5D6WA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6wA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6wA02
4C5GA 3UT1A 1WJSA 3LLRA 5KCOA 4IUUA 5C0MA 2F5KA 3P8HA 3MP6A 4QQDA 2BIVA 1WGSA 2RJEA 4OVAA 3OS1A 3QBYA 4QQ6A 3M9QA 5FROA 4E7HA 4QW2A 3OYJA 3OA6A 2M0OA 2CKKA 2EFIA 2L89A 5KCHA 3OS2A 2R5AA 3E9FA 3PMIA 2EQMA 2O4XB 5M9OA 3OYKA 5KE2A 4A4FA 4HCZA 4A4HA 3FDRA 4C5EA 5FRMA 3FLGA 4EDUA 3L2UA 4RG2A 4PLIA 5D6YA 5C6SA 4IKFA 4IUPA 5D6WA 1SSFA 2K3YA 2RI2A 2RI5A 4LD6A 4E7JA 4N4GA 2E6NA 3OYBA 1OZ3A 3F70A 3OB9A 2EQKA 2O4XA 4X34A 3SD4A 3NTHA 2LDMA 4PL6A 4IUQA 4BD3A 1WJQA 2MWPA 2RJDA 3O8VA 2M1HA 1WJRA 5J26A 3CEYA 3MEWA 2GFAA 3PFSA 4FU6A 2R57A 3C4SA 4FL6A 5IAYA 4L59A 3OYNA 3OYIA 2RHIA 3MO8A 2R5MA 3DB4A 2YRVA 3ASKA 3OMCA 2K3XA 3DLMA 2DIQA 4QVZA 1MHNA 1XNIA 3L2RA 3S3OA 3OQ5A 4II1A 3OYHA 3OY9A 2DIGA 4IURA 2D9TA 5IN1A 3OYMA 2RHXA 2R58A 3PNWC 4NS5A 2LTOA 2X35A 2LVMA 3LGFA 3LH0A 2WACA 4E7KA 2HQXA 3OYLA 3H6ZA 2RHZA 4ZTFA 1H3ZA 2XK0A 2EQUA 3OS0A 3GOXA 2EQJA 5J39A 4A4GA 2QQSA 3L2VA 1OI1A 2LCCA 4Z02A 3META 3E9GA 3OYAA 3NTIA 2JTFA 4PLLA 4BE2A 4GY5A 1KHCA 4A4EA 1OZ2A 2M16A 2B8AA 3PMTA 3L42A 2NLUA 4IUVA 2P0KA 2X4XA 3OYEA 5CIUA 2LRQA 3OMGA 3QJ6A 3S6WA 2BKDN 1RI0A 3MEUA 4ZTJA 4B9XA 1OYXA 2L8DA 4B9WA 2EKOA 3NTKA 3FEOA 2XDPA 3OYCA 3L2WA 3MEVA 4C5HA 3OYDA 2HQEA 2JZ2A 2RJCA 2E5QA 4QQGA 2L3RA 4UC4A 4BE1A 4BDZA 4CRIA 2G3RA 2IG0A 2X4YA 3LX7A 2RJFA 2RHUA 3LGLA 5D6XA 5FRNA 3KUFA 3LYIA 2DAQA 2RO0A 4C5IA 3MP8A 4BACA 4N4HA 2QQRA 3QIIA 3FC3A 1N27A 3DB3A 3L2QA 3OYFA 3OYGA 3H8ZA 2PQWA 3P8DA 3QKJA 4BE0A 1G5VA 4E7IA 4BDYA 2GF7A 2RHYA 3MP1A 4E7LA 3S3NA 5KE3A 3BDLA 3S3MA 2FHDA 4Q5WA 5KH6A 2MWOA 3ME9A 4IUTA 2VYTA 2GFUA 3Q1JA 3EAEA 3ZEHA 3MEAA 4N4IA 2RI3A 3UWNA 2X4WA 2BUDA
chains in the Genus database with same CATH superfamily
3UT1A 2VXFA 2KYBA 5GANd 2V8IA 3V8JA 4DA4A 3OS1A 4JJNK 1UGRB 2M51A 4ELYC 2KRMA 3H9NA 4BY6B 2VV5A 1YHQT 1K8AR 1PD1A 1LJOA 1JB0E 2QEXA 4A63B 3CCLQ 1AWOA 5I21A 3WVDB 3CPFA 2HBWA 1YWPA 1VIFA 3G71A 2Q1AX 1UGVA 2DTOA 2E70A 3M0QA 2JJ9A 5IHIA 4ANJA 4FL6A 4DBQA 2ATCB 3CC4A 2EIFA 4JLGA 3VS2A 1YFNA 2A36A 3OYHA 1M90R 2AZSA 2MOXA 1I81A 1KQSS 1RAIB 4J83A 2R58A 2FZCB 4X9CA 2LVMA 3CQTA 4XAXB 5HKCA 4AFUC 2X9HA 2KROA 2MF2A 3H6ZA 1ABOA 4J8OA 3JB9G 3ER0A 4A4EA 1B34A 1VQLQ 3TU4K 3OYEA 1AWWA 1UECA 2JNGA 4ZTJA 3RUXA 2KXCA 3X25B 2EPDA 4UC4A 2VGMA 1QVGP 4J9IA 1BB9A 4XK8E 3LX7A 3CC2A 3G1JA 3LYIA 3CMET 1ZUKA 4QVCA 2PZ1A 2HSPA 3A98A 1RI9A 1ZUUA 2RHYA 3VS1A 1ZUYA 2BZ8A 5KYXB 1SEMA 3H0FA 4Q5WA 2VYTA 4J5YA 2DVJA 2KRNA 3CCEQ 3M59A 3VU3C 4E7SA 2KGTA 2FB7A 1NJIU 2EYYA 1PC0A 2EGCA 3LLRA 4HXJA 3CCVT 1UGSB 2AT1B 1TTHB 2DLPA 3CMAQ 4HT9A 3J80E 2BIVA 4FCYA 2ROTA 3REAB 1S72Q 3MHXA 1VQ4A 4F16A 3FDRA 1K1ZA 1QKWA 3X24B 1JXMA 1ABQA 3OYYA 4V2SA 2QGGA 5KYUA 3AT1B 1PNJA 2ZPFB 3G4ST 1AT1B 4XU2A 1RACB 3JCMg 4CQNA 4M75G 2D0NA 3FPRA 1OX9A 2E5KA 1D0YA 1IGQA 1N9SA 2NUPA 3OYIA 1GCQC 2KR3A 1NYFA 2O88A 2MPXC 1G3YA 4QVZA 2FRWA 4J6YA 4CC7A 2RB6A 4HVWA 3CC7Q 2DEQA 1NEBA 1GCQA 2LJ0A 2PNIA 2JUFA 5GMKi 2E65A 2ESWA 4OMNA 3EG9B 2F1LA 1VQ8T 3ZJVA 1TU0B 2JW4A 1H3HA 1QKXA 2BE7D 1AZEA 3L42A 4ESRA 1ACMB 3MEVA 1TWBA 1KQSP 1PM3A 2FRYA 1OOTA 4M7AE 2DF6A 3EG2A 2RJFA 5A0GA 4EPCA 4L6V5 1K73R 1TS9A 2EJFA 3HP9A 4FYVB 3URGA 3LWIA 3QDFA 1TSFA 3LH5A 1VQPT 4FSXA 3MP1A 2DILA 2DMOA 2QG9B 3RERA 2B25A 1RAFB 5KH6A 4C92D 1D0ZA 1M1FA 3ZL7C 3CCUA 3I5RA 5DY9A 2DTHA 1NBEB 2E3HA 3I56A 3CPWA 1N6AA 2YVLA 2NWMA 1Q95G 4IUUA 4ZGJB 1SHFA 4RV0A 3RMQA 2O31A 1K4US 4PJOE 3JB9H 2MK5A 1BBZA 2R5AA 5M9OA 1CKAA 1GCPA 5KE2A 1PKTA 1GRIA 2OTLQ 1KQ2A 4EDUA 4R56A 2DBKA 1LCKA 1HYOA 4LD6A 4OGCA 4JS4A 3G6EA 1YJNA 5HY6A 1CSKA 1Q81U 2EQIA 3LW5E 4C0DC 1S72A 1WJQA 4C8QF 3ZJUA 3O8VA 1V29B 3EFOB 1NZ9A 3PFSA 4MZMA 2GGRA 3REBB 1S3SA 2R5MA 4F7UG 2EAYA 3HHTB 4RCBA 4M7AF 4PJJA 3OQ5A 1YITA 