2A 3I55Q 1FMWA 2HAXA 5LJ3j 1D3BA 5DYIA 2K5LA 3OYMA 1SKUB 4Q5WA 5KE3A 3CC7T 5IH2A 1RACB 8ATCB 4NOYA 5FRMA 3L2QA 5CKDA 1FX7A 3TQ7P 3CBPA 3CD6Q 3QJYA 4E2FB 5KYWB 3OQ5A 3PNWC 1CKBA 1YJNQ 2DM1A 3CPWP 5CD1A 3RNJA 3A8MB 5FTNA 3E19A 1GBQA 2EKHA 3ASKA 1X75C 1GL5A 4FSSA 4HT9A 3M58A 2AZSA 2RK1A 4N0AA 2NLUA 1WPYA 2JM9A 3ZJTA 4FW1A 4BB7A 4M75D 5GAOq 1Q86R 3RIRA 3CCEA 1M90U 3KXTA 3M57A 2OTLT 1O54A 3HFNA 1GCQA 1C0MA 1W4SA 3X24B 3CCUA 1YJWA 1KQ1A 5LL6S 3QWZA 1UECA 5CCAA 3J81E 1PRLC 1IREB 4OB3B 4MZPA 2CP3A 4PL6A 3CD6T 1OPLA 3UPUA 3MHXA 3OS2A 1QW1A 2RHUA 1VQ4A 5KYNA 5HY6A 3JRZA 1N8RR 1MMNA 1Y96B 4C92A 4BE2A 4KDLA 3G4ST 2F5KA 4PJNA 5KCHA 1G8XA 1WX6A 1R0BG 3MP8A 4PNOA 3TSZA 4ZTFA 3ZGZA 3P8BB 2J6OA 3EHRA 4JJBA 2OTLA 4LXCA 3HSBA 5GANh 2FL7A 3T9NA 2CDTA 4FYWB 2QASA 2KK4A 4JRPA 1ZA2B 4XTVA 2AIRB 2KSSA 1U3OA 4DBFA 3JB9F 3Q1JA 4CI0C 2DETA 3UDCA 4IIMA 2OTLQ 2BZYA 4OB0B 1N9SA 1ZSZA 4OF1A 3JCMg 4LUDA 3JCMQ 1K9MC 1QCNA 2PUOB 2ZPGB 1SSFA 1HSQA 2JOYA 4F7UA 2P0QA 4AFSC 4MDXA 3M4YA 1KQSA 2M0OA 3GNGA 2KT1A 1LCKA 1N6AA 1VQ8Q 3NTKA 5FROA 4PJOF 2JUFA 1WHLA 2V1RA 1UEBA 4AMCA 3G4SQ 2L5QA 2LDMA 3CPFA 4M78G 3EFOA 1RAAB 4BDZA 4JJNK 3CBMA 1RLQC 1RABB 1M1KC 5GMKm 2RQVA 2DVJA 2MYSA 5EC7A 1TWBA 2Q1DX 2EJ9A 5CO7A 3FJPA 1MMGA 2EAYA 4ZNXA 1K8AU 1I0CA 2CH4A 3VS0A 4C5HA 1YWOA 3MO8A 4E7IA 4A4GA 2DZCA 1JU5C 2J7IA 3JB9G 3CCRA 1G3TA 2IG0A 2BUDA 1M1KU 2ENMA 2PZ1A 1B34A 1I81A 3HU2A 4L5GA 4M7DE 1M2VB 1MNDA 2JNGA 1QCFA 3KFVA 5L8RE 1K1ZA 4FYYB 2FB7A 4M77E 3META 1I5LA 4C8QA 2XMFA 2B25A 3L2ZA 4C0DB 4OGCA 4FYXB 3OSVA 2EYWA 3OB9A 1XQHA 1X69A 4OB2B 5M9OA 1XJWB 2K3XA 4JS5A 5KYXB 4IKFA 2GF7A 2ROTA 2NUTB 2ZPIB 1AZGB 4XK8E 3RKWA 3LYIA 4R0KA 1N8RU 2PQWA 1YIJA 1AEYA 3TIWA 1JQQA 4HA8A 2LP5A 2FRYA 2DFUA 3C0CA 2KDSA 2OAWA 5LJ5d 4M75G 5CAIA 2FZCB 3ME9A 2CZ6B 5GAOm 1IHWA 2KQWA 3MEAA 3QHSA 2DXTA 4DBRA 1IZ6A 2LCCA 1BI2A 2P4TA 4L59A 3JB9I 2K6DA 1WHKA 4CC2A 3I5RA 2HDAA 1PHTA 3THKA 4M4ZA 2I0NA 2CT4A 5D6XA 3OYCA 3G6ET 1YJ9A 4LNPA 4FIBA 2JTEA 2GBQA 2P84A 5GMKh 3HHTB 4JLIA 1TSFA 3HU1A 2Y4YA 1QDNA 3CCRT 1ABOA 5KYYB 3DLLA 1H92A 1U1SA 2ZAEA 4Z02A 1VQ9T 2QEXA 2HNIA 1BI0A 5FU6B 3CC2A 3BDLA 1UGQB 1MV0B 2LQKA 2DIQA 1PM3A 5C6SA 3HFOA 2ED0A 3HRSA 2K5IA 3VS6A 3MP6A 1EX4A 2HQXA 3TREA 1K8AR 1VQOQ 3QUIA 1D3BB 1X43A 4EPCA 4C92F 4KUDK 2YDLA 3PTAA 2DEUA 2PU9B 1KC8U 2MI6A 3I56Q 2O4XA 2BIVA 1YWPA 4JDSA 1UGPB 3EFRA 1M1KR 3WXMB 3VKIA 4RCBA 2FHDA 4C0ZA 5A0GA 1PNJA 3NHNA 2ZPEB 1M1FA 2JW4A 4CC3A 3JCMd 3I56A 3NFCA 4C8QD 3OYKA 2A37A 5CKHA 1R77A 4DOVA 2D0NA 2DK3A 2DXCA 1D1AA 4L6V5 5GAOl 3GOXA 1VQ9Q 4M7AE 4B6MA 2LQWA 1VA7A 3DB3A 2VC8A 3OS0A 2GQVA 3BE3A 1T3SA 3EH2A 1VQOA 1VQ6A 9ATCB 2YWWA 1FYNA 1U8RA 1IGQA 1WQWA 4PJOE 1AWWA 2J6FA 4RUGA 2LQ8A 1KJWA 2A36A 2A7YA 2ATCB 4C5EA 2JS2A 2YUPA 2VWFA 1BCOA 3HTRA 3EGDB 1R0CB 3L42A 3MPUB 3RESA 4O6JA 2YRVA 3VYHB 3OYBA 1PSFA 3I56T 5CVIA 4LDUA 2YUNA 3A8HB 3JV3A 3CCQT 4ELZC 1PKTA 3PIOA 1SF9A 1KHCA 3SWNB 1X2KA 2EJFA 2KT8A 2DYBA 4KODA 1S72Q 4HCCA 1G3WA 1M30A 2MIOA 1VYVA 2LX9A 2VB6A 3V8KA 3FIFA 3EG9B 3FC3A 3P8DA 1LPLA 4M77D 1NYGA 3L2RA 3MCAB 3BQBA 4ORZA 2DMOA 2H3EB 1WYXA 3UT1A 3CCMT 4J9GA 4GLKA 3FRNA 5CK9A 1E6HA 3LLRA 1WXTA 1KQ2A 3M0QA 1NEBA 4ANJA 3G6EA 1YJ9T 4BE0A 2HMAA 5CQXA 4ARCA 2QA4Q 5GJWB 4J83A 4Z88A 1W2BS 2GQIA 5GMKl 4QVZA 2X4YA 4NS5A 4J8OA 2CP7A 3SEMA 3ZBDA 1WQ7A 1ZA1B 4LD6A 1Z9QA 4XU3A 1M8MA 2RI5A 2XDDA 1UGRB 3JCMf 1GBRA 3ZFJA 2RJCA 2EBPA 4O5VA 1YN8A 3CCQQ 3LHDA 2XICA 2WSFE 2RD1A 4KUIA 1KC8C 2I2LA 3CBOA 4RTUA 4J9IA 5KYWA 3SWNA 2DL7A 4C8QF 1ZHIA 3CMAT 2DBKA 2OJ2A 2V8JA 1T0HA 4RTTA 2DL3A 3QYHB 3SWNC 2GFAA 5GAMd 3SB2A 5GAMf 2AT1B 2K7AA 2YVLA 1SHFA 4C8QB 2AZVA 4EMKB 4GBQA 3EGDA 4RV0A 4IURA 3OSSC 3OYYA 2KAFA 2QA4T 4CRIA 2D6FA 4NL2A 2YUJA 2HQEA 1GRIA 2Z0WA 4DBHA 4HXJA 4PLLA 4A4KA 2PNIA 4Y91A 1W70A 4Y28E 1NJIR 4AQ7A 2L2PA 3FPTA 1LOJA 4PFZA 1VQ6T 4F7UF 2KY9A 2CH4W 2C0IA 3NMZC 4MMLA 4LD9K 1TUDA 3CXCP 5C18A 3V7RA 3J7AF 3DB4A 3V8LA 1QKXA 5B6CA 3G1JA 2RJEA 2F2WA 1NJIC 2JTMA 1YI2T 3JB9J 3RKYA 2AHJB 4D8DA 1E32A 2KEAA 1MNEA 3URGA 5GAOp 2JV2A 3IQLA 3L2VA 4C8QG 3E9GA 2C06A 1VQ7T 1QCOA 2MK5A 2ESWA 2MPXC 5GAN7 1YHQQ 2C0TA 4XAXB 4AT1B 1QQJA 4CQNA 3C4SA 2RMOA 3H9NA 4ZTJA 2PVGB 2BKDN 2D8HA 1JJ2P 5LJ3d 2DXBA 1BK2A 1EZZB 1AVZC 1G3SA 1K0XA 1QVFS 4OVAA 2PJHB 1YFNA 2LCSA 4ZGJB 4AFUC 2QQAA 5DY9A 2O2OA 1Y57A 3EFSA 4M7DB 2MM0A 3EHQA 1FMKA 2EKOA 4HVUA 1K9MU 2G3RA 2J06A 2MWOA 5FU7C 3L2WA 1R8OB 2BE7D 1VIFA 4M7DF 4PLIA 2F1LA 3OYJA 4PJOD 1Q82U 1VQ7A 2X4WA 3SDZA 3S3OA 2EGCA 3JCMX 3MEVA 4J5YA 2RHZA 4P5NA 1D1CA 1VQ8A 5DLOA 3CCLT 1V76A 1RUWA 1A0NB 1JXOA 1WI7A 3HL8A 1N9RA 4ME7A 2FZGB 2QGFB 2CSIA 3FLGA 1K73C 2LNVA 2EQUA 4DBQA 1VQ5Q 2C0OA 4A63B 3A5ZB 1QVGP 3JB9D 4QKUA 4FYVB 4JZ4A 1E7OA 1YJNT 1YJWQ 1M2OA 5ERGB 2VGNA 5ECAA 3J80E 1XNIA 1JXMA 5LJ3f 1KIKA 4C5IA 2LJ0A 4C92D 1YITQ 2O9SA 4OMQA 3QZ9B 4R56A 1WHHA 1R7RA 1U5SA 5FLXE 3OW2A 3CCLA 2B8AA 2HZYA 4E7KA 4MZTA 1SSHA 3M0PA 1M3AA 1RAFB 1OQKA 2EYYA 3QKJA 3EG0A 2KE9A 3LWHA 2FO0A 1UTIA 2COYA 3EG3A 5LJ5f 3VS7A 3M56A 3RKXA 3UA7A 1T0JA 1ZBJA 1UHFA 3GNFB 1FMVA 2CYZB 2XI9A 3O8VA 3PFSA 1AZEA 2LW6A 5GAN5 1GCPA 4HKEA 4AG2C 1ZSZB 2DRKA 1JEGA 2X4JA 5A0DA 2EQIA 1T3LA 3QQ8A 3PMIA 1K0SA 5GAMj 1PWTA 4JPBW 2NUPA 4JS4A 2OTJT 3MP1A 2ZCFB 2DNUA 1TXQA 2L3SA 1Q95G 2F5TX 1PSEA 4E7JA 4FCYA 2R57A 2OAUA 3RDVA 1VQNQ 3EG1A 3H0HA 4XU0A 1NG2A 2IPOB 2MCNA 2CKKA 5GAN3 3P8HA 1VQPA 3I55T 3CD6A 3M0RA 2DD5A 4PJOC 2A28A 4HCZA 4D6WA 1H3HA 1QWFA 2OTJA 4FL6A 5D6YA 3R6OA 1OU9A 1Q82R 2HBWA 1VQLA 4F14A 4BD3A 3OA6A 1M90C 4F7UB 4IUPA 1B7TA 2CSQA 3PVLA 1KQSP 1MGQA 4F04B 1GXIE 1MHNA 2COZA 4X9CA 4M75B 2O88A 2QK0A 2VXEA 3CCET 5IN1A 4HT8A 1ARKA 1AWJA 1XTDA 2JT4A 4FM4B 2EQMA 2QI2A 1QP2A 4N4HA 1PCXA 2XKOC 2J05A 2CREA 5KYUA 3OS1A 5LJ5g 2VUBA 1G3YA 1EIFA 1RLPC 4C92C 1S1NA 3G6EQ 1VQLQ 5LJ3e 2F2VA 4N4GA 4E7LA 1M1GA 1VQKA 1YJNA 4A54A 2RQRA 4EIKA 3BFMA 2CZ7B 1ZSZC 3HP9A 3G7ZA 2ZPBB 1ACMB 1VQMA 4M78D 5J26A 1YIJQ 1RAHB 4PK4A 5EQJB 2X9HA 3QZ5B 2KRSA 1RAIB 2GTJA 2RPNA 1RI0A 2QTVA 5CQYA 2G6FX 1VQPT 1UJYA 3JCMb 4OMFB 7AT1B 4BI4A 4BI3A 3MEWA 3ZJVA 1VQNA 2DLPA 3OYGA 4MMKA 3JCMV 4IUUA 3V8JA 3OYEA 2ED1A 2KXDA 4M7DC 2E12A 5GMKe 5GAN6 3CXCA 1U1TA 3QJ6A 1UDLA 4F17A 1OEBA 2W10A 1OU8A 2DEQA 1QVFP 3OMCA 1M27C 2J6KA 2YUOA 3V7CA 1QWEA 3REBB 2LT1A 4M75F 2CUBA 2QDLA 1SRMA 4X34A 3H0FA 2LQNA 2D0QB 3BY7A 5DM7R 4CC7A 4B9XA 3WVDB 4UC4A 2RQWA 4M75A 2GCXA 2O31A 3AHUA 1NEGA 1B3QA 2NYSA 4J7IA 5LJ3g 3CCVT 1C1AA 2PVOB 3G71T 1GFCA 2R5AA 5LJ5e 3QC8A 3CCRQ 2HCKA 2CP0A 3JCMh 4NL3A 4ESRA 1UHCA 3PE0A 4E7SA 5CKEA 1Q86C 1GCQC 1VQMQ 3NPFA 1TU0B 4JUVA 2A3LA 1JB0E 5FTLA 2RO0A 2HKNA 1VQKQ 4ZN1A 4M7AF 2PVDB 2CZ0B 3CCUT 3CCSQ 4M78F 3CC4A 1MMAA 2L3RA 2O01E 2K4YA 1O75A 2M02A 1WLFA 1CSKA 4IUVA 2LJ1A 1UFFA 4XTUA 2SEMA 1NJIU 4J9DA 5L23A 2CP5A 4FSXA 3MEUA 5DYGA 3A8OB 1WLPB 5GMKi 2CT3A 1KK7A 5IHNA 3QWYA 1E6GA 2RK2A 2EFIA 1ZC1A 4QVCA 4HVWA 3OYAA 2Q19X 2E6NA 1HD3A 1IRXA 2DTHA 2PUKB 3CC4T 5D6WA 2DTIA 3TEEA 1SRLA 5IT9E 4DEYA 3FJ5A 1QVGA 1M8VA 2KVQG 1D0ZA 1HXDA 2B86A 1CZ5A 1UB4A 1BYMA 1KD1U 1ZUYA 3HKSA 4KULA 3X25B 2YRDA 1SPKA 2A0FB 5IHKA 2R5MA 2EQKA 1SG5A 3OYHA 1H8KA 1TOVA 3CCVA 4KLNA 1WA7A 5GANf 2XHCA 2DBMA 3RR6A 1YITA 3JSCA 3ZEHA 1W6XA 2QAZA 2E64A 4XQ3A 1NPPA 1FWZA 2IVWA 1K73U 3SFMA 5GAN2 2D1XA 3CC2T 3OMGA 5KYYA 2KGTA 4X9DA 5A2QE 2EWNA 4C8QE 4PJMA 4DOWA 4J9BA 4BDYA 4IUQA 1Q86U 1JJ2A 4Z8AA 5GAMe 1VYTA 2E70A 1MUZA 4MDWA 3PGGA 3TVTA 4LDWA 2P0PA 1S72T 2YRCA 1M90R 4M78B 1D1BA 5C1BA 2W0ZA 4M7AD 5CCXA 1Q82C 5FW9A 3U23A 2EYQA 5GMKj 4OMOA 2XU8A 4RMOA 4OP0A 3JCMW 2ZGWA 2DKGA 3KUFA 3CF2A 2DL4A 2JMAA 1VYUA 2LC4A 1H3ZA 4JRKA 3VS1A 2FPDA 4OMNA 3VS3A 4M77G 1F1BB 1KFZA 4M77B 3N5BB 4C0GA 3CEYA 3E1SA 2E3HA 2LZ6B 2RH2A 2CUDA 1OZ2A 3ULRB 1VIEA 4KGVB 5GANd 1JRIA 3CMEA 5I22A 2PTKA 4HVVA 4RTYA 2DJZA 1Q7YU 4JLGA 4EMGA 4EMKC 1ZSGA 2E5QA 4OMMA 1WNLA 1OULA 3M55A 1G83A 3QBYA 1OI1A 5HK3A 4J9EA 3VRZA 2GGRA 4M78A 2DD4A 4C92G 2VASA 4BI8B 3C12A 5IXBA 3EFOB 2H8HA 1X27A 2AK5A 1YBYA 1BCMA 2MOXA 2HKQB 2RB6A 3QPHA 5FTKA 3LX7A 1G2BA 4KRTA 1VQ4Q 3CMEQ 3I9QA 3R6NA 3HU3A 3MB5A 3JCMe 4KBMB 2Y90A 5KCOA 2YXYA 3CCLQ 1CZ4A 2OI3A 1W2BA 1U06A 1KD1R 3QDFA 2E41A 3L2UA 1QP3A 2VGMA 2NUZA 1YI2A 2RJFA 1B34B 2CZ1B 5FU6C 3HRUA 2QQSA 3TCJA 4ZN3A 5I2MA 1RADB 1KG1A 2EW3A 1YJWT 2BE9B 1ABQA 1QMCA 1SEMA 3GLXA 3WVEB 4C0FA 4II1A 1AD5A 2QA4A 1RL2A 1LNXA 1W2BP 2ABLA 2O9VA 2QYZA 1BI1A 3QG1A 2DTOA 2P0KA 3OYDA 1X6OA 3GF5A 1VQ4T 2LT4A 4PJLA 3CCMQ 1KQSS 2DF6A 2AKLA 5FWCA 4HCBA 2BZXA 3SD4A 4XTXA 1N8RC 2XG8D 2DO3A 3DLMA 1G5VA 1W1FA 1OPKA 2YUQA 1CR5A 1WZOA 5FTMA 4WTOB 1S72A 4DQ2A 2KXCA 3EH1A 4A4FA 2DERA 1FXXA 3M9QA 1TS9A 3OYIA 1IO6A 4KGXB 3JCMP 2X3WD 2FYKA 1VQ8T 3V7SA 3C95A 1PRMC 3PIPA 2RNAA 2M9UA 4M7DD 1I8FA 4OMLA 3FEOA 1GFDA 2KMTA 2WSCE 5HCKA 2D9TA 1Q7YR 1J3TA 3RUXA 5A0LA 1Y7XA 2DPPB 5GAOn 4QW2A 5LJ5j 2QQ9A 2E5KA 1TH7A 3LWIA 2GTOA 2O4XB 5I2SA 2SRCA 2L0AA 2RJDA 2Q18X 4LE9A 2K3BA 4AFQC 3OBYA 5D7UA 3X20B 4PFOA 3M59A 1M3BA 3OYNA 1PC0A 1NE8A 4XTYA 4AG1C 4J9CA 4EMHA 3OW2S 2EYZA 1X6BA 4IIOA 4BE1A 2MMPA 1NM7A 1AT1B 1D0YA 2QQBA 2HL3A 2CP6A 2COWA 1NPRA 5LJ3h 1NLPC 2DL8A 2JS0A 2E10A 3D7SB 5J3BA 3EAEA 3BW1A 3PMTA 4V2SA 1BIAA 1Z9ZA 3CCJQ 2YHTA 2DILA 2WACA 1D0XA 2DVEA 3PT9A 1OYXA 3EG9A 4IUTA 3QQ7A 3M54A 3G71A 1K76A 1K8AC 5LJ5h 2VV5A 4Z89A 4RG8A 3G4SA 5GANg 4F7UG 5I11A 4M75C 3CCMA 3CC7Q 1AHJB 4J7FA 5I21A 2GFUA 3UWNA 2FPFA 3M53A 1V1CA 2RQUA 2Q1AX 2LRQA 4B9WA 3GP8A 4J6YA 2JMCA 1VOMA 2XK0A 1KC8R 5CKFA 2LMJA 1EFNA 4ATOA 5KH6A 2QEXQ 4C92E 5KE2A 3RMSA 4JRQA 3LH5A 2EIFA 4GY5A 1VQ5A 4PJOB 3H0IA 1YIJT 4PJOG 1UE9A 3OS5A 4KGZB 3NTIA 3UA6A 4PKCC 4KH1B 3VJPA 2DYIA 5HKCA 1ZQ1A 3REAB 3QIIA 2DIGA 2AKKA 2JVVA 5CCBA 3E2UA 4ZGEB 1RAEB 2XDBA 1HJDA 4JZ3A 4J9FA 2YSQA 3S6WA 4C5GA 1PD1A 1KSWA 2YT6A 1DJ7B 5GJVB 1Y0MA 4M78C 1AWOA 3HRTA 5GAN8 1NLOC 2QGGA 1N27A 4LDVA 4C0DC 5CR2A 1UGVA 1VQ5T 2RHYA 4AS1A 5GANj 1XOVA 2E1HA 1TUGB 2GNCA 4PJJA 4K11A 4OB1B 3INZA 3SHWA 3H8ZA 1H641 2L3PA 1WDXA 2E65A 2QEXT 1BI3A 4A4EA 1QVGS 3I55A 4KDIA 2E4HA 3LH0A 1JBMA 4M77A 1Y07A 2L8DA 1MV3A 4PFPA 3M0UA 4RKUE 5J39A 3EGXA 1YITT 1LVKA 3QXEB 2ECZA 2EVRA 1NYFA 1JO8A 2RI3A 1I07A 4RTVA 3L1AA 3ZJUA 1ZUUA 4XTZA 3QDRB 3RERA 1WHJA 2JTFA 4VUBA 1LJOA 1VQLT 2KNBB 5IHIA 3VS2A 2IIMA 3S3NA 3CCVQ 4ELYC 1K4US 1WXBA 1QVPA 1QKWA 3FB9A 3CQTA 4XTWA 3VS4A 4J6XA 4BY6C 1K9MR 4HCKA 4N0AC 3CC7A 2ZPFB 1SHGA 2MWPA 2RM4A 5C0MA 3QO3A 2F69A 4X1VA 2OTJQ 2A08A 3A8GB 5GAN4 2XD0A 2EGEA 4A53A 4TVRA 1UG1A 3AT1B 1VQPQ 1OOTA 2M1HA 5AT1B 1JJ2S 4QQGA 4PJOA 2K57A 1M9SA 2DRMA 4M7DA 2KRNA 3A8LB 1BU1A 3E9FA 4LDXA 2X3XD 3O5ZA 1PKSA 2MAMA 3KBGA 2L3QA 2LX7A 3MJXA 4JRIA 2JJ9A 4QQDA 1I4K1 3VS5A 2DL5A 4E7ZA 2KR3A 3CPWS 2K2MA 5FRNA
chains in the Genus database with same CATH topology
2L89A 4ZTJA 5A2QE 2PVGB 2BKDN 1N9SA 2EWNA 4OB0B 5LJ3d 4C8QE 4DOWA 4BDYA 4IUQA 1Q86U 1JJ2A 4CI0C 4M7AC 4OF1A 3JCMg 2DXBA 2RHIA 5GAMe 2E70A 2Y4XA 4KO8A 1G3SA 3JCMQ 4RG2A 1K9MC 4MDWA 1QVFS 3PGGA 4OVAA 4LDWA 2P0PA 2PUOB 2ZPGB 3JCMJ 1S72T 2PJHB 4M78B 1SSFA 4C8QC 4ZGJB 2JOYA 5C1BA 2QQAA 4F7UA 5DY9A 3EFSA 4M7AD 2P0QA 3X26B 3OYFA 1Q82C 4M7DB 5CCXA 2MM0A 2EKOA 4M78E 4MDXA 2EYQA 5GMKj 4RMOA 2XU8A 4MZMA 3M4YA 1K9MU 4OP0A 2M0OA 2G3RA 2ZGWA 2DKGA 3GNGA 3KUFA 3JCMW 5GAOr 1KQSA 3CF2A 1BIBA 1N6AA 2LC4A 1KC8U 3NTKA 1H3ZA 5FROA 1VQ9A 2MWOA 5FU7C 4PJOF 4JRKA 3L2WA 2JUFA 1R8OB 1YCYA 1VIFA 4EMKA 1UEBA 4M7DF 4PLIA 3OYJA 4PJOD 1Q82U 1VQ7A 2X4WA 4M77G 2L5QA 2LDMA 3CPFA 3SDZA 4M77B 3N5BB 4C0GA 3S3OA 2EQJA 3CEYA 3MEVA 4M78G 3E1SA 4J5YA 2RHZA 3JCMX 2LTOA 2EJGA 3FDRA 1VQOT 4P5NA 4BDZA 2RH2A 1VQ8A 5DLOA 2PWYA 3C94A 3CCLT 4JJNK 3CBMA 1OZ2A 5CKBA 1VIEA 1M1KC 5GMKm 5GANd 3HL8A 5HK0A 1N9RA 4ME7A 1JRIA 3CMEA 2Q1DX 2EJ9A 1KHIA 5CO7A 3FJPA 3FLGA 2EAYA 1K8AU 1QVFA 3VV0A 1VQMT 2E6ZA 1K73C 2LNVA 2DJZA 2EQUA 1Q7YU 4JLGA 4EMGA 4C5HA 4EMKC 1Q7YC 2E5QA 1WNLA 3A5ZB 3MO8A 4A4GA 4E7IA 3M55A 4M77F 3JB9D 3QBYA 1YJNT 2DZCA 1OI1A 3TU4K 5HK3A 5ERGB 3JB9G 2VGNA 2RI2A 3J80E 1XNIA 3CCRA 5LJ3f 1G3TA 2IG0A 2BUDA 4M78A 1M1KU 1BKBA 2DD4A 2X35A 1P92A 4C5IA 4C92G 4BI8B 3C12A 4C92D 1B34A 1I81A 2FVUA 4L5GA 1YBYA 5EG2A 3BDUA 4M7DE 1ZBXA 3HU2A 2JNGA 4YTLA 3QZ9B 2RB6A 3QPHA 3JAME 4R56A 1R7RA 5L8RE 5FTKA 3LX7A 3QYGB 3CCQA 2FB7A 4M77E 3META 5FLXE 2ZZDA 1I5LA 3OW2A 3CCLA 3FPRA 4C8QA 3HU3A 2B8AA 4M77C 2B25A 3MB5A 2VXFA 3JCMe 3CCSA 3LGAA 5FTJA 3L2ZA 4C0DB 4OGCA 1UGSB 4KBMB 4MZTA 4E7KA 2YLCA 3QKJA 3LWHA 4M7AA 2Y90A 3OSVA 5KCOA 3OB9A 5LJ5f 3M56A 3RKXA 1XQHA 3GNFB 4OB2B 2CYZB 2XI9A 3O8VA 3PFSA 1CZ4A 5M9OA 1QCSA 2LW6A 5AYFA 1W2BA 5GAN5 2K3XA 4HKEA 4JS5A 4IKFA 2GF7A 2E41A 2K3YA 2K5FA 2ZPIB 3L2UA 2XDPA 1QP3A 1Q81C 2VGMA 4XK8E 3RKWA 3LYIA 2X4JA 1N8RU 5A0DA 2PQWA 1YI2A 2RJFA 1YIJA 1B34B 2CZ1B 3TIWA 3LW5E 5FU6C 3QQ8A 3HRUA 2QQSA 3TCJA 1WGSA 4HA8A 4ZN3A 3PMIA 5I2MA 5GAMj 1WJRA 1OZ3A 1KG1A 4JS4A 1YJWT 2KDSA 2OTJT 3MP1A 2ZCFB 4M75G 5CAIA 5LJ5d 