5GAMf 2WSEE 2VUBA 2K79A 1J3TA 5ERGB 2X35A 4E6RA 1N5ZA 1YJWT 2QXFA 3G71T 1UHCA 1WDXA 1Q7YC 2ROLA 3GNGA 2MIOA 3UDCA 2DZ9A 3MCAB 1U1TA 4FYWB 2A28A 1BI3A 4M78F 2YLBA 3QJ6A 3J7AF 3CMEQ 2A3LA 2DX1A 4J9HA 5FW9A 1OYXA 2LNVA 4O5VA 1Q86C 1P92A 2K3BA 1K0XA 4X9DA 1KC8U 2E10A 3QHSA 4L5GA 3LGLA 4OP0A 1RAGB 3EGXA 3MP8A 2CSIA 2F2VA 4ATOA 3VS0A 1TXQA 5KYNA 4C92B 3CCVQ 3SDZA 2AHJB 3M0UA 3TVTA 3UATA 1UFFA 2RF0A 2RM4A 1VYUA 5IHNA 4E47A 3EGDB 4EMHA 3JCMX 1Q81R 1VQ9A 2DFUA 4RG8A 1E32A 2JS0A 1KK7A 1M4ZA 2KXDA 4D8KA 2KQWA 5DLQE 3TQ7P 3H0HA 4Y92A 3G4SQ 2CDTA 2HDAA 1X69A 1Z9QA 4QW2A 2M0OA 2YHTA 2CP6A 2L89A 2YT6A 2YDLA 2OJ2A 4HA8A 4M7AC 1YHQA 2CZ1B 4A4HA 1WLPB 3VJPA 2DRMA 1YNZA 4KUIA 4IKFA 5GAOr 4J6XA 2RI2A 2L3QA 3VUBA 2KNBB 4N4GA 3OB9A 3EHQA 4M7AA 4PJOD 2LDMA 4IUQA 5FLXE 2E6ZA 4M7DG 5GAMj 3CCQA 4Z88A 4M78C 3QSUA 4CC3A 1UB4A 2GTJA 9ATCB 1RL2A 2RNAA 3PTAA 2FEIA 1OU8A 4M78A 4NS5A 3VKIA 1IRXA 1WXUA 5CKEA 3LH0A 4FT4A 3OYLA 3CPWS 1LPLA 2VKNA 5J39A 2QQSA 2CYZB 1D09B 2HCKA 2K7AA 3PE0A 1W1FA 4A54A 4A53A 2JTFA 2QDYB 1WHMA 2RH2A 5CIUA 4M4ZA 1PSFA 1O9SA 2DD5A 3MEUA 2XKOC 1B07A 1CR5A 4C5HA 1VQPQ 2DXBA 2OI3A 3QWZA 1UJ0A 2K2MA 5GJVB 3QZ5B 1QVPA 3A8GB 2LQWA 4BE0A 2J6KA 2PJHB 4PFZA 4RTXA 4M75E 5GAN4 2CZ0B 5KE3A 2EYXA 4GLKA 1QLYA 4RTYA 5KYWA 3QWXX 3GIBA 2CP5A 2JM9A 3JCMf 5CD1A 2EVRA 3WXMB 2SRCA 4CI0C 2P4TA 3GF5A 4A4FA 4KH1B 2G6FX 2K6DA 1MUZA 4PJOB 2JMAA 1Y96B 1AHJB 1AWXA 1YN8A 1N9RA 3CCUT 3D7SB 1G2BA 3G4SA 4DOWA 2CZ7B 3I56T 1K9MU 4ZNXA 2LW6A 2DM1A 2QEXQ 2MYSA 1SSHA 4C8QG 1X75C 1D1AA 1E6HA 2OAUA 5GMKe 3G71Q 2PU9B 3JV3A 5LJ3f 3MO8A 4JZ4A 3JB9D 4E2FB 3C0CA 4Y91A 1WNLA 3CCRA 2DYIA 3MKDA 3G6ET 3CC4Q 3LGFA 1YJNT 2QTVA 1C1AA 4E7KA 2VXEA 1D3BA 5GMKh 3OS0A 2WSFE 1OI1A 5KYWB 1VQ8A 3M58A 3RKYA 3PVLA 1X2KA 4LDXA 2ED0A 2P0KA 4KDLA 3M54A 3S6WA 2P0QA 1NLPC 1RI0A 1YITT 1ZBXA 2RA2A 4JS5A 2K5FA 4KRTA 3JAME 1QVGS 1K8AU 2JZ2A 4BE1A 3RBBB 1R0CB 2K2VA 2C06A 2DL7A 2RQUA 1WLFA 4J9CA 3A8LB 3NMZC 1X43A 3ZBDA 2Q19X 3CPWP 2QQRA 5GAOp 3FC3A 4KO8A 2JM8A 5A0DA 4KUDK 1EFNA 3CC2Q 1HXDA 3S3NA 4JRQA 3S3MA 2MWOA 2JMCA 3Q1JA 3MEAA 3L2ZA 3X26B 5IXBA 3QUIA 4DBRA 1OPLA 1T3SA 2EJ9A 2LNHB 1I8FA 2F5KA 4QQDA 4M75D 1CKBA 3TCJA 2FYKA 5HCKA 1C0MA 2KE9A 4FW2A 1VYTA 1D3BB 2YUPA 1M3AA 2HSEB 5LJ5d 1VQ9T 2C0IA 3SEMA 3QZ9B 1GBRA 3C94A 4OF1A 4JRKA 5LJ3j 3SD4A 4M75C 3OW2A 1M27C 3LGAA 2X3WD 1IGUA 3U23A 2RK2A 2JVVA 4D6WA 2CT3A 1XJWB 4KODA 1KD1R 4DBFA 4M75A 4KGXB 1UDLA 1XTDA 2QGFB 2DIQA 1MHNA 3S3OA 3HSBA 1OV3A 2J6FA 1BCMA 8ATCB 4WF2A 4C0ZA 2DL8A 5GANe 1ZA1B 3JB9J 2JTMA 3M55A 1KC8C 2COWA 1VQOA 4ZN1A 1YJWA 1H3ZA 2KT1A 4QT7A 3I5SA 5CAIA 4OMOA 1G3TA 1TUCA 3HRUA 3CCQT 1N8RR 4GY5A 4F7UF 3OMGA 1LVKA 5GANh 3VRZA 1H92A 3A8HB 1BCOA 7AT1B 3OYCA 2LX9A 2ZPIB 1Q82C 4HT8A 2E5QA 2ZAEA 4K11A 4RTZA 2BZYA 2MM2A 2J06A 2RQVA 3QJYA 4HVUA 2QYZA 1TOVA 4DEYA 3OYGA 5DLOA 5IHKA 2KDSA 2P4RA 4WCIA 1JJ2A 1JXOA 2HKQB 1RAAB 3M4YA 3M5AA 5DYIA 1U8RA 4IUTA 4KGVB 1WIEA 4M75B 2EYZA 4DOVA 5CVIA 3CCUQ 5CKFA 1JEGA 2H3EB 5CO7A 2JN0A 2J7IA 1WYXA 3I56Q 2K5LA 1QWFA 5C1BA 3CF2A 3PMIA 2EQMA 4HCZA 2DPPB 4PJNA 2JV2A 3UA6A 2FVUA 4RG2A 2LMJA 1MMNA 1SKUB 4BB7A 3V7RA 2DXTA 4RUGA 5J26A 3G6EQ 1YJNQ 4HKEA 1K73U 1UHFA 3ASKA 4II1A 4IURA 1R77A 2FPEA 4F7UA 2DKGA 4TVRA 1T3LA 1B34B 2P0PA 2WACA 5GAN7 1YITQ 4C0GA 3I35A 4M7DF 2QDLA 4XU0A 3L2VA 1X6GA 2LCCA 4KGZB 4IIOA 4RMOA 2VWFA 1NLOC 2DL5A 2ZZDA 2YLCA 3E19A 3JCMb 2L8DA 3QXEB 1M1KC 2J6OA 2F69A 3CCRT 5EQJB 2F2WA 2O2OA 2PUOB 3LWHA 1BI1A 1Y71A 2EGAA 3RMSA 2O9SA 3OW2S 4C5IA 1U1SA 1Y57A 4C92F 1JU5C 4JJCA 4F17A 4RCCA 4B6MA 2OTJT 4C8QE 1R7RA 3EG1A 3JCMJ 1I5LA 4YTLA 1VQ9Q 5FTMA 4OVAA 3BDUA 1VQ6A 3L1AA 3HU3A 5GANg 2IVWA 5KYUB 3QC8A 1WX6A 2EW3A 2XDDA 1NM7A 4E7ZA 4EIKA 1PWTA 1X6BA 2NUPB 1YHQQ 4M78E 1WHJA 2DXCA 2XI9A 1ZQ1A 4OMPA 2MWPA 1YP5A 1H641 2PVDB 4ZGEB 3CEYA 3MEWA 