3ME9A 3GLXA 3WVEB 4C0FA 4II1A 3ER0A 2CZ6B 3JCMc 3OYLA 1RL2A 2QA4A 5GAOm 2F5TX 1LNXA 2KQWA 4ARIA 1PSEA 3MEAA 3QHSA 2DXTA 4E7JA 1IZ6A 2LCCA 4E47A 2R57A 1BI2A 2OAUA 1BI1A 2P4TA 4L59A 3JB9I 4XU1A 3QG1A 4M75E 2DTOA 2P0KA 1V29B 3F70A 4A4HA 3OYDA 5CIUA 1X6OA 3GF5A 3CXCS 1VQ4T 4XU0A 2Q1CX 2LT4A 1KQSS 4F7UE 4QVDA 2CKKA 4HCBA 3JB9H 5D6XA 3SD4A 5GAN3 3OYCA 4XTXA 3G6ET 3P8HA 1VQPA 1YJ9A 1N8RC 1Q81U 4FIBA 5GAMg 3I55T 3CD6A 4M7AB 2XG8D 3CMAA 5GMKh 2DO3A 3DLMA 3HHTB 4JLIA 1G5VA 2DD5A 3HU1A 1HK9A 2Y4YA 1QDNA 1CR5A 2LVMA 3LGFA 4PJOC 4HCZA 3CCRT 5FTMA 4D6WA 3DLLA 1O9SA 2OTJA 1U1SA 2QXFA 4BUGA 3GIBA 1Y71A 1S72A 4Z02A 4FL6A 5D6YA 1VQ9T 3R6OA 4DQ2A 2QEXA 2HNIA 2QQRA 1BI0A 2R58A 4OGEA 5FU6B 4A4FA 1YHQA 3CC2A 2K2VA 1FXXA 3DKMA 3BDLA 3M9QA 4BD3A 1VQLA 1UGQB 3VUBA 3OA6A 3OYIA 1X01A 2LQKA 5FU7B 2DIQA 1M90C 2RHXA 4F7UB 5C6SA 1VQKT 3JCMP 4IUPA 3HFOA 2FYKA 3HRSA 1VQ8T 3CCST 3V7SA 4EDUA 1MGQA 3C95A 1GXIE 1MHNA 3PIPA 3VU3C 4X9CA 4M75B 2VXEA 4J6WA 2K5IA 2M9UA 3CCET 5IN1A 4M7DD 1I8FA 3MP6A 2YLBA 2HQXA 4HT8A 3TREA 3FEOA 1XTDA 2KMTA 2MF2A 2EQMA 2QI2A 1QP2A 2V8KA 2WSCE 1D3BB 3QUIA 2XKOC 4FM4B 2D9TA 4N4HA 4C92F 3RUXA 4EPCA 5A0LA 2WSEE 2QDYB 4KUDK 1Y7XA 2DPPB 5GAOn 4QW2A 3VYGA 3PTAA 5LJ5j 3OS1A 2PU9B 2HBPA 1TH7A 2QQ9A 2VUBA 2MI6A 2O4XB 4FT2A 5LJ5g 1G3YA 1EIFA 2O4XA 5I2SA 2BIVA 3RMQA 4C92C 4JDSA 4ZGDB 2RJDA 2Q18X 5LJ3e 1UGPB 3EFRA 4M7AG 1I9GA 3WXMB 3VKIA 3OBYA 2JN0A 3X20B 4N4GA 2CGHA 2FHDA 4RCBA 4C0ZA 3M59A 1M1GA 1M5Q1 4E7LA 5A0GA 3M5AA 3OYNA 2ZPEB 4E7HA 2XIDA 2X4XA 1VQKA 1NE8A 1M1FA 4XTYA 5GANe 1M4ZA 1YJNA 4A54A 4EMHA 3NFCA 4C8QD 3JCMd 5CKHA 3OYKA 3I56A 5DLQE 4DOVA 4BE1A 3OW2S 3M4GA 2MMPA 2DK3A 2DXCA 5EPPA 2QQBA 3BFMA 4L6V5 2CZ7B 5GAOl 3GOXA 3GPLA 3HP9A 4M7AE 3H6ZA 3G7ZA 2ZPBB 1NPRA 5LJ3h 1VQMA 4M78D 3CPWA 3DB3A 2VC8A 3X28B 2E10A 2GQVA 5J26A 3OS0A 1VQOA 1VQ6A 5J3BA 3EAEA 3BW1A 3NTHA 4DA4A 4FU6A 1U8RA 3PMTA 2H3JA 1WQWA 1BIAA 3QSUA 4V2SA 5EQJB 3S3MA 2DAQA 3QZ5B 3CMET 4PJOE 5IAYA 1RI0A 4KT0E 2YHTA 2LQ8A 5CQYA 1VQPT 5GLFA 4BACA 1NZ9A 3HPWA 2A7YA 2V8IA 3JCMb 2WACA 4LDYA 2DVEA 4OMFB 3PT9A 4C5EA 3VUZA 2MM2A 4N4IA 1OYXA 4FT4A 4QQ6A 4BI4A 4IUTA 3QQ7A 4BI3A 1VUBA 3M54A 5GAMh 3MEWA 3G71A 1K8AC 3ZJVA 1VQNA 5LJ5h 2VV5A 3L42A 3RESA 2ZPHB 2LCLA 4RCCA 4O6JA 4BY6B 2HD0A 2M16A 4RG8A 3OYGA 2YRVA 3G4SA 5GANg 3LGLA 4MMKA 3VYHB 4M75C 4F7UG 1PSFA 1AHJB 3OYBA 4J7FA 3JCMV 5CVIA 3I56T 3CCMA 1YHQT 4IUUA 3V8JA 2GFUA 5I21A 3OYEA 3UWNA 4M7DC 3M53A 4LDUA 2E12A 5GMKe 3A8HB 5GAN6 4R55A 2Q1AX 2LRQA 4B9WA 3CXCA 4J6YA 1U1TA 3QJ6A 3GP8A 4ELZC 3CCQT 3PIOA 2CS7A 2XK0A 1KD1C 1KHCA 3SWNB 2EJFA 5CKFA 2DEQA 4XU2A 3OBWA 3OMCA 4KODA 2VYTA 4ATOA 5KH6A 3OY9A 2RA2A 4HCCA 4C92E 5KE2A 3RMSA 4JRQA 1G3WA 2EIFA 2DZ9A 4GY5A 4WF2A 2LX9A 3V7CA 3V8KA 1VQ5A 1YIJT 2LT1A 4M75F 4PJOB 3FIFA 4PJOG 3FC3A 3J7AF 3P8DA 1WJSA 2DXUA 3OS5A 1Y96A 3NTIA 4M77D 4X34A 4C92B 1WJQA 3L2RA 2D0QB 1VQNT 4M7DG 3MCAB 4PKCC 3BQBA 3VJPA 3BY7A 5HKCA 5DM7R 3CCJT 1ZQ1A 3UT1A 4B9XA 3CCMT 2QTXA 3WVDB 4GLKA 4UC4A 3FRNA 4M75A 5CK9A 3LLRA 1KQ2A 3FPUA 3QIIA 1S3SA 2DIGA 2GCXA 3G6EA 4BE0A 1YJ9T 2JZ2A 3AHUA 5CQXA 4ARCA 2HAXA 5LJ3j 2JVVA 4J83A 1W2BS 5CCBA 4ZGEB 5LJ3g 4J7IA 3CCVT 5GMKl 4QVZA 2PVOB 2XDBA 1D3BA 2X4YA 3G71T 5DYIA 3S6WA 4C5GA 2K5LA 2R5AA 5LJ5e 4NS5A 4J8OA 3QC8A 3OYMA 4Q5WA 5KE3A 3ZBDA 1WQ7A 3JCMh 4NL3A 3CC7T 4LD6A 1DJ7B 4M78C 4XU3A 5CKEA 2RI5A 3HRTA 5GAN8 2XDDA 1Q86C 4NOYA 5FRMA 1UGRB 3JCMf 1N27A 4LDVA 3L2QA 3ZFJA 2RJCA 5CKDA 4C0DC 1FX7A 4JUVA 5CR2A 2A3LA 4O5VA 1VQ5T 1JB0E 2RHYA 5FTLA 3CBPA 2RO0A 2XICA 3QJYA 1XOVA 2E1HA 5GANj 3LHDA 4AS1A 2WSFE 2RD1A 3OQ5A 3PNWC 4ZN1A 4M7AF 5CD1A 2PVDB 4KUIA 3A8MB 2CZ0B 4OB1B 3CCUT 4M78F 1KC8C 5FTNA 3INZA 2I2LA 3CBOA 3E19A 3H8ZA 3CC4A 1H641 2QEXT 2E65A 1BI3A 4A4EA 3ASKA 1QVGS 3I55A 1X75C 2L3RA 4KDIA 3LH0A 3SWNA 2O01E 2K4YA 4C8QF 1ZHIA 1JBMA 4M77A 1Y07A 3CMAT 2L8DA 1O75A 4HT9A 1WLFA 3M58A 4RKUE 5J39A 1YITT 4IUVA 2V8JA 2RK1A 2NLUA 4N0AA 1WPYA 3QXEB 3QYHB 4XTUA 3SWNC 2GFAA 2RI3A 5GAMd 3SB2A 5GAMf 3ZJTA 1NJIU 2YVLA 3L1AA 3ZJUA 4C8QB 4BB7A 4M75D 5GAOq 4EMKB 3RIRA 4XTZA 3QDRB 4RV0A 4IURA 4FSXA 2JTFA 3CCEA 3MEUA 4VUBA 3RERA 5DYGA 3OSSC 3OYYA 1LJOA 3A8OB 1M90U 1VQLT 3KXTA 3M57A 2KAFA 5GMKi 2QA4T 4CRIA 2D6FA 3S3NA 2OTLT 4ELYC 3HFNA 1O54A 4NL2A 1QVPA 1W4SA 3FB9A 2RK2A 2EFIA 4XTWA 4QVCA 1ZC1A 2HQEA 3X24B 4J6XA 4BY6C 3CCUA 2YUJA 1YJWA 3OYAA 1KQ1A 5LL6S 2Q19X 4PLLA 2E6NA 4A4KA 3QWZA 4Y91A 4N0AC 5CCAA 4Y28E 3CC7A 2DTHA 4AQ7A 2ZPFB 2PUKB 3CC4T 3J81E 5D6WA 2DTIA 1IREB 3FPTA 1LOJA 4OB3B 4MZPA 3TEEA 4PL6A 1VQ6T 3CCJA 2MWPA 4F7UF 2KY9A 2RM4A 5IT9E 3CD6T 4MMLA 5C0MA 4LD9K 3QO3A 1QVGA 1M8VA 2KVQG 1HXDA 2F69A 1CZ5A 3UPUA 1UB4A 3MHXA 3OS2A 1BYMA 1KD1U 3HKSA 5C18A 1QW1A 4KULA 2RHUA 3DB4A 3V7RA 3V8LA 3X25B 5HY6A 3A8GB 5GAN4 3JRZA 1VQ4A 2RJEA 4A53A 4TVRA 2XD0A 5B6CA 1NJIC 1Y96B 4C92A 4BE2A 4KDLA 2R5MA 2EQKA 2JTMA 2F5KA 2M1HA 3G4ST 1YI2T 4QQGA 1JJ2S 5KCHA 3OYHA 4PJOA 2K57A 3JB9J 1M9SA 3CCVA 4KLNA 3RKYA 3A8LB 3MP8A 5GANf 2AHJB 2XHCA 4PNOA 4M7DA 1YITA 1E32A 4ZTFA 3URGA 5GAOp 3P8BB 3E9FA 3JSCA 2JV2A 4LDXA 3ZGZA 3ZEHA 2OTLA 3HSBA 5GANh 2MAMA 3L2VA 4C8QG 3E9GA 2C06A 3KBGA 1VQ7T 2FL7A 3T9NA 2E64A 5GAN7 4JRIA 4XQ3A 2KK4A 1I4K1 4QQDA 4XAXB 1NPPA 4JRPA 1FWZA 2IVWA 1K73U 3LWIA 4XTVA 2KSSA 3SFMA 5GAN2 3CC2T 3JB9F 3C4SA 3OMGA 3Q1JA 3CPWS 4CQNA 3UDCA 5FRNA 4X9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7L A;  2L89 A;  5KE3 A;  4ZTJ A;  4IKF A;  2GF7 A;  4LD6 A;  2BKD N;  3OYN A;  4BDY A;  3L2U A;  2K3Y A;  2X4X A;  4E7H A;  4IUQ A;  2XDP A;  2RI5 A;  3LYI A;  2RHI A;  5FRM A;  1N27 A;  2PQW A;  3L2Q A;  2RJC A;  3OYK A;  2RJF A;  4RG2 A;  4BE1 A;  4OVA A;  2QQS A;  2RHY A;  1WGS A;  2RO0 A;  3PMI A;  3GOX A;  1SSF A;  3H6Z A;  1WJR A;  3OQ5 A;  1OZ3 A;  3PNW C;  3DB3 A;  3MP1 A;  5J26 A;  3OS0 A;  3OYF A;  3EAE A;  3NTH A;  3H8Z A;  3ME9 A;  4FU6 A;  2EKO A;  3PMT A;  4II1 A;  4A4E A;  3ASK A;  2M0O A;  2G3R A;  2DAQ A;  2L3R A;  3KUF A;  3LH0 A;  3OYL A;  3S3M A;  3NTK A;  1H3Z A;  2L8D A;  5FRO A;  2MWO A;  3MEA A;  5J39 A;  1RI0 A;  3L2W A;  4E7J A;  4IUV A;  2LCC A;  2R57 A;  2NLU A;  4PLI A;  4L59 A;  3OYJ A;  4BAC A;  2X4W A;  4A4H A;  2P0K A;  3F70 A;  2GFA A;  2RI3 A;  3OYD A;  2LDM A;  5CIU A;  2WAC A;  3S3O A;  2EQJ A;  3CEY A;  3MEV A;  4C5E A;  4N4I A;  1OYX A;  2RHZ A;  2LTO A;  4QQ6 A;  4IUT A;  3FDR A;  4BDZ A;  4IUR A;  3MEW A;  2CKK A;  2JTF A;  