2YSQA 5FU7C 1WQWA 4X1VA 3CCJA 2ZPBB 1XOVA 4LE9A 1JJ2S 1DJ7B 4M7DA 3L2RA 3CCQQ 2D9TA 3CXCA 1K8AC 3PNWC 4MDXA 1R0BG 3EHRA 2CH4W 2EQUA 1WZOA 1MMAA 2I0NA 1IXDA 1RLPC 4BE2A 3VYGA 2M16A 3PMTA 2YRDA 2JS2A 5L8RE 1M90C 4XTZA 1VQOT 2IG0A 5AYFA 3NGPA 1NE8A 1U5SA 3KUFA 1SRLA 1WHGA 1PG5B 5I2SA 4ORZA 6AT1B 2B86A 5ECAA 3RNJA 1SF9A 2FZKB 5I11A 2MAMA 1XQHA 4C5GA 3HPWA 3JSCA 2HZYA 1FYNA 5FWCA 5GMKm 1NG2A 3C12A 4KT0E 1KIKA 5CCXA 3OW2P 5FROA 3HU2A 4C8QD 5I22A 2BZXA 3FPUA 1CZ5A 4PFPA 2FG0A 1UEBA 3THKA 4C5EA 4J7FA 1VQKT 1VUBA 5D6WA 3ULRB 2RI5A 4M7AD 4M77F 2E6NA 5FTJA 3MJXA 5GAN2 4C0DB 2K9GA 5GAOm 4C8QC 3VS6A 5HK3A 3VS4A 1KHIA 4GLMA 3C4SA 3QO3A 1ZSGA 2H8HA 2H3JA 1BU1A 3GP8A 3RDVA 2CZ6B 4C8QA 1XNIA 5HK0A 4ARIA 2W10A 3H41A 4M78D 1FMWA 2E1HA 2L2PA 2M02A 4Y28E 1I9GA 5GLFA 3O5ZA 4N0AC 1YWOA 2DRKA 2RHZA 1VQ5A 3I55T 3CCRQ 3GOXA 1RAEB 1W70A 4FSSA 1IO6A 4Z02A 1FX7A 2KBTA 2LQNA 3SHWA 2VC8A 4N0AA 5GAMd 3UPUA 4RKUE 4JDSA 4J9GA 1VQ8Q 1WHLA 3EGXB 4IIMA 1D1BA 4XQ3A 5CR2A 1JJ2P 1FWZA 5CQYA 1D1CA 2YUQA 4AFZC 2DBMA 3E2UA 2OTJQ 3JCMc 2G3RA 4AT1B 2X4YA 3CCMA 5I2MA 1RUWA 2KI7A 1SHGA 2CP0A 3OYFA 2K57A 2KSSA 2COYA 4C92G 3PIOA 5FU6C 2V1QA 2FHDA 1BI0A 1UG1A 2GFUA 3EAEA 4BI3A 2PVGB 4PK4A 5EG2A 2RI3A 1D0XA 5LL6S 1NJIC 4LUDA 2HNIA 1WJSA 4LDWA 4C8QB 5FTKA 5EPPA 3VRYA 4RTVA 2MMPA 2L5QA 3SWNC 1ZSZC 1ZC1A 2P84A 3EFSA 1NYGA 2E3IA 5KCHA 4XTVA 4M7AB 2EWNA 1EIFA 1M2VA 3SWNA 1ZSZA 4BI8B 2KY9A 2KAFA 2WSCE 2K3YA 3TEEA 3MB5A 1I4K1 2O4XA 4X34A 5IXFA 1G8XA 4PL6A 1SG5A 4J6WA 1GFDA 2CH4A 1R8OB 4OB0B 2KK4A 2LP5A 1VQ6T 4NOYA 2R57A 2ZPEB 4M78B 2RHIA 3NHNA 2K4YA 3JRZA 3DLMA 2HL5C 2Z0WA 3X20B 2KMTA 3V8KA 2O01E 2EKHA 2RHXA 4FT2A 2L3PA 2GQIA 4XTWA 1YIJA 2RQTA 4XTUA 3HFNA 2XIDA 2E4HA 2EQJA 4A4GA 2YRCA 4O6JA 2JXBA 3NTIA 1PRMC 1VQOQ 1LNXA 2E64A 1YJWQ 2RMOA 3JCMW 1IHVA 3M4GA 3CCJT 2COZA 2D0QB 4QKUA 4Z89A 3HFOA 3HKSA 1TG0A 2BE9B 4LXCA 2DD4A 1GFCA 3SWNB 2RO0A 2LZ6B 2PUKB 1ZSZB 1S1NA 4J9FA 5GANf 3CCET 3ZFJA 2DZCA 4AS1A 3PVQA 2DEUA 2OTJA 1KD1U 4XU3A 3CMAT 5D7UA 2GBQA 2HBPA 2DETA 1JQQA 2QA4T 1VQNA 2LT1A 4FW1A 4FM4B 5C0MA 3CBOA 1WGSA 1HJDA 3SB2A 3HU1A 1OX8A 1PCXA 2CKKA 4BY6C 1I07A 1N8RU 2Q1CX 2PVOB 4OMMA 2AZVA 5C6SA 3JCMQ 3JCMd 3FJPA 4PJOG 3IQLA 2LQ8A 2NYSA 4F7UE 1OZ3A 1VQ7A 1Q81C 3INZA 4M77G 4OB1B 4BD3A 2M1HA 1WJRA 5AT1B 3CC7T 4L59A 1K9AA 2CREA 1MV0B 4LNPA 2DIGA 2HL3A 3VYHB 1HK9A 4LD9K 1QDNA 2LTOA 3MPUB 4RTWA 2D1XA 2LJ3A 2GQVA 1NPRA 4AQ7A 3BW1A 1GXIE 2QAZA 5LJ3d 1G3WA 2DNUA 2Y90A 1PHTA 5LJ5e 2A0FB 1EZZB 1KHCA 1OZ2A 2Y4YA 4CC4B 2X4XA 4MDWA 1RAHB 1C6VX 4JPBW 3OYDA 1Q86U 2FZGB 2NUTA 2V8KA 5LJ3e 5GANj 1QWEA 2JTEA 2EYQA 3VS3A 5LJ5h 5GMKl 1VQ5T 2ZGWA 5D6XA 1WQ7A 1M5Q1 2DO3A 3FJ5A 1IZ6A 2KVQG 1YI2A 1YJ9A 2E12A 1QMCA 4J9BA 3OSVA 3NPFA 2W0ZA 1B7TA 4E7LA 4DBHA 1QQJA 5LJ3h 1SRMA 4QVDA 1Y0MA 3FB9A 3QQ7A 1UTIA 2MI6A 2FL7A 4PJLA 3AHUA 3GBQA 5KYXA 3CCMT 5GAOl 3P8HA 2OTLT 1I1JA 2RJEA 2MM0A 4QQ6A 3A8OB 2KYMA 2RQWA 2D8JA 1BKBA 2ZPGB 3TSZA 3OYKA 3KXTA 4ZN3A 3VUZA 1WI7A 3CD6T 2V8JA 1NPPA 1VQ6Q 4M7DE 1NEGA 3FLGA 2XHCA 1VQKA 3FIFA 1Q7YR 2LQKA 2RPNA 2C0TA 1ZBJA 1WHKA 1QCNA 1K76A 2EJGA 2GFAA 1WPYA 2NUTB 3OYNA 4OB3B 2IIMA 1UUEA 3HRTA 3J81E 2DL4A 3VS5A 2K3XA 1QCOA 4WTOB 1Q86R 3R6OA 2K5IA 3QYHB 3CCJQ 5CQXA 4C92E 3QPHA 2A7YA 2L0AA 3CCSA 3RKWA 4ZTFA 2PTKA 1ARKA 3OBWA 3I55A 4PLLA 2CUDA 3VS7A 1GBQA 4FYXB 3QQ8A 2NLUA 1OQKA 2YXYA 5IT9E 3EG9A 1JO8A 4AFQC 1V1CA 5GAN8 4FIBA 5IH2A 4HVVA 1M2OA 2RJCA 1X6OA 2CS7A 2L3RA 1YIJT 1AOJA 3P8BB 4PFOA 2LX7A 4LUEA 2HAXA 2QA4Q 3QIIA 2QQBA 4HCKA 1MGQA 3V8LA 4BUGA 1VQMA 5KYYA 1PKSA 1KSWA 2PQWA 1M8MA 3E1SA 4KH0B 3BDLA 2YUNA 3EH1A 2VASA 4A4KA 1M3BA 1QCFA 1SPKA 1MMDA 4JRIA 1JBMA 4JJDA 5GAN6 1W4SA 2I2LA 1AWJA 2ZCFB 5FTNA 2CGHA 4JJBA 1A0NB 1BI2A 2CSQA 4F14A 4E7HA 4HCBA 2EFIA 3OS2A 3E9FA 3X28B 2DERA 1OU9A 4PKCC 1RADB 3CCLA 1ZA2B 5FRMA 4RTTA 3L2UA 4AMCA 2QTXA 4AG1C 5LJ5g 1VQNT 1K9MC 2X51A 4C0FA 1FMVA 2DK3A 1Y07A 2GTOA 2JOYA 2BTTA 3G7ZA 1W2BA 5J3BA 1KFZA 5IAYA 2X3XD 3M57A 4F7UB 5LJ3g 4AG2C 4M7DD 4EMGA 3OMCA 1TUGB 2AK5A 1X01A 2XMFA 1Y7XA 3EFOA 1NJIR 3DLLA 3OYMA 3C95A 2RD1A 5KYYB 2OX7A 1VQ7T 3M56A 1QW1A 5C18A 1VQLA 1E6GA 1FXXA 4M7DC 1B3QA 2LC4A 1QVFA 5DYGA 1W6XA 1VQ5Q 1QP3A 5CK9A 2XU8A 5CCAA 3EG3A 1KD1C 4B9XA 4B9WA 1QCSA 3NTKA 2XG8D 5GAOn 1BIBA 2HQEA 3DKMA 1AZGB 4KBMB 2RHUA 4PJMA 2CP7A 2DAQA 3UA7A 1N27A 2CUBA 2DJZA 3A1PA 3DB3A 3KFVA 4M77E 3P8DA 2KT8A 3QKJA 4C92C 3CCMQ 1WXTA 4NL3A 3CCEA 1KG1A 1N8RC 1AVZC 3EH2A 3ME9A 3ZEHA 3CMAA 1IHWA 4MMKA 4PNOA 4C92A 2QQ9A 3CD6Q 2QA4A 1OEBA 3SFMA 4ME7A 5FTLA 4J9DA 3OS5A 3EGDA 3RIRA 1Z9ZA 4LN2A 4AFSC 1HD3A 2V26A 1YI2T 1OPKA 1I5OB 1YJ9T 3QDRB 1UE9A 2RQRA 1F1BB 4GBQA 2ED1A 1UJYA 4PLIA 5D6YA 1HSQA 2QEXT 2QASA 4D8DA 1IREB 1WHHA 5GJWB 2YUJA 4M7DB 4KDIA 2EYWA 2DL3A 3ZGZA 1BYMA 2DA9A 2DYBA 3GNFB 3BE3A 5FU7B 3CC7A 3CC4T 4JRPA 4XTYA 3DB4A 2YRVA 2FO0A 3OY9A 2HQHA 2EBPA 4PJOF 4DEXA 1I0CA 3M0SA 5CKDA 3RKXA 2RK1A 2RN8A 1TUDA 4Z8AA 2YUOA 2HQXA 4EMKC 4F04B 3WVEB 2M9UA 3FRNA 3PT9A 2XK0A 3H0IA 2JT4A 4CC2A 1YCSB 2F5TX 2AKLA 4ZGDB 1VIEA 3RR6A 1YIJQ 1VOMA 1WFWA 4EMKA 2YWWA 3EFRA 4OB2B 1KQ1A 2EKOA 4OMLA 2O9VA 1M9SA 1PRLC 1Q82U 5CCBA 3V7SA 4QQGA 3TSWA 3HRSA 3CCST 2CT4A 3CC2T 2ENMA 1WXBA 1IB8A 4XU1A 2F2XA 1M3CA 4FYYB 1W2BS 4ELZC 2GF7A 1QVGA 1X2QA 1PSEA 2Q1DX 4RTUA 2X4WA 1CZ4A 5GAN5 4ARCA 1UGQB 4M77D 5GAMe 2OTLA 5L23A 2QI2A 3QBYA 1VQMT 1VQNQ 3CBPA 4MZPA 3OA6A 1QVFS 2J05A 3V7CA 4LDUA 1VQ4T 3M0PA 3N5BB 4MMLA 1G83A 5GAOq 3CD6A 4PJOC 1TH7A 3JCMP 1M8VA 1KC8R 4IUPA 3JCMV 1SSFA 5GAN3 3CXCS 4E7JA 4JLIA 2DTIA 3BY7A 4M77C 3OYBA 5GAMh 3HTRA 5DM7R 3F70A 4EMKB 2AKKA 3NTHA 1T0JA 4PJOA 4JZ3A 3R6NA 1Y96A 2D8HA 2DVEA 4FU6A 1VQ7Q 2AIRB 4M77A 3RESA 1K73C 2ECZA 2V1RA 1ZHIA 2X4JA 3CCLT 1BIAA 1Q82R 3JB9I 8AT1B 5FWBA 3OSSC 1MNDA 3M0RA 4VUBA 4XTXA 1X27A 2SEMA 1K0SA 3JB9F 5CKHA 3VV0A 3CMEA 3META 3OYAA 3GPLA 4MZTA 1RABB 4IUVA 3A8MB 3CBMA 1BK2A 5EC7A 3FEOA 1M1KU 2XDPA 3L2WA 4R0KA 1V76A 2GCXA 2KRSA 4DQ2A 2PWYA 2LCSA 4BDZA 2NUZA 2MCNA 1VQLT 1O54A 2EGEA 3CCVA 5FRNA 1O75A 1GL5A 2D6FA 3H8ZA 3PGGA 5GMKj 1M30A 4BDYA 3BQBA 5FU6B 1YI2Q 1KQSA 1YJ9Q 2VGNA 4OMFB 4KLNA 4M77B 5LJ5f 1U3OA 4OMQA 2QQAA 1VA7A 3A5ZB 2C0OA 1VYVA 3KBGA 5KCOA 2CP3A 2VB6A 3MP6A 4J9EA 1M2VB 5A0LA 1MNEA 3OBYA 3M9QA 5B6CA 3OYJA 1JRIA 1W2BP 1MMGA 2O4XB 2LCLA 3I9QA 1AD5A 2LT4A 5CKBA 3QYGB 4M7AG 4KULA 1LOJA 2DXUA 1UGPB 2DJQA 2EQKA 4LDVA 2IPOB 3FPTA 1S72T 2CP2A 4M75F 3EGUA 2RJDA 3PIPA 1VQKQ 3UF4A 2OAWA 2E41A 4P5NA 2DE0X 3EG0A 1ZX6A 4JUVA 1AEYA 1U06A 1M1KR 2Y4XA 1G3SA 4M78G 1QVFP 3TREA 4LDYA 2XICA 5IN1A 2LJ1A 2FPDA 1RLQC 4HCCA 2QK0A 4R55A 2A37A 1H8KA 3CXCP 2GNCA 1KJWA 2Q18X 2ABLA 1WA7A 2HMAA 2VVKA 4NL2A 3E9GA 1ZLMA 3TIWA 3CCSQ 1OULA 2B8AA 1VQPA 3JCMe 1M1GA 2LRQA 3I55Q 2BKDN 5A2QE 4BI4A 3NFCA 5GAMg 1K9MR 4J7IA 3ZJTA 1M90U 3T9NA 4CRIA 1YBYA 2HKNA 2L3SA 3BFMA 2A08A 1QP2A 1E7OA 3QG1A 1Q7YU 3JCMh 3HL8A 2HD0A 3M0TA 4BACA 4N4HA 1T0HA 3L2QA 2XDBA 1PD0A 5LJ5j 3M53A 1EX4A 1G5VA 2HEQA 4E7IA 2XD0A 1MV3A 3LHDA 2M0YA 1FMKA 1VQMQ 2ZPHB 1YCYA 3GLXA 4OGEA 4N4IA 3QWYA 2KEAA 2FPFA 3UWNA 1VQ4Q 2BUDA
chains in the Genus database with same CATH topology