3MEU A;  5D6X A;  3SD4 A;  3OYC A;  1OZ2 A;  3P8H A;  3L42 A;  2M16 A;  3OYG A;  2YRV A;  4CRI A;  3LGL A;  3OYB A;  3S3N A;  3DLM A;  1G5V A;  4IUU A;  2GFU A;  2EFI A;  3OYE A;  3UWN A;  3FLG A;  2HQE A;  2LVM A;  3LGF A;  3OYA A;  4HCZ A;  2EQU A;  4PLL A;  2E6N A;  4C5H A;  2LRQ A;  4B9W A;  2E5Q A;  3QJ6 A;  3MO8 A;  4E7I A;  4A4G A;  4Z02 A;  4FL6 A;  5D6Y A;  2XK0 A;  2QQR A;  3QBY A;  1KHC A;  1OI1 A;  2R58 A;  5D6W A;  4A4F A;  2RI2 A;  4PL6 A;  3M9Q A;  2MWP A;  3BDL A;  4BD3 A;  1XNI A;  3OMC A;  2VYT A;  3OA6 A;  2IG0 A;  2BUD A;  5C0M A;  5KH6 A;  3OY9 A;  3OYI A;  5KE2 A;  2DIQ A;  2X35 A;  4C5I A;  2RHX A;  5C6S A;  4GY5 A;  4IUP A;  3OS2 A;  2RHU A;  3DB4 A;  4EDU A;  2RJE A;  3FC3 A;  3P8D A;  1WJS A;  4X34 A;  1MHN A;  3NTI A;  3L2R A;  1WJQ A;  4BE2 A;  2R5M A;  2EQK A;  2F5K A;  2M1H A;  3LX7 A;  4QQG A;  5IN1 A;  5KCH A;  3OYH A;  3MET A;  3MP6 A;  2HQX A;  3UT1 A;  4B9X A;  3MP8 A;  2B8A A;  3FEO A;  4UC4 A;  2EQM A;  4ZTF A;  3LLR A;  3E9F A;  4N4H A;  2D9T A;  5IAY A;  4E7K A;  3QII A;  2DIG A;  3ZEH A;  3L2V A;  3QKJ A;  4BE0 A;  2JZ2 A;  4QW2 A;  3E9G A;  3OS1 A;  2O4X B;  5KCO A;  4QVZ A;  3OB9 A;  2O4X A;  2BIV A;  2X4Y A;  4QQD A;  3O8V A;  3PFS A;  2RJD A;  3S6W A;  2R5A A;  4C5G A;  5M9O A;  4NS5 A;  5FRN A;  3OYM A;  3C4S A;  3OMG A;  3Q1J A;  4Q5W A;  2K3X A;  4N4G A;  2FHD A; 
#chains in the Genus database with same CATH topology
 2L89 A;  4M7A C;  2VVK A;  1YCS B;  2NUT A;  2V1Q A;  2RHI A;  2Y4X A;  4KO8 A;  1UJ0 A;  4RG2 A;  3JCM J;  1Q81 R;  4QT7 A;  4C8Q C;  2HSP A;  2DA9 A;  2E3I A;  3X26 B;  2JM8 A;  3OYF A;  2M0Y A;  1ZX6 A;  4M78 E;  2V26 A;  4MZM A;  1YNZ A;  2FG0 A;  5GAO r;  5IXF A;  1BIB A;  2BZ8 A;  2QG9 B;  1VQ9 A;  4EMK A;  1YCY A;  3CCE Q;  1YJ9 Q;  2EQJ A;  2NWM A;  2LNH B;  2LTO A;  1MMD A;  2EJG A;  1B07 A;  3FDR A;  3H41 A;  3GBQ A;  1VQO T;  2PWY A;  3C94 A;  5CKB A;  5KYU B;  5HK0 A;  2K9G A;  1KHI A;  1QVF A;  2KBT A;  3VV0 A;  1VQM T;  2E6Z A;  1I5O B;  2KRO A;  3CC2 Q;  4AFZ C;  1Q7Y C;  3NGP A;  4CC4 B;  4M77 F;  3TU4 K;  3CCU Q;  4DEX A;  2RI2 A;  2FEI A;  1BKB A;  2X35 A;  1P92 A;  1IXD A;  2EYX A;  5EG2 A;  2FVU A;  3BDU A;  1ZBX A;  4YTL A;  1RI9 A;  3JAM E;  3QYG B;  3CCQ A;  1N5Z A;  2ZZD A;  3FPR A;  4M77 C;  2VXF A;  3CCS A;  3LGA A;  5FTJ A;  1UGS B;  2YLC A;  3M0S A;  2KI7 A;  4M7A A;  1QCS A;  3UAT A;  2DJQ A;  1ZUK A;  5AYF A;  1WXU A;  2K5F A;  2K3Y A;  1WHG A;  2XDP A;  1Q81 C;  3CC4 Q;  1VQ6 Q;  3TSW A;  3LW5 E;  2FPE A;  1WGS A;  1UUE A;  2HSE B;  1WJR A;  2NUP B;  1OZ3 A;  3A98 A;  1IB8 A;  2D8J A;  2OX7 A;  4FW2 A;  3EGX B;  1OX8 A;  1IGU A;  3ER0 A;  1YI2 Q;  4RTZ A;  3JCM c;  3OYL A;  2HL5 C;  1RAG B;  4ARI A;  1ZLM A;  3M0T A;  4LN2 A;  4E47 A;  1BB9 A;  4XU1 A;  4A4H A;  4M75 E;  3F70 A;  1V29 B;  5CIU A;  3CXC S;  3EGU A;  2Q1C X;  2FZK B;  1PG5 B;  4F7U E;  4QVD A;  3JB9 H;  2P4R A;  4E6R A;  3OW2 P;  1Q81 U;  5GAM g;  1TTH B;  4M7A B;  4GLM A;  1PD0 A;  3CMA A;  4JJD A;  3G71 Q;  1WFW A;  1HK9 A;  5FWB A;  2HQH A;  2LVM A;  3LGF A;  4WCI A;  1O9S A;  3EG2 A;  4BUG A;  2QXF A;  3GIB A;  1Y71 A;  4LUE A;  1OX9 A;  2QQR A;  4Y92 A;  2R58 A;  4OGE A;  1YHQ A;  1WHM A;  1D09 B;  2K2V A;  3DKM A;  3VUB A;  1X01 A;  3MKD A;  5FU7 B;  1I1J A;  4D8K A;  2RHX A;  1VQK T;  3CCS T;  2JXB A;  3VRY A;  4EDU A;  1AOJ A;  3VU3 C;  2KYM A;  4J6W A;  2YLB A;  3CMA Q;  2BTT A;  4RTW A;  1YP5 A;  2V8K A;  2MF2 A;  5IAY A;  3QWX X;  2WSE E;  2QDY B;  3VYG A;  8AT1 B;  4FT2 A;  2HBP A;  1HYO A;  2RF0 A;  3CCJ A;  3UF4 A;  3RMQ A;  4ZGD B;  4M7A G;  1I9G A;  4JJC A;  2JN0 A;  2LJ3 A;  2CGH A;  1M5Q 1;  3M5A A;  4E7H A;  2XID A;  2X4X A;  2ROL A;  5GAN e;  1M4Z A;  5DLQ E;  3M4G A;  1WIE A;  5EPP A;  3GPL A;  3H6Z A;  1NBE B;  3I5S A;  2HEQ A;  3CPW A;  3X28 B;  1CKA A;  3NTH A;  4DA4 A;  4FU6 A;  1K73 R;  1M3C A;  2H3J A;  3QSU A;  3S3M A;  2DAQ A;  2F2X A;  1OV3 A;  3CME T;  2M51 A;  4KT0 E;  2KRM A;  4OMP A;  5GLF A;  4BAC A;  1NZ9 A;  2EGA A;  2K79 A;  3HPW A;  2V8I A;  4LDY A;  1TG0 A;  4J9H A;  3VUZ A;  2MM2 A;  4N4I A;  4FT4 A;  4QQ6 A;  1AWX A;  1VUB A;  5GAM h;  2DX1 A;  2ZPH B;  1BBZ A;  2LCL A;  4RCC A;  4BY6 B;  2HD0 A;  2M16 A;  1VQ7 Q;  1X2Q A;  3LGL A;  1YHQ T;  2FRW A;  3A1P A;  3RBB B;  4R55 A;  1TUC A;  2CP2 A;  2CS7 A;  2RN8 A;  1KD1 C;  6AT1 B;  2X51 A;  4XU2 A;  3OBW A;  5KYX A;  2EPD A;  2VKN A;  2VYT A;  3OY9 A;  2RA2 A;  4WF2 A;  2DZ9 A;  2DE0 X;  1QLY A;  1WJS A;  2DXU A;  2RQT A;  1Y96 A;  4C92 B;  4M7D G;  1WJQ A;  1VQN T;  3I35 A;  1K9A A;  4RTX A;  1IHV A;  3ZL7 C;  3PVQ A;  2KYB A;  1C6V X;  3CCJ T;  1M2V A;  2QTX A;  1X6G A;  4F16 A;  3FPU A;  1S3S A;  4KH0 B;  2JZ2 A;  3I55 Q;  1FMW A;  2HAX A;  5LJ3 j;  1D3B A;  5DYI A;  2K5L A;  3OYM A;  1SKU B;  4Q5W A;  5KE3 A;  3CC7 T;  5IH2 A;  1RAC B;  8ATC B;  4NOY A;  5FRM A;  3L2Q A;  5CKD A;  1FX7 A;  3TQ7 P;  3CBP A;  3CD6 Q;  3QJY A;  4E2F B;  5KYW B;  3OQ5 A;  3PNW C;  1CKB A;  1YJN Q;  2DM1 A;  3CPW P;  5CD1 A;  3RNJ A;  3A8M B;  5FTN A;  3E19 A;  1GBQ A;  2EKH A;  3ASK A;  1X75 C;  1GL5 A;  4FSS A;  4HT9 A;  3M58 A;  2AZS A;  2RK1 A;  4N0A A;  2NLU A;  1WPY A;  2JM9 A;  3ZJT A;  4FW1 A;  4BB7 A;  4M75 D;  5GAO q;  1Q86 R;  3RIR A;  3CCE A;  1M90 U;  3KXT A;  3M57 A;  2OTL T;  1O54 A;  3HFN A;  1GCQ A;  1C0M A;  1W4S A;  3X24 B;  3CCU A;  1YJW A;  1KQ1 A;  5LL6 S;  3QWZ A;  1UEC A;  5CCA A;  3J81 E;  1PRL C;  1IRE B;  4OB3 B;  4MZP A;  2CP3 A;  4PL6 A;  3CD6 T;  1OPL A;  3UPU A;  3MHX A;  3OS2 A;  1QW1 A;  2RHU A;  1VQ4 A;  5KYN A;  5HY6 A;  3JRZ A;  1N8R R;  1MMN A;  1Y96 B;  4C92 A;  4BE2 A;  4KDL A;  3G4S T;  2F5K A;  4PJN A;  5KCH A;  1G8X A;  1WX6 A;  1R0B G;  3MP8 A;  4PNO A;  3TSZ A;  4ZTF A;  3ZGZ A;  3P8B B;  2J6O A;  3EHR A;  4JJB A;  2OTL A;  4LXC A;  3HSB A;  5GAN h;  2FL7 A;  3T9N A;  2CDT A;  4FYW B;  2QAS A;  2KK4 A;  4JRP A;  1ZA2 B;  4XTV A;  2AIR B;  2KSS A;  1U3O A;  4DBF A;  3JB9 F;  3Q1J A;  4CI0 C;  2DET A;  3UDC A;  4IIM A;  2OTL Q;  2BZY A;  4OB0 B;  1N9S A;  1ZSZ A;  4OF1 A;  3JCM g;  4LUD A;  3JCM Q;  1K9M C;  1QCN A;  2PUO B;  2ZPG B;  1SSF A;  1HSQ A;  2JOY A;  4F7U A;  2P0Q A;  4AFS C;  4MDX A;  3M4Y A;  1KQS A;  2M0O A;  3GNG A;  2KT1 A;  1LCK A;  1N6A A;  1VQ8 Q;  3NTK