4C5GA 3HPWA 3JCMf 5GAN6 3JSCA 5CD1A 3UT1A 1W4SA 2I2LA 5GMKm 2VXFA 2ZCFB 3WXMB 5GANd 4CI0C 2V8IA 3C12A 3V8JA 5FTNA 2CGHA 4DA4A 4KT0E 3OS1A 2P4TA 1BI2A 5CCXA 5FROA 4JJNK 4E7HA 3HU2A 1UGRB 4HCBA 4C8QD 2EFIA 4ELYC 3OS2A 3FPUA 3E9FA 3X28B 2VV5A 4BY6B 1YHQT 1CZ5A 1UEBA 3GF5A 4PKCC 4A4FA 3CCLA 1LJOA 4C5EA 4J7FA 5FRMA 4PJOB 1Y96B 1AHJB 3L2UA 1VQKT 1VUBA 1JB0E 2QTXA 5D6WA 1N9RA 2QEXA 2RI5A 5LJ5g 3CCUT 4M7AD 4M77F 2E6NA 5FTJA 3G4SA 5I21A 1VQNT 1K9MC 3WVDB 2CZ7B 3CPFA 4C0FA 4DOWA 5GAN2 4C0DB 3I56T 1VIFA 3G71A 2Q1AX 2DK3A 2LW6A 1Y07A 5GAOm 4C8QC 2DTOA 2JOYA 2E70A 5HK3A 3G7ZA 4JRIA 1W2BA 5J3BA 4C8QG 1KHIA 1X75C 5IAYA 4FL6A 3C4SA 3M57A 2OAUA 4F7UB 3QO3A 5GMKe 5LJ3g 2PU9B 5LJ3f 4M7DD 2H3JA 3MO8A 3JB9D 3GP8A 4EMGA 3CC4A 3OMCA 2EIFA 2CZ6B 4JLGA 4C8QA 1XNIA 3OYHA 1X01A 5HK0A 4ARIA 1Y7XA 4Y91A 3DLLA 4M78D 1I81A 1KQSS 3OYMA 4J83A 1WNLA 3C95A 3CCRA 2E1HA 2R58A 2RD1A 3G6ET 4X9CA 4Y28E 2LVMA 1I9GA 5GLFA 3LGFA 1YJNT 1VQ7T 4N0AC 4XAXB 5HKCA 3M56A 2VXEA 4E7KA 1QW1A 5C18A 1D3BA 5GMKh 2MF2A 2RHZA 3H6ZA 1VQLA 1VQ5A 3I55T 3OS0A 2WSFE 1FXXA 3GOXA 4M7DC 2LC4A 1OI1A 4Z02A 4J8OA 1VQ8A 1FX7A 1QVFA 3M58A 3RKYA 3JB9G 3ER0A 4A4EA 2VC8A 1B34A 4N0AA 4LDXA 5DYGA 5GAMd 1QP3A 2P0KA 5CK9A 4RKUE 4JDSA 3OYEA 3M54A 2JNGA 2XU8A 3S6WA 4KDLA 5CCAA 2P0QA 1RI0A 1KD1C 4ZTJA 1YITT 1ZBXA 4XQ3A 3RUXA 4B9XA 2RA2A 4B9WA 3NTKA 5CR2A 4JS5A 1QCSA 1FWZA 2K5FA 5CQYA 3JAME 2XG8D 5GAOn 1QVGS 1BIBA 1K8AU 3X25B 2HQEA 2JZ2A 4UC4A 2VGMA 4BE1A 3G6EA 3DKMA 4XK8E 2K2VA 3JCMc 2G3RA 2C06A 2X4YA 1WLFA 4KBMB 3A8LB 3LX7A 3CCMA 2RHUA 3CC2A 5I2MA 3LYIA 2DAQA 3ZBDA 2Q19X 3CMET 2QQRA 5GAOp 3FC3A 1N27A 2DJZA 4QVCA 3DB3A 4KO8A 5A0DA 3OYFA 4M77E 2K57A 2KSSA 3P8DA 3QKJA 4C92C 4KUDK 4NL3A 3CCEA 1HXDA 2RHYA 1KG1A 4C92G 1N8RC 3S3NA 3PIOA 5FU6C 4JRQA 3S3MA 2FHDA 4Q5WA 2MWOA 3ME9A 1BI0A 2VYTA 2GFUA 4J5YA 3Q1JA 3EAEA 3ZEHA 2PVGB 3MEAA 3L2ZA 4BI3A 5EG2A 2RI3A 3CMAA 4MMKA 4PNOA 3X26B 3M59A 4C92A 2QQ9A 3QUIA 5LL6S 3VU3C 1NJIC 2FB7A 2QA4A 1NJIU 2HNIA 1WJSA 3LLRA 3SFMA 4LDWA 4C8QB 5FTKA 2EJ9A 4ME7A 1UGSB 3CCVT 1I8FA 2F5KA 5EPPA 5FTLA 4QQDA 4HT9A 3OS5A 3J80E 2BIVA 2MMPA 3RIRA 2L5QA 3SWNC 1YI2T 4M75D 1ZC1A 1YJ9T 3QDRB 3TCJA 2FYKA 3EFSA 5KCHA 3MHXA 4XTVA 4M7AB 1VQ4A 1D3BB 2EWNA 5LJ5d 3FDRA 3X24B 1EIFA 3SWNA 4PLIA 5D6YA 1VQ9T 4BI8B 2QEXT 2KY9A 3OYYA 2KAFA 4V2SA 2WSCE 2K3YA 3QZ9B 3TEEA 2ZPFB 3G4ST 3MB5A 1I4K1 3C94A 4XU2A 4OF1A 2O4XA 4JRKA 4X34A 3JCMg 5LJ3j 4CQNA 3SD4A 4M75C 1IREB 4PL6A 2YUJA 3OW2A 4J6WA 4M7DB 4KDIA 1R8OB 3LGAA 4OB0B 4M75G 2KK4A 1BYMA 3ZGZA 3FPRA 2RK2A 2JVVA 3GNFB 4D6WA 1VQ6T 4NOYA 2R57A 5FU7B 1N9SA 3OYIA 2ZPEB 4M78B 2RHIA 3CC7A 4KODA 3CC4T 2K4YA 4M75A 4XTYA 1G3YA 3DB4A 2YRVA 3JRZA 1XTDA 4JRPA 4QVZA 3DLMA 2DIQA 1MHNA 3S3OA 3HSBA 3X20B 2KMTA 4J6YA 3OY9A 3V8KA 2RB6A 2O01E 4PJOF 2DEQA 2RHXA 4WF2A 4FT2A 4C0ZA 5CKDA 5GANe 3RKXA 2RK1A 3JB9J 4XTWA 2JTMA 3M55A 1KC8C 1YIJA 1VQOA 2JUFA 2HQXA 4EMKC 5GMKi 2E65A 3WVEB 4ZN1A 4XTUA 2M9UA 1YJWA 3HFNA 3FRNA 3PT9A 2XIDA 1H3ZA 2XK0A 5CAIA 2EQJA 4A4GA 1VQ8T 3ZJVA 1G3TA 2F5TX 3HRUA 4O6JA 4ZGDB 3CCQT 1VIEA 3NTIA 1LNXA 2E64A 4GY5A 4F7UF 3JCMW 3M4GA 3L42A 4EMKA 3CCJT 3OMGA 5GANh 3EFRA 2D0QB 4OB2B 1KQ1A 3A8HB 2EKOA 3HFOA 3HKSA 3OYCA 2LX9A 3MEVA 2ZPIB 1M9SA 1Q82C 1Q82U 4HT8A 5CCBA 3V7SA 4QQGA 2E5QA 2DD4A 3HRSA 3CCST 4M7AE 3CC2T 2MM2A 2RJFA 5A0GA 4EPCA 4XU1A 4L6V5 3SWNB 3QJYA 2RO0A 2PUKB 2EJFA 3HP9A 1W2BS 5GANf 3URGA 3OYGA 3CCET 3LWIA 3ZFJA 4ELZC 5DLOA 2KDSA 1O54A 1VQPT 4FSXA 3UPUA 2DZCA 1JJ2A 2GF7A 3MP1A 4AS1A 3RERA 3M4YA 2B25A 3M5AA 5DYIA 1U8RA 5KH6A 1KD1U 1QVGA 4XU3A 2OTJA 3CMAT 4C92D 4IUTA 1M1FA 2HBPA 1PSEA 2Q1DX 3CCUA 2X4WA 5DY9A 2QA4T 2DTHA 1CZ4A 5GAN5 4M75B 1VQNA 2LT1A 3I56A 3CPWA 1N6AA 4DOVA 4ARCA 2YVLA 4ZGJB 4IUUA 4FM4B 5CVIA 5C0MA 4RV0A 3CBOA 3RMQA 1UGQB 1WGSA 4M77D 5CKFA 5GAMe 2OTLA 4PJOE 5CO7A 2JN0A 2QI2A 3SB2A 3QBYA 1VQMT 3CBPA 4MZPA 2K5LA 3HU1A 3OA6A 1QVFS 3JB9H 5C1BA 2CKKA 3V7CA 4LDUA 1VQ4T 3CF2A 2R5AA 3PMIA 5M9OA 2EQMA 4BY6C 5KE2A 4HCZA 3N5BB 4MMLA 5GAOq 1N8RU 1KQ2A 2DPPB 2Q1CX 3CD6A 2JV2A 2PVOB 4EDUA 4PJOC 4R56A 1TH7A 2FVUA 4RG2A 3JCMP 1M8VA 5C6SA 3JCMQ 3JCMd 3FJPA 4IUPA 3JCMV 4PJOG 1SSFA 4LD6A 4OGCA 5GAN3 3CXCS 2LQ8A 4JLIA 2DTIA 3BY7A 4M77C 3OYBA 4F7UE 5GAMh 4BB7A 1OZ3A 5DM7R 3F70A 5HY6A 3V7RA 4EMKB 1YJNA 1Q81C 1Q81U 1VQ7A 3INZA 3LW5E 3NTHA 4M77G 4OB1B 4C0DC 1S72A 4BD3A 1WJQA 2DXTA 4C8QF 4PJOA 3O8VA 3ZJUA 1Y96A 2DVEA 2M1HA 1V29B 1WJRA 5J26A 1NZ9A 4FU6A 3PFSA 3CC7T 4MZMA 4HKEA 4M77A 1S3SA 4L59A 3RESA 1K73C 1K73U 2R5MA 4F7UG 2EAYA 3ASKA 1ZHIA 2X4JA 3HHTB 4RCBA 3CCLT 1BIAA 4M7AF 3OQ5A 4II1A 3JB9I 1YITA 2DIGA 4IURA 5GAMf 2WSEE 3VYHB 1HK9A 2VUBA 3OSSC 4F7UA 4LD9K 1QDNA 2DKGA 2LTOA 5ERGB 2X35A 4TVRA 4VUBA 1B34B 2P0PA 2WACA 5GAN7 1YJWT 2GQVA 2QXFA 4XTXA 4C0GA 3G71T 1NPRA 1Q7YC 4AQ7A 3BW1A 4M7DF 1GXIE 3JB9F 3GNGA 4XU0A 5CKHA 5LJ3d 3L2VA 3VV0A 3CMEA 1G3WA 2LCCA 2DZ9A 2Y90A 3MCAB 3META 3UDCA 3OYAA 5LJ5e 4RMOA 1U1TA 3GPLA 1KHCA 4MZTA 1BI3A 1OZ2A 2Y4YA 4M78F 4IUVA 2X4XA 2YLBA 3A8MB 2ZZDA 2YLCA 3E19A 3QJ6A 4MDWA 3J7AF 3CBMA 2A3LA 3JCMb 1OYXA 2L8DA 3QXEB 1M1KC 1M1KU 3FEOA 2XDPA 2F69A 3CCRT 2LNVA 4O5VA 3OYDA 3L2WA 1Q86C 1Q86U 5EQJB 2GCXA 2PUOB 4DQ2A 2V8KA 5LJ3e 3LWHA 5GANj 1P92A 2PWYA 2EYQA 1BI1A 4BDZA 1Y71A 4X9DA 1KC8U 2E10A 5LJ5h 3QHSA 4L5GA 3LGLA 4OP0A 3RMSA 5GMKl 3CCVA 1VQ5T 1VQLT 2ZGWA 5D6XA 1WQ7A 3OW2S 5FRNA 1O75A 1M5Q1 4C5IA 2DO3A 3MP8A 1U1SA 1IZ6A 2KVQG 1YI2A 4ATOA 1YJ9A 2E12A 4C92B 2D6FA 3H8ZA 4C92F 3PGGA 5GMKj 3SDZA 3OSVA 4BDYA 2AHJB 4RCCA 3BQBA 4E7LA 5FU6B 2OTJT 5LJ3h 4C8QE 4QVDA 2RM4A 1R7RA 1KQSA 1K9MU 3JCMJ 4E47A 3FB9A 3QQ7A 2VGNA 4OMFB 2MI6A 4EMHA 3JCMX 1VQ9A 4RG8A 1E32A 4KLNA 4M77B 5LJ5f 2FL7A 1I5LA 3AHUA 4YTLA 2QQAA 3A5ZB 1M4ZA 2KQWA 3KBGA 5KCOA 3CCMT 5DLQE 5GAOl 3P8HA 3MP6A 2OTLT 5FTMA 2RJEA 4OVAA 3BDUA 5A0LA 2MM0A 3OBYA 1VQ6A 4E7JA 3L1AA 3A8OB 4QQ6A 3M9QA 3HU3A 5B6CA 5GANg 2IVWA 4QW2A 3OYJA 2M0OA 2YHTA 1JRIA 3QC8A 2L89A 1BKBA 2ZPGB 3OYKA 2O4XB 4HA8A 3KXTA 4M7AC 2LCLA 3VUZA 4ZN3A 2XDDA 1YHQA 2CZ1B 3CD6T 4A4HA 2V8JA 1NPPA 4M7DE 2LT4A 5CKBA 3FLGA 3QYGB 3VJPA 4M7AG 2XHCA 4KULA 4KUIA 4IKFA 5GAOr 4J6XA 1LOJA 2RI2A 3FIFA 2DXUA 1VQKA 1UGPB 3VUBA 4N4GA 2LQKA 4M78E 3OB9A 2EQKA 4LDVA 4M7AA 3FPTA 1S72T 4PJOD 2DXCA 2XI9A 4M75F 2LDMA 1ZQ1A 4IUQA 2MWPA 2RJDA 5FLXE 3PIPA 1H641 2PVDB 2E6ZA 4M7DG 4ZGEB 5GAMj 3CEYA 3MEWA 2EJGA 2E41A 2GFAA 3CCQA 1WPYA 5FU7C 4P5NA 3OYNA 4M78C 1WQWA 4JUVA 4OB3B 3QSUA 3HRTA 2Y4XA 3J81E 1G3SA 4M78G 3CCJA 2K3XA 1XOVA 1UB4A 2ZPBB 1DJ7B 3TREA 3L2RA 1JJ2S 4M7DA 3R6OA 2K5IA 4LDYA 1RL2A 2XICA 2D9TA 3QYHB 5IN1A 3PTAA 3CXCA 1K8AC 3PNWC 4M78A 4NS5A 4MDXA 4HCCA 3VKIA 5CQXA 4C92E 5CKEA 4R55A 3LH0A 3QPHA 2A7YA 4FT4A 3OYLA 3CCSA 3RKWA 3CPWS 4ZTFA 2Q18X 2EQUA 3OBWA 5J39A 3I55A 2QQSA 2CYZB 4NL2A 3E9GA 4A54A 4A53A 2JTFA 4PLLA 3TIWA 2QDYB 4BE2A 3VYGA 2M16A 2B8AA 3PMTA 3QQ8A 1VQPA 2NLUA 2RH2A 3JCMe 5CIUA 1M1GA 2LRQA 1PSFA 1O9SA 2DD5A 2BKDN 5IT9E 3MEUA 5A2QE 4BI4A 3NFCA 2XKOC 5GAMg 1CR5A 4J7IA 4FIBA 5GAN8 4JS4A 4C5HA 3TU4K 3ZJTA 5L8RE 1M90C 1M90U 2DXBA 2RJCA 1X6OA 3T9NA 2CS7A 2L3RA 3QWZA 4XTZA 4CRIA 1VQOT 1YIJT 1YBYA 2IG0A 5AYFA 3BFMA 3QZ5B 1QVPA 3P8BB 1QP2A 3A8GB 1NE8A 3KUFA 3QG1A 1Q7YU 3JCMh 3HL8A 2HD0A 4BACA 2HAXA 4N4HA 3QIIA 2QQBA 3V8LA 1MGQA 5I2SA 4BUGA 1VQMA 3L2QA 2XDBA 5LJ5j 2PQWA 4BE0A 3M53A 3E1SA 1G5VA 2PJHB 4E7IA 2XD0A 3LHDA 4M75E 5GAN4 2CZ0B 5KE3A 3BDLA 2ZPHB 4GLKA 1YCYA 3GLXA 4OGEA 4A4KA 4N4IA 3GIBA 2MAMA 1XQHA 3UWNA 1JBMA 2BUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5G A;  3UT1 A;  1WJS A;  3LLR A;  5KCO A;  4IUU A;  5C0M A;  2F5K A;  3P8H A;  3MP6 A;  4QQD A;  2BIV A;  1WGS A;  2RJE A;  4OVA A;  3OS1 A;  3QBY A;  4QQ6 A;  3M9Q A;  5FRO A;  4E7H A;  4QW2 A;  3OYJ A;  3OA6 A;  2M0O A;  2CKK A;  2EFI A;  2L89 A;  5KCH A;  3OS2 A;  2R5A A;  3E9F A;  3PMI A;  2EQM A;  2O4X B;  5M9O A;  3OYK A;  5KE2 A;  4A4F A;  4HCZ A;  4A4H A;  3FDR A;  4C5E A;  5FRM A;  3FLG A;  4EDU A;  3L2U A;  4RG2 A;  4PLI A;  5D6Y A;  5C6S A;  4IKF A;  4IUP A;  5D6W A;  1SSF A;  2K3Y A;  2RI2 A;  2RI5 A;  4LD6 A;  4E7J A;  4N4G A;  2E6N A;  3OYB A;  1OZ3 A;  3F70 A;  3OB9 A;  2EQK A;  2O4X A;  4X34 A;  3SD4 A;  3NTH A;  2LDM A;  4PL6 A;  4IUQ A;  4BD3 A;  1WJQ A;  2MWP A;  2RJD A;  3O8V A;  2M1H A;  1WJR A;  5J26 A;  3CEY A;  3MEW A;  2GFA A;  3PFS A;  4FU6 A;  2R57 A;  3C4S A;  4FL6 A;  5IAY A;  4L59 A;  3OYN A;  3OYI A;  2RHI A;  3MO8 A;  2R5M A;  3DB4 A;  2YRV A;  3ASK A;  3OMC A;  2K3X A;  3DLM A;  2DIQ A;  4QVZ A;  1MHN A;  1XNI A;  3L2R A;  3S3O A;  3OQ5 A;  4II1 A;  3OYH A;  3OY9 A;  2DIG A;  4IUR A;  2D9T A;  5IN1 A;  3OYM A;  2RHX A;  2R58 A;  3PNW C;  4NS5 A;  2LTO A;  2X35 A;  2LVM A;  3LGF A;  3LH0 A;  2WAC A;  4E7K A;  2HQX A;  3OYL A;  3H6Z A;  2RHZ A;  4ZTF A;  1H3Z A;  2XK0 A;  2EQU A;  3OS0 A;  3GOX A;  2EQJ A;  5J39 A;  4A4G A;  2QQS A;  3L2V A;  1OI1 A;  2LCC A;  4Z02 A;  3MET A;  3E9G A;  3OYA A;  3NTI A;  2JTF A;  4PLL A;  4BE2 A;  4GY5 A;  1KHC A;  4A4E A;  1OZ2 A;  2M16 A;  2B8A A;  3PMT A;  3L42 A;  2NLU A;  4IUV A;  2P0K A;  2X4X A;  3OYE A;  5CIU A;  2LRQ A;  3OMG A;  3QJ6 A;  3S6W A;  2BKD N;  1RI0 A;  3MEU A;  4ZTJ A;  4B9X A;  1OYX A;  2L8D A;  4B9W A;  2EKO A;  3NTK A;  3FEO A;  2XDP A;  3OYC A;  3L2W A;  3MEV A;  4C5H A;  3OYD A;  2HQE A;  2JZ2 A;  2RJC A;  2E5Q A;  4QQG A;  2L3R A;  4UC4 A;  4BE1 A;  4BDZ A;  4CRI A;  2G3R A;  2IG0 A;  2X4Y A;  3LX7 A;  2RJF A;  2RHU A;  3LGL A;  5D6X A;  5FRN A;  3KUF A;  3LYI A;  2DAQ A;  2RO0 A;  4C5I A;  3MP8 A;  4BAC A;  4N4H A;  2QQR A;  3QII A;  3FC3 A;  1N27 A;  3DB3 A;  3L2Q A;  3OYF A;  3OYG A;  3H8Z A;  2PQW A;  3P8D A;  3QKJ A;  4BE0 A;  1G5V A;  4E7I A;  4BDY A;  2GF7 A;  2RHY A;  3MP1 A;  4E7L A;  3S3N A;  5KE3 A;  3BDL A;  3S3M A;  2FHD A;  4Q5W A;  5KH6 A;  2MWO A;  3ME9 A;  4IUT A;  2VYT A;  2GFU A;  3Q1J A;  3EAE A;  3ZEH A;  3MEA A;  4N4I A;  2RI3 A;  3UWN A;  2X4W A;  2BUD A; 
#chains in the Genus database with same CATH topology
 3UT1 A;  2VXF A;  2KYB A;  5GAN d;  2V8I A;  3V8J A;  4DA4 A;  3OS1 A;  4JJN K;  1UGR B;  2M51 A;  4ELY C;  2KRM A;  3H9N A;  4BY6 B;  2VV5 A;  1YHQ T;  1K8A R;  1PD1 A;  1LJO A;  1JB0 E;  2QEX A;  4A63 B;  3CCL Q;  1AWO A;  5I21 A;  3WVD B;  3CPF A;  2HBW A;  1YWP A;  1VIF A;  3G71 A;  2Q1A X;  1UGV A;  2DTO A;  2E70 A;  3M0Q A;  2JJ9 A;  5IHI A;  4ANJ A;  4FL6 A;  4DBQ A;  2ATC B;  3CC4 A;  2EIF A;  4JLG A;  3VS2 A;  1YFN A;  2A36 A;  3OYH A;  1M90 R;  2AZS A;  2MOX A;  1I81 A;  1KQS S;  1RAI B;  4J83 A;  2R58 A;  2FZC B;  4X9C A;  2LVM A;  3CQT A;  4XAX B;  5HKC A;  4AFU C;  2X9H A;  2KRO A;  2MF2 A;  3H6Z A;  1ABO A;  4J8O A;  3JB9 G;  3ER0 A;  4A4E A;  1B34 A;  1VQL Q;  3TU4 K;  3OYE A;  1AWW A;  1UEC A;  2JNG A;  4ZTJ A;  3RUX A;  2KXC A;  3X25 B;  2EPD A;  4UC4 A;  2VGM A;  1QVG P;  4J9I A;  1BB9 A;  4XK8 E;  3LX7 A;  3CC2 A;  3G1J A;  3LYI A;  3CME T;  1ZUK A;  4QVC A;  2PZ1 A;  2HSP A;  3A98 A;  1RI9 A;  1ZUU A;  2RHY A;  3VS1 A;  1ZUY A;  2BZ8 A;  5KYX B;  1SEM A;  3H0F A;  4Q5W A;  2VYT A;  4J5Y A;  2DVJ A;  2KRN A;  3CCE Q;  3M59 A;  3VU3 C;  4E7S A;  2KGT A;  2FB7 A;  1NJI U;  2EYY A;  1PC0 A;  2EGC A;  3LLR A;  4HXJ A;  3CCV T;  1UGS B;  2AT1 B;  1TTH B;  2DLP A;  3CMA Q;  4HT9 A;  3J80 E;  2BIV A;  4FCY A;  2ROT A;  3REA B;  1S72 Q;  3MHX A;  1VQ4 A;  4F16 A;  3FDR A;  1K1Z A;  1QKW A;  3X24 B;  1JXM A;  1ABQ A;  3OYY A;  4V2S A;  2QGG A;  5KYU A;  3AT1 B;  1PNJ A;  2ZPF B;  3G4S T;  1AT1 B;  4XU2 A;  1RAC B;  3JCM g;  4CQN A;  4M75 G;  2D0N A;  3FPR A;  1OX9 A;  2E5K A;  1D0Y A;  1IGQ A;  1N9S A;  2NUP A;  3OYI A;  1GCQ C;  2KR3 A;  1NYF A;  2O88 A;  2MPX C;  1G3Y A;  4QVZ A;  2FRW A;  4J6Y A;  4CC7 A;  2RB6 A;  4HVW A;  3CC7 Q;  2DEQ A;  1NEB A;  1GCQ A;  2LJ0 A;  2PNI A;  2JUF A;  5GMK i;  2E65 A;  2ESW A;  4OMN A;  3EG9 B;  2F1L A;  1VQ8 T;  3ZJV A;  1TU0 B;  2JW4 A;  1H3H A;  1QKX A;  2BE7 D;  1AZE A;  3L42 A;  4ESR A;  1ACM B;  3MEV A;  1TWB A;  1KQS P;  1PM3 A;  2FRY A;  