A;  5FRO A;  4PJO F;  2JUF A;  1WHL A;  2V1R A;  1UEB A;  4AMC A;  3G4S Q;  2L5Q A;  2LDM A;  3CPF A;  4M78 G;  3EFO A;  1RAA B;  4BDZ A;  4JJN K;  3CBM A;  1RLQ C;  1RAB B;  1M1K C;  5GMK m;  2RQV A;  2DVJ A;  2MYS A;  5EC7 A;  1TWB A;  2Q1D X;  2EJ9 A;  5CO7 A;  3FJP A;  1MMG A;  2EAY A;  4ZNX A;  1K8A U;  1I0C A;  2CH4 A;  3VS0 A;  4C5H A;  1YWO A;  3MO8 A;  4E7I A;  4A4G A;  2DZC A;  1JU5 C;  2J7I A;  3JB9 G;  3CCR A;  1G3T A;  2IG0 A;  2BUD A;  1M1K U;  2ENM A;  2PZ1 A;  1B34 A;  1I81 A;  3HU2 A;  4L5G A;  4M7D E;  1M2V B;  1MND A;  2JNG A;  1QCF A;  3KFV A;  5L8R E;  1K1Z A;  4FYY B;  2FB7 A;  4M77 E;  3MET A;  1I5L A;  4C8Q A;  2XMF A;  2B25 A;  3L2Z A;  4C0D B;  4OGC A;  4FYX B;  3OSV A;  2EYW A;  3OB9 A;  1XQH A;  1X69 A;  4OB2 B;  5M9O A;  1XJW B;  2K3X A;  4JS5 A;  5KYX B;  4IKF A;  2GF7 A;  2ROT A;  2NUT B;  2ZPI B;  1AZG B;  4XK8 E;  3RKW A;  3LYI A;  4R0K A;  1N8R U;  2PQW A;  1YIJ A;  1AEY A;  3TIW A;  1JQQ A;  4HA8 A;  2LP5 A;  2FRY A;  2DFU A;  3C0C A;  2KDS A;  2OAW A;  5LJ5 d;  4M75 G;  5CAI A;  2FZC B;  3ME9 A;  2CZ6 B;  5GAO m;  1IHW A;  2KQW A;  3MEA A;  3QHS A;  2DXT A;  4DBR A;  1IZ6 A;  2LCC A;  1BI2 A;  2P4T A;  4L59 A;  3JB9 I;  2K6D A;  1WHK A;  4CC2 A;  3I5R A;  2HDA A;  1PHT A;  3THK A;  4M4Z A;  2I0N A;  2CT4 A;  5D6X A;  3OYC A;  3G6E T;  1YJ9 A;  4LNP A;  4FIB A;  2JTE A;  2GBQ A;  2P84 A;  5GMK h;  3HHT B;  4JLI A;  1TSF A;  3HU1 A;  2Y4Y A;  1QDN A;  3CCR T;  1ABO A;  5KYY B;  3DLL A;  1H92 A;  1U1S A;  2ZAE A;  4Z02 A;  1VQ9 T;  2QEX A;  2HNI A;  1BI0 A;  5FU6 B;  3CC2 A;  3BDL A;  1UGQ B;  1MV0 B;  2LQK A;  2DIQ A;  1PM3 A;  5C6S A;  3HFO A;  2ED0 A;  3HRS A;  2K5I A;  3VS6 A;  3MP6 A;  1EX4 A;  2HQX A;  3TRE A;  1K8A R;  1VQO Q;  3QUI A;  1D3B B;  1X43 A;  4EPC A;  4C92 F;  4KUD K;  2YDL A;  3PTA A;  2DEU A;  2PU9 B;  1KC8 U;  2MI6 A;  3I56 Q;  2O4X A;  2BIV A;  1YWP A;  4JDS A;  1UGP B;  3EFR A;  1M1K R;  3WXM B;  3VKI A;  4RCB A;  2FHD A;  4C0Z A;  5A0G A;  1PNJ A;  3NHN A;  2ZPE B;  1M1F A;  2JW4 A;  4CC3 A;  3JCM d;  3I56 A;  3NFC A;  4C8Q D;  3OYK A;  2A37 A;  5CKH A;  1R77 A;  4DOV A;  2D0N A;  2DK3 A;  2DXC A;  1D1A A;  4L6V 5;  5GAO l;  3GOX A;  1VQ9 Q;  4M7A E;  4B6M A;  2LQW A;  1VA7 A;  3DB3 A;  2VC8 A;  3OS0 A;  2GQV A;  3BE3 A;  1T3S A;  3EH2 A;  1VQO A;  1VQ6 A;  9ATC B;  2YWW A;  1FYN A;  1U8R A;  1IGQ A;  1WQW A;  4PJO E;  1AWW A;  2J6F A;  4RUG A;  2LQ8 A;  1KJW A;  2A36 A;  2A7Y A;  2ATC B;  4C5E A;  2JS2 A;  2YUP A;  2VWF A;  1BCO A;  3HTR A;  3EGD B;  1R0C B;  3L42 A;  3MPU B;  3RES A;  4O6J A;  2YRV A;  3VYH B;  3OYB A;  1PSF A;  3I56 T;  5CVI A;  4LDU A;  2YUN A;  3A8H B;  3JV3 A;  3CCQ T;  4ELZ C;  1PKT A;  3PIO A;  1SF9 A;  1KHC A;  3SWN B;  1X2K A;  2EJF A;  2KT8 A;  2DYB A;  4KOD A;  1S72 Q;  4HCC A;  1G3W A;  1M30 A;  2MIO A;  1VYV A;  2LX9 A;  2VB6 A;  3V8K A;  3FIF A;  3EG9 B;  3FC3 A;  3P8D A;  1LPL A;  4M77 D;  1NYG A;  3L2R A;  3MCA B;  3BQB A;  4ORZ A;  2DMO A;  2H3E B;  1WYX A;  3UT1 A;  3CCM T;  4J9G A;  4GLK A;  3FRN A;  5CK9 A;  1E6H A;  3LLR A;  1WXT A;  1KQ2 A;  3M0Q A;  1NEB A;  4ANJ A;  3G6E A;  1YJ9 T;  4BE0 A;  2HMA A;  5CQX A;  4ARC A;  2QA4 Q;  5GJW B;  4J83 A;  4Z88 A;  1W2B S;  2GQI A;  5GMK l;  4QVZ A;  2X4Y A;  4NS5 A;  4J8O A;  2CP7 A;  3SEM A;  3ZBD A;  1WQ7 A;  1ZA1 B;  4LD6 A;  1Z9Q A;  4XU3 A;  1M8M A;  2RI5 A;  2XDD A;  1UGR B;  3JCM f;  1GBR A;  3ZFJ A;  2RJC A;  2EBP A;  4O5V A;  1YN8 A;  3CCQ Q;  3LHD A;  2XIC A;  2WSF E;  2RD1 A;  4KUI A;  1KC8 C;  2I2L A;  3CBO A;  4RTU A;  4J9I A;  5KYW A;  3SWN A;  2DL7 A;  4C8Q F;  1ZHI A;  3CMA T;  2DBK A;  2OJ2 A;  2V8J A;  1T0H A;  4RTT A;  2DL3 A;  3QYH B;  3SWN C;  2GFA A;  5GAM d;  3SB2 A;  5GAM f;  2AT1 B;  2K7A A;  2YVL A;  1SHF A;  4C8Q B;  2AZV A;  4EMK B;  4GBQ A;  3EGD A;  4RV0 A;  4IUR A;  3OSS C;  3OYY A;  2KAF A;  2QA4 T;  4CRI A;  2D6F A;  4NL2 A;  2YUJ A;  2HQE A;  1GRI A;  2Z0W A;  4DBH A;  4HXJ A;  4PLL A;  4A4K A;  2PNI A;  4Y91 A;  1W70 A;  4Y28 E;  1NJI R;  4AQ7 A;  2L2P A;  3FPT A;  1LOJ A;  4PFZ A;  1VQ6 T;  4F7U F;  2KY9 A;  2CH4 W;  2C0I A;  3NMZ C;  4MML A;  4LD9 K;  1TUD A;  3CXC P;  5C18 A;  3V7R A;  3J7A F;  3DB4 A;  3V8L A;  1QKX A;  5B6C A;  3G1J A;  2RJE A;  2F2W A;  1NJI C;  2JTM A;  1YI2 T;  3JB9 J;  3RKY A;  2AHJ B;  4D8D A;  1E32 A;  2KEA A;  1MNE A;  3URG A;  5GAO p;  2JV2 A;  3IQL A;  3L2V A;  4C8Q G;  3E9G A;  2C06 A;  1VQ7 T;  1QCO A;  2MK5 A;  2ESW A;  2MPX C;  5GAN 7;  1YHQ Q;  2C0T A;  4XAX B;  4AT1 B;  1QQJ A;  4CQN A;  3C4S A;  2RMO A;  3H9N A;  4ZTJ A;  2PVG B;  2BKD N;  2D8H A;  1JJ2 P;  5LJ3 d;  2DXB A;  1BK2 A;  1EZZ B;  1AVZ C;  1G3S A;  1K0X A;  1QVF S;  4OVA A;  2PJH B;  1YFN A;  2LCS A;  4ZGJ B;  4AFU C;  2QQA A;  5DY9 A;  2O2O A;  1Y57 A;  3EFS A;  4M7D B;  2MM0 A;  3EHQ A;  1FMK A;  2EKO A;  4HVU A;  1K9M U;  2G3R A;  2J06 A;  2MWO A;  5FU7 C;  3L2W A;  1R8O B;  2BE7 D;  1VIF A;  4M7D F;  4PLI A;  2F1L A;  3OYJ A;  4PJO D;  1Q82 U;  1VQ7 A;  2X4W A;  3SDZ A;  3S3O A;  2EGC A;  3JCM X;  3MEV A;  4J5Y A;  2RHZ A;  4P5N A;  1D1C A;  1VQ8 A;  5DLO A;  3CCL T;  1V76 A;  1RUW A;  1A0N B;  1JXO A;  1WI7 A;  3HL8 A;  1N9R A;  4ME7 A;  2FZG B;  2QGF B;  2CSI A;  3FLG A;  1K73 C;  2LNV A;  2EQU A;  4DBQ A;  1VQ5 Q;  2C0O A;  4A63 B;  3A5Z B;  1QVG P;  3JB9 D;  4QKU A;  4FYV B;  4JZ4 A;  1E7O A;  1YJN T;  1YJW Q;  1M2O A;  5ERG B;  2VGN A;  5ECA A;  3J80 E;  1XNI A;  1JXM A;  5LJ3 f;  1KIK A;  4C5I A;  2LJ0 A;  4C92 D;  1YIT Q;  2O9S A;  4OMQ A;  3QZ9 B;  4R56 A;  1WHH A;  1R7R A;  1U5S A;  5FLX E;  3OW2 A;  3CCL A;  2B8A A;  2HZY A;  4E7K A;  4MZT A;  1SSH A;  3M0P A;  1M3A A;  1RAF B;  1OQK A;  2EYY A;  3QKJ A;  3EG0 A;  2KE9 A;  3LWH A;  2FO0 A;  1UTI A;  2COY A;  3EG3 A;  5LJ5 f;  3VS7 A;  3M56 A;  3RKX A;  3UA7 A;  1T0J A;  1ZBJ A;  1UHF A;  3GNF B;  1FMV A;  2CYZ B;  2XI9 A;  3O8V A;  3PFS A;  1AZE A;  2LW6 A;  5GAN 5;  1GCP A;  4HKE A;  4AG2 C;  1ZSZ B;  2DRK A;  1JEG A;  2X4J A;  5A0D A;  2EQI A;  1T3L A;  3QQ8 A;  3PMI A;  1K0S A;  5GAM j;  1PWT A;  4JPB W;  2NUP A;  4JS4 A;  2OTJ T;  3MP1 A;  2ZCF B;  2DNU A;  1TXQ A;  2L3S A;  1Q95 G;  2F5T X;  1PSE A;  4E7J A;  4FCY A;  2R57 A;  2OAU A;  3RDV A;  1VQN Q;  3EG1 A;  3H0H A;  4XU0 A;  1NG2 A;  2IPO B;  2MCN A;  2CKK A;  5GAN 3;  3P8H A;  1VQP A;  3I55 T;  3CD6 A;  3M0R A;  2DD5 A;  4PJO C;  2A28 A;  4HCZ A;  4D6W A;  1H3H A;  1QWF A;  2OTJ A;  4FL6 A;  5D6Y A;  3R6O A;  1OU9 A;  1Q82 R;  2HBW A;  1VQL A;  4F14 A;  4BD3 A;  3OA6 A;  1M90 C;  4F7U B;  4IUP A;  1B7T A;  2CSQ A;  3PVL A;  1KQS P;  1MGQ A;  4F04 B;  1GXI E;  1MHN A;  2COZ A;  4X9C A;  4M75 B;  2O88 A;  2QK0 A;  2VXE A;  3CCE T;  5IN1 A;  4HT8 A;  1ARK A;  1AWJ A;  1XTD A;  2JT4 A;  4FM4 B;  2EQM A;  2QI2 A;  1QP2 A;  4N4H A;  1PCX A;  2XKO C;  2J05 A;  2CRE A;  5KYU A;  3OS1 A;  5LJ5 g;  2VUB A;  1G3Y A;  1EIF A;  1RLP C;  4C92 C;  1S1N A;  3G6E Q;  1VQL Q;  5LJ3 e;  2F2V A;  4N4G A;  4E7L A;  1M1G A;  1VQK A;  1YJN A;  4A54 A;  2RQR A;  4EIK A;  3BFM A;  2CZ7 B;  1ZSZ C;  3HP9 A;  3G7Z A;  2ZPB B;  1ACM B;  1VQM A;  4M78 D;  5J26 A;  1YIJ Q;  1RAH B;  4PK4 A;  5EQJ B;  2X9H A;  3QZ5 B;  2KRS A;  1RAI B;  2GTJ A;  2RPN A;  1RI0 A;  2QTV A;  5CQY A;  2G6F X;  1VQP T;  1UJY A;  3JCM b;  4OMF B;  7AT1 B;  4BI4 A;  4BI3 A;  3MEW A;  3ZJV A;  1VQN A;  2DLP A;  3OYG A;  4MMK A;  3JCM V;  4IUU A;  3V8J A;  3OYE A;  2ED1 A;  2KXD A;  4M7D C;  2E12 A;  5GMK e;  5GAN 6;  3CXC A;  1U1T A;  3QJ6 A;  1UDL A;  4F17 A;  1OEB A;  2W10 A;  1OU8 A;  2DEQ A;  1QVF P;  3OMC A;  1M27 C;  2J6K A;  2YUO A;  3V7C A;  1QWE A;  3REB B;  2LT1 A;  4M75 F;  2CUB A;  2QDL A;  1SRM A;  4X34 A;  3H0F A;  2LQN A;  2D0Q B;  3BY7 A;  5DM7 R;  4CC7 A;  4B9X A;  3WVD B;  4UC4 A;  2RQW A;  4M75 A;  2GCX A;  2O31 A;  3AHU A;  1NEG A;  1B3Q A;  2NYS A;  4J7I A;  5LJ3 g;  3CCV T;  1C1A A;  2PVO B;  3G71 T;  1GFC A;  2R5A A;  5LJ5 e;  3QC8 A;  3CCR Q;  2HCK A;  2CP0 A;  3JCM h;  4NL3 A;  4ESR A;  1UHC A;  3PE0 A;  4E7S A;  5CKE A;  1Q86 C;  1GCQ C;  1VQM Q;  3NPF A;  1TU0 B;  4JUV A;  2A3L A;  1JB0 E;  5FTL A;  2RO0 A;  2HKN A;  1VQK Q;  4ZN1 A;  4M7A F;  2PVD B;  2CZ0 B;  3CCU T;  3CCS Q;  4M78 F;  3CC4 A;  1MMA A;  2L3R A;  2O01 E;  2K4Y A;  1O75 A;  2M02 A;  1WLF A;  1CSK A;  4IUV A;  2LJ1 A;  1UFF A;  4XTU A;  2SEM A;  1NJI U;  4J9D A;  5L23 A;  2CP5 A;  4FSX A;  3MEU A;  5DYG A;  3A8O B;  1WLP B;  5GMK i;  2CT3 A;  1KK7 A;  5IHN A;  3QWY A;  1E6G A;  2RK2 A;  2EFI A;  1ZC1 A;  4QVC A;  4HVW A;  3OYA A;  2Q19 X;  2E6N A;  1HD3 A;  1IRX A;  2DTH A;  2PUK B;  3CC4 T;  5D6W A;  2DTI A;  3TEE A;  1SRL A;  5IT9 E;  4DEY A;  3FJ5 A;  1QVG A;  1M8V A;  2KVQ G;  1D0Z A;  1HXD A;  2B86 A;  1CZ5 A;  1UB4 A;  1BYM A;  1KD1 U;  1ZUY A;  3HKS A;  4KUL A;  3X25 B;  2YRD A;  1SPK A;  2A0F B;  5IHK A;  2R5M A;  2EQK A;  1SG5 A;  3OYH A;  1H8K A;  1TOV A;  3CCV A;  4KLN A;  1WA7 A;  5GAN f;  2XHC A;  2DBM A;  3RR6 A;  1YIT A;  3JSC A;  3ZEH A;  1W6X A;  2QAZ A;  2E64 A;  4XQ3 A;  1NPP A;  1FWZ A;  2IVW A;  1K73 U;  3SFM A;  5GAN 2;  2D1X A;  3CC2 T;  3OMG A;  5KYY A;  2KGT A;  4X9D A;  5A2Q E;  2EWN A;  4C8Q E;  4PJM A;  4DOW A;  4J9B A;  4BDY A;  4IUQ A;  1Q86 U;  1JJ2 A;  4Z8A A;  5GAM e;  1VYT A;  2E70 A;  1MUZ A;  4MDW A;  3PGG A;  3TVT A;  4LDW A;  2P0P A;  1S72 T;  2YRC A;  1M90 R;  4M78 B;  1D1B A;  5C1B A;  2W0Z A;  4M7A D;  5CCX A;  1Q82 C;  5FW9 A;  3U23 A;  2EYQ A;  5GMK j;  4OMO A;  2XU8 A;  4RMO A;  4OP0 A;  3JCM W;  2ZGW A;  2DKG A;  3KUF A;  3CF2 A;  2DL4 A;  2JMA A;  1VYU A;  2LC4 A;  1H3Z A;  4JRK A;  3VS1 A;  2FPD A;  4OMN A;  3VS3 A;  4M77 G;  1F1B B;  1KFZ A;  4M77 B;  3N5B B;  4C0G A;  3CEY A;  3E1S A;  2E3H A;  2LZ6 B;  2RH2 A;  2CUD A;  1OZ2 A;  3ULR B;  1VIE A;  4KGV B;  5GAN d;  1JRI A;  3CME A;  5I22 A;  2PTK A;  4HVV A;  4RTY A;  2DJZ A;  1Q7Y U;  4JLG A;  4EMG A;  4EMK C;  1ZSG A;  2E5Q A;  4OMM A;  1WNL A;  1OUL A;  3M55 A;  1G83 A;  3QBY A;  1OI1 A;  5HK3 A;  4J9E A;  3VRZ A;  2GGR A;  4M78 A;  2DD4 A;  4C92 G;  2VAS A;  4BI8 B;  3C12 A;  5IXB A;  3EFO B;  2H8H A;  1X27 A;  2AK5 A;  1YBY A;  1BCM A;  2MOX A;  2HKQ B;  2RB6 A;  3QPH A;  5FTK A;  3LX7 A;  1G2B A;  4KRT A;  1VQ4 Q;  3CME Q;  3I9Q A;  3R6N A;  3HU3 A;  3MB5 A;  3JCM e;  4KBM B;  2Y90 A;  5KCO A;  2YXY A;  3CCL Q;  1CZ4 A;  2OI3 A;  1W2B A;  1U06 A;  1KD1 R;  3QDF A;  2E41 A;  3L2U A;  1QP3 A;  2VGM A;  2NUZ A;  1YI2 A;  2RJF A;  1B34 B;  2CZ1 B;  5FU6 C;  3HRU A;  2QQS A;  3TCJ A;  4ZN3 A;  5I2M A;  1RAD B;  1KG1 A;  2EW3 A;  1YJW T;  2BE9 B;  1ABQ A;  1QMC A;  1SEM A;  3GLX A;  3WVE B;  4C0F A;  4II1 A;  1AD5 A;  2QA4 A;  1RL2 A;  1LNX A;  1W2B P;  2ABL A;  2O9V A;  2QYZ A;  1BI1 A;  3QG1 A;  2DTO A;  2P0K A;  3OYD A;  1X6O A;  3GF5 A;  1VQ4 T;  2LT4 A;  4PJL A;  3CCM Q;  1KQS S;  2DF6 A;  2AKL A;  5FWC A;  4HCB A;  2BZX A;  3SD4 A;  4XTX A;  1N8R C;  2XG8 D;  2DO3 A;  3DLM A;  1G5V A;  1W1F A;  1OPK A;  2YUQ A;  1CR5 A;  1WZO A;  5FTM A;  4WTO B;  1S72 A;  4DQ2 A;  2KXC A;  3EH1 A;  4A4F A;  2DER A;  1FXX A;  3M9Q A;  1TS9 A;  3OYI A;  1IO6 A;  4KGX B;  3JCM P;  2X3W D;  2FYK A;  1VQ8 T;  3V7S A;  3C95 A;  1PRM C;  3PIP A;  2RNA A;  2M9U A;  4M7D D;  1I8F A;  4OML A;  3FEO A;  1GFD A;  2KMT A;  2WSC E;  5HCK A;  2D9T A;  1Q7Y R;  1J3T A;  3RUX A;  5A0L A;  1Y7X A;  2DPP B;  5GAO n;  4QW2 A;  5LJ5 j;  2QQ9 A;  2E5K A;  1TH7 A;  3LWI A;  2GTO A;  2O4X B;  5I2S A;  2SRC A;  2L0A A;  2RJD A;  2Q18 X;  4LE9 A;  2K3B A;  4AFQ C;  3OBY A;  5D7U A;  3X20 B;  4PFO A;  3M59 A;  1M3B A;  3OYN A;  1PC0 A;  1NE8 A;  4XTY A;  4AG1 C;  4J9C A;  4EMH A;  3OW2 S;  2EYZ A;  1X6B A;  4IIO A;  4BE1 A;  2MMP A;  1NM7 A;  1AT1 B;  1D0Y A;  2QQB A;  2HL3 A;  2CP6 A;  2COW A;  1NPR A;  5LJ3 h;  1NLP C;  2DL8 A;  2JS0 A;  2E10 A;  3D7S B;  5J3B A;  3EAE A;  3BW1 A;  3PMT A;  4V2S A;  1BIA A;  1Z9Z A;  3CCJ Q;  2YHT A;  2DIL A;  2WAC A;  1D0X A;  2DVE A;  3PT9 A;  1OYX A;  3EG9 A;  4IUT A;  3QQ7 A;  3M54 A;  3G71 A;  1K76 A;  1K8A C;  5LJ5 h;  2VV5 A;  4Z89 A;  4RG8 A;  3G4S A;  5GAN g;  4F7U G;  5I11 A;  4M75 C;  3CCM A;  3CC7 Q;  1AHJ B;  4J7F A;  5I21 A;  2GFU A;  3UWN A;  2FPF A;  3M53 A;  1V1C A;  2RQU A;  2Q1A X;  2LRQ A;  4B9W A;  3GP8 A;  4J6Y A;  2JMC A;  1VOM A;  2XK0 A;  1KC8 R;  5CKF A;  2LMJ A;  1EFN A;  4ATO A;  5KH6 A;  2QEX Q;  4C92 E;  5KE2 A;  3RMS A;  4JRQ A;  3LH5 A;  2EIF A;  4GY5 A;  1VQ5 A;  4PJO B;  3H0I A;  1YIJ T;  4PJO G;  1UE9 A;  3OS5 A;  4KGZ B;  3NTI A;  3UA6 A;  4PKC C;  4KH1 B;  3VJP A;  2DYI A;  5HKC A;  1ZQ1 A;  3REA B;  3QII A;  2DIG A;  2AKK A;  2JVV A;  5CCB A;  3E2U A;  4ZGE B;  1RAE B;  2XDB A;  1HJD A;  4JZ3 A;  4J9F A;  2YSQ A;  3S6W A;  4C5G A;  1PD1 A;  1KSW A;  2YT6 A;  1DJ7 B;  5GJV B;  1Y0M A;  4M78 C;  1AWO A;  3HRT A;  5GAN 8;  1NLO C;  2QGG A;  1N27 A;  4LDV A;  4C0D C;  5CR2 A;  1UGV A;  1VQ5 T;  2RHY A;  4AS1 A;  5GAN j;  1XOV A;  2E1H A;  1TUG B;  2GNC A;  4PJJ A;  4K11 A;  4OB1 B;  3INZ A;  3SHW A;  3H8Z A;  1H64 1;  2L3P A;  1WDX A;  2E65 A;  2QEX T;  1BI3 A;  4A4E A;  1QVG S;  3I55 A;  4KDI A;  2E4H A;  3LH0 A;  1JBM A;  4M77 A;  1Y07 A;  2L8D A;  1MV3 A;  4PFP A;  3M0U A;  4RKU E;  5J39 A;  3EGX A;  1YIT T;  1LVK A;  3QXE B;  2ECZ A;  2EVR A;  1NYF A;  1JO8 A;  2RI3 A;  1I07 A;  4RTV A;  3L1A A;  3ZJU A;  1ZUU A;  4XTZ A;  3QDR B;  3RER A;  1WHJ A;  2JTF A;  4VUB A;  1LJO A;  1VQL T;  2KNB B;  5IHI A;  3VS2 A;  2IIM A;  3S3N A;  3CCV Q;  4ELY C;  1K4U S;  1WXB A;  1QVP A;  1QKW A;  3FB9 A;  3CQT A;  4XTW A;  3VS4 A;  4J6X A;  4BY6 C;  1K9M R;  4HCK A;  4N0A C;  3CC7 A;  2ZPF B;  1SHG A;  2MWP A;  2RM4 A;  5C0M A;  3QO3 A;  2F69 A;  4X1V A;  2OTJ Q;  2A08 A;  3A8G B;  5GAN 4;  2XD0 A;  2EGE A;  4A53 A;  4TVR A;  1UG1 A;  3AT1 B;  1VQP Q;  1OOT A;  2M1H A;  5AT1 B;  1JJ2 S;  4QQG A;  4PJO A;  2K57 A;  1M9S A;  2DRM A;  4M7D A;  2KRN A;  3A8L B;  1BU1 A;  3E9F A;  4LDX A;  2X3X D;  3O5Z A;  1PKS A;  2MAM A;  3KBG A;  2L3Q A;  2LX7 A;  3MJX A;  4JRI A;  2JJ9 A;  4QQD A;  1I4K 1;  3VS5 A;  2DL5 A;  4E7Z A;  2KR3 A;  3CPW S;  2K2M A;  5FRN A; 
#chains in the Genus database with same CATH homology
 2L89 A;  4ZTJ A;  5A2Q E;  2PVG B;  2BKD N;  1N9S A;  2EWN A;  4OB0 B;  5LJ3 d;  4C8Q E;  4DOW A;  4BDY A;  4IUQ A;  1Q86 U;  1JJ2 A;  4CI0 C;  4M7A C;  4OF1 A;  3JCM g;  2DXB A;  2RHI A;  5GAM e;  2E70 A;  2Y4X A;  4KO8 A;  1G3S A;  3JCM Q;  4RG2 A;  1K9M C;  4MDW A;  1QVF S;  3PGG A;  4OVA A;  4LDW A;  2P0P A;  2PUO B;  2ZPG B;  3JCM J;  1S72 T;  2PJH B;  4M78 B;  1SSF A;  4C8Q C;  4ZGJ B;  2JOY A;  5C1B A;  2QQA A;  4F7U A;  5DY9 A;  3EFS A;  4M7A D;  2P0Q A;  3X26 B;  3OYF A;  1Q82 C;  4M7D B;  5CCX A;  2MM0 A;  2EKO A;  4M78 E;  4MDX A;  2EYQ A;  5GMK j;  4RMO A;  2XU8 A;  4MZM A;  3M4Y A;  1K9M U;  4OP0 A;  2M0O A;  2G3R A;  2ZGW A;  2DKG A;  3GNG A;  3KUF A;  3JCM W;  5GAO r;  1KQS A;  3CF2 A;  1BIB A;  1N6A A;  2LC4 A;  1KC8 U;  3NTK A;  1H3Z A;  5FRO A;  1VQ9 A;  2MWO A;  5FU7 C;  4PJO F;  4JRK A;  3L2W A;  2JUF A;  1R8O B;  1YCY A;  1VIF A;  4EMK A;  1UEB A;  4M7D F;  4PLI A;  3OYJ A;  4PJO D;  1Q82 U;  1VQ7 A;  2X4W A;  4M77 G;  2L5Q A;  2LDM A;  3CPF A;  3SDZ A;  4M77 B;  3N5B B;  4C0G A;  3S3O A;  2EQJ A;  3CEY A;  3MEV A;  4M78 G;  3E1S A;  4J5Y A;  2RHZ A;  3JCM X;  2LTO A;  2EJG A;  3FDR A;  1VQO T;  4P5N A;  4BDZ A;  2RH2 A;  1VQ8 A;  5DLO A;  2PWY A;  3C94 A;  3CCL T;  4JJN K;  3CBM A;  1OZ2 A;  5CKB A;  1VIE A;  1M1K C;  5GMK m;  5GAN d;  3HL8 A;  5HK0 A;  1N9R A;  4ME7 A;  1JRI A;  3CME A;  2Q1D X;  2EJ9 A;  1KHI A;  5CO7 A;  3FJP A;  3FLG A;  2EAY A;  1K8A U;  1QVF A;  3VV0 A;  1VQM T;  2E6Z A;  1K73 C;  2LNV A;  2DJZ A;  2EQU A;  1Q7Y U;  4JLG A;  4EMG A;  4C5H A;  4EMK C;  1Q7Y C;  2E5Q A;  1WNL A;  3A5Z B;  3MO8 A;  4A4G A;  4E7I A;  3M55 A;  4M77 F;  3JB9 D;  3QBY A;  1YJN T;  2DZC A;  1OI1 A;  3TU4 K;  5HK3 A;  5ERG B;  3JB9 G;  2VGN A;  2RI2 A;  3J80 E;  1XNI A;  3CCR A;  5LJ3 f;  1G3T A;  2IG0 A;  2BUD A;  4M78 A;  1M1K U;  1BKB A;  2DD4 A;  2X35 A;  1P92 A;  4C5I A;  4C92 G;  4BI8 B;  3C12 A;  4C92 D;  1B34 A;  1I81 A;  2FVU A;  4L5G A;  1YBY A;  5EG2 A;  3BDU A;  4M7D E;  1ZBX A;  3HU2 A;  2JNG A;  4YTL A;  3QZ9 B;  2RB6 A;  3QPH A;  3JAM E;  4R56 A;  1R7R A;  5L8R E;  5FTK A;  3LX7 A;  3QYG B;  3CCQ A;  2FB7 A;  4M77 E;  3MET A;  5FLX E;  2ZZD A;  1I5L A;  3OW2 A;  3CCL A;  3FPR A;  4C8Q A;  3HU3 A;  2B8A A;  4M77 C;  2B25 A;  3MB5 A;  2VXF A;  3JCM e;  3CCS A;  3LGA A;  5FTJ A;  3L2Z A;  4C0D B;  4OGC A;  1UGS B;  4KBM B;  4MZT A;  4E7K A;  2YLC A;  3QKJ A;  3LWH A;  4M7A A;  2Y90 A;  3OSV A;  5KCO A;  3OB9 A;  5LJ5 f;  3M56 A;  3RKX A;  1XQH A;  3GNF B;  4OB2 B;  2CYZ B;  2XI9 A;  3O8V A;  3PFS A;  1CZ4 A;  5M9O A;  1QCS A;  2LW6 A;  5AYF A;  1W2B A;  5GAN 5;  2K3X A;  4HKE A;  4JS5 A;  4IKF A;  2GF7 A;  2E41 A;  2K3Y A;  2K5F A;  2ZPI B;  3L2U A;  2XDP A;  1QP3 A;  1Q81 C;  2VGM A;  4XK8 E;  3RKW A;  3LYI A;  2X4J A;  1N8R U;  5A0D A;  2PQW A;  1YI2 A;  2RJF A;  1YIJ A;  1B34 B;  2CZ1 B;  3TIW A;  3LW5 E;  5FU6 C;  3QQ8 A;  3HRU A;  2QQS A;  3TCJ A;  1WGS A;  4HA8 A;  4ZN3 A;  3PMI A;  5I2M A;  5GAM j;  1WJR A;  1OZ3 A;  1KG1 A;  4JS4 A;  1YJW T;  2KDS A;  2OTJ T;  3MP1 A;  2ZCF B;  4M75 G;  5CAI A;  5LJ5 d;  3ME9 A;  3GLX A;  3WVE B;  4C0F A;  4II1 A;  3ER0 A;  2CZ6 B;  3JCM c;  3OYL A;  1RL2 A;  2QA4 A;  5GAO m;  2F5T X;  1LNX A;  2KQW A;  4ARI A;  1PSE A;  3MEA A;  3QHS A;  2DXT A;  4E7J A;  1IZ6 A;  2LCC A;  4E47 A;  2R57 A;  1BI2 A;  2OAU A;  1BI1 A;  2P4T A;  4L59 A;  3JB9 I;  4XU1 A;  3QG1 A;  4M75 E;  2DTO A;  2P0K A;  1V29 B;  3F70 A;  4A4H A;  3OYD A;  5CIU A;  1X6O A;  3GF5 A;  3CXC S;  1VQ4 T;  4XU0 A;  2Q1C X;  2LT4 A;  1KQS S;  4F7U E;  4QVD A;  2CKK A;  4HCB A;  3JB9 H;  5D6X A;  3SD4 A;  5GAN 3;  3OYC A;  4XTX A;  3G6E T;  3P8H A;  1VQP A;  1YJ9 A;  1N8R C;  1Q81 U;  4FIB A;  5GAM g;  3I55 T;  3CD6 A;  4M7A B;  2XG8 D;  3CMA A;  5GMK h;  2DO3 A;  3DLM A;  3HHT B;  4JLI A;  1G5V A;  2DD5 A;  3HU1 A;  1HK9 A;  2Y4Y A;  1QDN A;  1CR5 A;  2LVM A;  3LGF A;  4PJO C;  4HCZ A;  3CCR T;  5FTM A;  4D6W A;  3DLL A;  1O9S A;  2OTJ A;  1U1S A;  2QXF A;  4BUG A;  3GIB A;  1Y71 A;  1S72 A;  4Z02 A;  4FL6 A;  5D6Y A;  1VQ9 T;  3R6O A;  4DQ2 A;  2QEX A;  2HNI A;  2QQR A;  1BI0 A;  2R58 A;  4OGE A;  5FU6 B;  4A4F A;  1YHQ A;  3CC2 A;  2K2V A;  1FXX A;  3DKM A;  3BDL A;  3M9Q A;  4BD3 A;  1VQL A;  1UGQ B;  3VUB A;  3OA6 A;  3OYI A;  1X01 A;  2LQK A;  5FU7 B;  2DIQ A;  1M90 C;  2RHX A;  4F7U B;  5C6S A;  1VQK T;  3JCM P;  4IUP A;  3HFO A;  2FYK A;  3HRS A;  1VQ8 T;  3CCS T;  3V7S A;  4EDU A;  1MGQ A;  3C95 A;  1GXI E;  1MHN A;  3PIP A;  3VU3 C;  4X9C A;  4M75 B;  2VXE A;  4J6W A;  2K5I A;  2M9U A;  3CCE T;  5IN1 A;  4M7D D;  1I8F A;  3MP6 A;  2YLB A;  2HQX A;  4HT8 A;  3TRE A;  3FEO A;  1XTD A;  2KMT A;  2MF2 A;  2EQM A;  2QI2 A;  1QP2 A;  2V8K A;  2WSC E;  1D3B B;  3QUI A;  2XKO C;  4FM4 B;  2D9T A;  4N4H A;  4C92 F;  3RUX A;  4EPC A;  5A0L A;  2WSE E;  2QDY B;  4KUD K;  1Y7X A;  2DPP B;  5GAO n;  4QW2 A;  3VYG A;  3PTA A;  5LJ5 j;  3OS1 A;  2PU9 B;  2HBP A;  1TH7 A;  2QQ9 A;  2VUB A;  2MI6 A;  2O4X B;  4FT2 A;  5LJ5 g;  1G3Y A;  1EIF A;  2O4X A;  5I2S A;  2BIV A;  3RMQ A;  4C92 C;  4JDS A;  4ZGD B;  2RJD A;  2Q18 X;  5LJ3 e;  1UGP B;  3EFR A;  4M7A G;  1I9G A;  3WXM B;  3VKI A;  3OBY A;  2JN0 A;  3X20 B;  4N4G A;  2CGH A;  2FHD A;  4RCB A;  4C0Z A;  3M59 A;  1M1G A;  1M5Q 1;  4E7L A;  5A0G A;  3M5A A;  3OYN A;  2ZPE B;  4E7H A;  2XID A;  2X4X A;  1VQK A;  1NE8 A;  1M1F A;  4XTY A;  5GAN e;  1M4Z A;  1YJN A;  4A54 A;  4EMH A;  3NFC A;  4C8Q D;  3JCM d;  5CKH A;  3OYK A;  3I56 A;  5DLQ E;  4DOV A;  4BE1 A;  3OW2 S;  3M4G A;  2MMP A;  2DK3 A;  2DXC A;  5EPP A;  2QQB A;  3BFM A;  4L6V 5;  2CZ7 B;  5GAO l;  3GOX A;  3GPL A;  3HP9 A;  4M7A E;  3H6Z A;  3G7Z A;  2ZPB B;  1NPR A;  5LJ3 h;  1VQM A;  4M78 D;  3CPW A;  3DB3 A;  2VC8 A;  3X28 B;  2E10 A;  2GQV A;  5J26 A;  3OS0 A;  1VQO A;  1VQ6 A;  5J3B A;  3EAE A;  3BW1 A;  3NTH A;  4DA4 A;  4FU6 A;  1U8R A;  3PMT A;  2H3J A;  1WQW A;  1BIA A;  3QSU A;  4V2S A;  5EQJ B;  3S3M A;  2DAQ A;  3QZ5 B;  3CME T;  4PJO E;  5IAY A;  1RI0 A;  4KT0 E;  2YHT A;  2LQ8 A;  5CQY A;  1VQP T;  5GLF A;  4BAC A;  1NZ9 A;  3HPW A;  2A7Y A;  2V8I A;  3JCM b;  2WAC A;  4LDY A;  2DVE A;  4OMF B;  3PT9 A;  4C5E A;  3VUZ A;  2MM2 A;  4N4I A;  1OYX A;  4FT4 A;  4QQ6 A;  4BI4 A;  4IUT A;  3QQ7 A;  4BI3 A;  1VUB A;  3M54 A;  5GAM h;  3MEW A;  3G71 A;  1K8A C;  3ZJV A;  1VQN A;  5LJ5 h;  2VV5 A;  3L42 A;  3RES A;  2ZPH B;  2LCL A;  4RCC A;  4O6J A;  4BY6 B;  2HD0 A;  2M16 A;  4RG8 A;  3OYG A;  2YRV A;  3G4S A;  5GAN g;  3LGL A;  4MMK A;  3VYH B;  4M75 C;  4F7U G;  1PSF A;  1AHJ B;  3OYB A;  4J7F A;  3JCM V;  5CVI A;  3I56 T;  3CCM A;  1YHQ T;  4IUU A;  3V8J A;  2GFU A;  5I21 A;  3OYE A;  3UWN A;  4M7D C;  3M53 A;  4LDU A;  2E12 A;  5GMK e;  3A8H B;  5GAN 6;  4R55 A;  2Q1A X;  2LRQ A;  4B9W A;  3CXC A;  4J6Y A;  1U1T A;  3QJ6 A;  3GP8 A;  4ELZ C;  3CCQ T;  3PIO A;  2CS7 A;  2XK0 A;  1KD1 C;  1KHC A;  3SWN B;  2EJF A;  5CKF A;  2DEQ A;  4XU2 A;  3OBW A;  3OMC A;  4KOD A;  2VYT A;  4ATO A;  5KH6 A;  3OY9 A;  2RA2 A;  4HCC A;  4C92 E;  5KE2 A;  3RMS A;  4JRQ A;  1G3W A;  2EIF A;  2DZ9 A;  4GY5 A;  4WF2 A;  2LX9 A;  3V7C A;  3V8K A;  1VQ5 A;  1YIJ T;  2LT1 A;  4M75 F;  4PJO B;  3FIF A;  4PJO G;  3FC3 A;  3J7A F;  3P8D A;  1WJS A;  2DXU A;  3OS5 A;  1Y96 A;  3NTI A;  4M77 D;  4X34 A;  4C92 B;  1WJQ A;  3L2R A;  2D0Q B;  1VQN T;  4M7D G;  3MCA B;  4PKC C;  3BQB A;  3VJP A;  3BY7 A;  5HKC A;  5DM7 R;  3CCJ T;  1ZQ1 A;  3UT1 A;  4B9X A;  3CCM T;  2QTX A;  3WVD B;  4GLK A;  4UC4 A;  3FRN A;  4M75 A;  5CK9 A;  3LLR A;  1KQ2 A;  3FPU A;  3QII A;  1S3S A;  2DIG A;  2GCX A;  3G6E A;  4BE0 A;  1YJ9 T;  2JZ2 A;  3AHU A;  5CQX A;  4ARC A;  2HAX A;  5LJ3 j;  2JVV A;  4J83 A;  1W2B S;  5CCB A;  4ZGE B;  5LJ3 g;  4J7I A;  3CCV T;  5GMK l;  4QVZ A;  2PVO B;  2XDB A;  1D3B A;  2X4Y A;  3G71 T;  5DYI A;  3S6W A;  4C5G A;  2K5L A;  2R5A A;  5LJ5 e;  4NS5 A;  4J8O A;  3QC8 A;  3OYM A;  4Q5W A;  5KE3 A;  3ZBD A;  1WQ7 A;  3JCM h;  4NL3 A;  3CC7 T;  4LD6 A;  1DJ7 B;  4M78 C;  4XU3 A;  5CKE A;  2RI5 A;  3HRT A;  5GAN 8;  2XDD A;  1Q86 C;  4NOY A;  5FRM A;  1UGR B;  3JCM f;  1N27 A;  4LDV A;  3L2Q A;  3ZFJ A;  2RJC A;  5CKD A;  4C0D C;  1FX7 A;  4JUV A;  5CR2 A;  2A3L A;  4O5V A;  1VQ5 T;  1JB0 E;  2RHY A;  5FTL A;  3CBP A;  2RO0 A;  2XIC A;  3QJY A;  1XOV A;  2E1H A;  5GAN j;  3LHD A;  4AS1 A;  2WSF E;  2RD1 A;  3OQ5 A;  3PNW C;  4ZN1 A;  4M7A F;  5CD1 A;  2PVD B;  4KUI A;  3A8M B;  2CZ0 B;  4OB1 B;  3CCU T;  4M78 F;  1KC8 C;  5FTN A;  3INZ A;  2I2L A;  3CBO A;  3E19 A;  3H8Z A;  3CC4 A;  1H64 1;  2QEX T;  2E65 A;  1BI3 A;  4A4E A;  3ASK A;  1QVG S;  3I55 A;  1X75 C;  2L3R A;  4KDI A;  3LH0 A;  3SWN A;  2O01 E;  2K4Y A;  4C8Q F;  1ZHI A;  1JBM A;  4M77 A;  1Y07 A;  3CMA T;  2L8D A;  1O75 A;  4HT9 A;  1WLF A;  3M58 A;  4RKU E;  5J39 A;  1YIT T;  4IUV A;  2V8J A;  2RK1 A;  2NLU A;  4N0A A;  1WPY A;  3QXE B;  3QYH B;  4XTU A;  3SWN C;  2GFA A;  2RI3 A;  5GAM d;  3SB2 A;  5GAM f;  3ZJT A;  1NJI U;  2YVL A;  3L1A A;  3ZJU A;  4C8Q B;  4BB7 A;  4M75 D;  5GAO q;  4EMK B;  3RIR A;  4XTZ A;  3QDR B;  4RV0 A;  4IUR A;  4FSX A;  2JTF A;  3CCE A;  3MEU A;  4VUB A;  3RER A;  5DYG A;  3OSS C;  3OYY A;  1LJO A;  3A8O B;  1M90 U;  1VQL T;  3KXT A;  3M57 A;  2KAF A;  5GMK i;  2QA4 T;  4CRI A;  2D6F A;  3S3N A;  2OTL T;  4ELY C;  3HFN A;  1O54 A;  4NL2 A;  1QVP A;  1W4S A;  3FB9 A;  2RK2 A;  2EFI A;  4XTW A;  4QVC A;  1ZC1 A;  2HQE A;  3X24 B;  4J6X A;  4BY6 C;  3CCU A;  2YUJ A;  1YJW A;  3OYA A;  1KQ1 A;  5LL6 S;  2Q19 X;  4PLL A;  2E6N A;  4A4K A;  3QWZ A;  4Y91 A;  4N0A C;  5CCA A;  4Y28 E;  3CC7 A;  2DTH A;  4AQ7 A;  2ZPF B;  2PUK B;  3CC4 T;  3J81 E;  5D6W A;  2DTI A;  1IRE B;  3FPT A;  1LOJ A;  4OB3 B;  4MZP A;  3TEE A;  4PL6 A;  1VQ6 T;  3CCJ A;  2MWP A;  4F7U F;  2KY9 A;  2RM4 A;  5IT9 E;  3CD6 T;  4MML A;  5C0M A;  4LD9 K;  3QO3 A;  1QVG A;  1M8V A;  2KVQ G;  1HXD A;  2F69 A;  1CZ5 A;  3UPU A;  1UB4 A;  3MHX A;  3OS2 A;  1BYM A;  1KD1 U;  3HKS A;  5C18 A;  1QW1 A;  4KUL A;  2RHU A;  3DB4 A;  3V7R A;  3V8L A;  3X25 B;  5HY6 A;  3A8G B;  5GAN 4;  3JRZ A;  1VQ4 A;  2RJE A;  4A53 A;  4TVR A;  2XD0 A;  5B6C A;  1NJI C;  1Y96 B;  4C92 A;  4BE2 A;  4KDL A;  2R5M A;  2EQK A;  2JTM A;  2F5K A;  2M1H A;  3G4S T;  1YI2 T;  4QQG A;  1JJ2 S;  5KCH A;  3OYH A;  4PJO A;  2K57 A;  3JB9 J;  1M9S A;  3CCV A;  4KLN A;  3RKY A;  3A8L B;  3MP8 A;  5GAN f;  2AHJ B;  2XHC A;  4PNO A;  4M7D A;  1YIT A;  1E32 A;  4ZTF A;  3URG A;  5GAO p;  3P8B B;  3E9F A;  3JSC A;  2JV2 A;  4LDX A;  3ZGZ A;  3ZEH A;  2OTL A;  3HSB A;  5GAN h;  2MAM A;  3L2V A;  4C8Q G;  3E9G A;  2C06 A;  3KBG A;  1VQ7 T;  2FL7 A;  3T9N A;  2E64 A;  5GAN 7;  4JRI A;  4XQ3 A;  2KK4 A;  1I4K 1;  4QQD A;  4XAX B;  1NPP A;  4JRP A;  1FWZ A;  2IVW A;  1K73 U;  3LWI A;  4XTV A;  2KSS A;  3SFM A;  5GAN 2;  3CC2 T;  3JB9 F;  3C4S A;  3OMG A;  3Q1J A;  3CPW S;  4CQN A;  3UDC A;  5FRN A;  4X9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...