1OOT A;  4M7A E;  2DF6 A;  3EG2 A;  2RJF A;  5A0G A;  4EPC A;  4L6V 5;  1K73 R;  1TS9 A;  2EJF A;  3HP9 A;  4FYV B;  3URG A;  3LWI A;  3QDF A;  1TSF A;  3LH5 A;  1VQP T;  4FSX A;  3MP1 A;  2DIL A;  2DMO A;  2QG9 B;  3RER A;  2B25 A;  1RAF B;  5KH6 A;  4C92 D;  1D0Z A;  1M1F A;  3ZL7 C;  3CCU A;  3I5R A;  5DY9 A;  2DTH A;  1NBE B;  2E3H A;  3I56 A;  3CPW A;  1N6A A;  2YVL A;  2NWM A;  1Q95 G;  4IUU A;  4ZGJ B;  1SHF A;  4RV0 A;  3RMQ A;  2O31 A;  1K4U S;  4PJO E;  3JB9 H;  2MK5 A;  1BBZ A;  2R5A A;  5M9O A;  1CKA A;  1GCP A;  5KE2 A;  1PKT A;  1GRI A;  2OTL Q;  1KQ2 A;  4EDU A;  4R56 A;  2DBK A;  1LCK A;  1HYO A;  4LD6 A;  4OGC A;  4JS4 A;  3G6E A;  1YJN A;  5HY6 A;  1CSK A;  1Q81 U;  2EQI A;  3LW5 E;  4C0D C;  1S72 A;  1WJQ A;  4C8Q F;  3ZJU A;  3O8V A;  1V29 B;  3EFO B;  1NZ9 A;  3PFS A;  4MZM A;  2GGR A;  3REB B;  1S3S A;  2R5M A;  4F7U G;  2EAY A;  3HHT B;  4RCB A;  4M7A F;  4PJJ A;  3OQ5 A;  1YIT A;  5GAM f;  2WSE E;  2VUB A;  2K79 A;  1J3T A;  5ERG B;  2X35 A;  4E6R A;  1N5Z A;  1YJW T;  2QXF A;  3G71 T;  1UHC A;  1WDX A;  1Q7Y C;  2ROL A;  3GNG A;  2MIO A;  3UDC A;  2DZ9 A;  3MCA B;  1U1T A;  4FYW B;  2A28 A;  1BI3 A;  4M78 F;  2YLB A;  3QJ6 A;  3J7A F;  3CME Q;  2A3L A;  2DX1 A;  4J9H A;  5FW9 A;  1OYX A;  2LNV A;  4O5V A;  1Q86 C;  1P92 A;  2K3B A;  1K0X A;  4X9D A;  1KC8 U;  2E10 A;  3QHS A;  4L5G A;  3LGL A;  4OP0 A;  1RAG B;  3EGX A;  3MP8 A;  2CSI A;  2F2V A;  4ATO A;  3VS0 A;  1TXQ A;  5KYN A;  4C92 B;  3CCV Q;  3SDZ A;  2AHJ B;  3M0U A;  3TVT A;  3UAT A;  1UFF A;  2RF0 A;  2RM4 A;  1VYU A;  5IHN A;  4E47 A;  3EGD B;  4EMH A;  3JCM X;  1Q81 R;  1VQ9 A;  2DFU A;  4RG8 A;  1E32 A;  2JS0 A;  1KK7 A;  1M4Z A;  2KXD A;  4D8K A;  2KQW A;  5DLQ E;  3TQ7 P;  3H0H A;  4Y92 A;  3G4S Q;  2CDT A;  2HDA A;  1X69 A;  1Z9Q A;  4QW2 A;  2M0O A;  2YHT A;  2CP6 A;  2L89 A;  2YT6 A;  2YDL A;  2OJ2 A;  4HA8 A;  4M7A C;  1YHQ A;  2CZ1 B;  4A4H A;  1WLP B;  3VJP A;  2DRM A;  1YNZ A;  4KUI A;  4IKF A;  5GAO r;  4J6X A;  2RI2 A;  2L3Q A;  3VUB A;  2KNB B;  4N4G A;  3OB9 A;  3EHQ A;  4M7A A;  4PJO D;  2LDM A;  4IUQ A;  5FLX E;  2E6Z A;  4M7D G;  5GAM j;  3CCQ A;  4Z88 A;  4M78 C;  3QSU A;  4CC3 A;  1UB4 A;  2GTJ A;  9ATC B;  1RL2 A;  2RNA A;  3PTA A;  2FEI A;  1OU8 A;  4M78 A;  4NS5 A;  3VKI A;  1IRX A;  1WXU A;  5CKE A;  3LH0 A;  4FT4 A;  3OYL A;  3CPW S;  1LPL A;  2VKN A;  5J39 A;  2QQS A;  2CYZ B;  1D09 B;  2HCK A;  2K7A A;  3PE0 A;  1W1F A;  4A54 A;  4A53 A;  2JTF A;  2QDY B;  1WHM A;  2RH2 A;  5CIU A;  4M4Z A;  1PSF A;  1O9S A;  2DD5 A;  3MEU A;  2XKO C;  1B07 A;  1CR5 A;  4C5H A;  1VQP Q;  2DXB A;  2OI3 A;  3QWZ A;  1UJ0 A;  2K2M A;  5GJV B;  3QZ5 B;  1QVP A;  3A8G B;  2LQW A;  4BE0 A;  2J6K A;  2PJH B;  4PFZ A;  4RTX A;  4M75 E;  5GAN 4;  2CZ0 B;  5KE3 A;  2EYX A;  4GLK A;  1QLY A;  4RTY A;  5KYW A;  3QWX X;  3GIB A;  2CP5 A;  2JM9 A;  3JCM f;  5CD1 A;  2EVR A;  3WXM B;  2SRC A;  4CI0 C;  2P4T A;  3GF5 A;  4A4F A;  4KH1 B;  2G6F X;  2K6D A;  1MUZ A;  4PJO B;  2JMA A;  1Y96 B;  1AHJ B;  1AWX A;  1YN8 A;  1N9R A;  3CCU T;  3D7S B;  1G2B A;  3G4S A;  4DOW A;  2CZ7 B;  3I56 T;  1K9M U;  4ZNX A;  2LW6 A;  2DM1 A;  2QEX Q;  2MYS A;  1SSH A;  4C8Q G;  1X75 C;  1D1A A;  1E6H A;  2OAU A;  5GMK e;  3G71 Q;  2PU9 B;  3JV3 A;  5LJ3 f;  3MO8 A;  4JZ4 A;  3JB9 D;  4E2F B;  3C0C A;  4Y91 A;  1WNL A;  3CCR A;  2DYI A;  3MKD A;  3G6E T;  3CC4 Q;  3LGF A;  1YJN T;  2QTV A;  1C1A A;  4E7K A;  2VXE A;  1D3B A;  5GMK h;  3OS0 A;  2WSF E;  1OI1 A;  5KYW B;  1VQ8 A;  3M58 A;  3RKY A;  3PVL A;  1X2K A;  4LDX A;  2ED0 A;  2P0K A;  4KDL A;  3M54 A;  3S6W A;  2P0Q A;  1NLP C;  1RI0 A;  1YIT T;  1ZBX A;  2RA2 A;  4JS5 A;  2K5F A;  4KRT A;  3JAM E;  1QVG S;  1K8A U;  2JZ2 A;  4BE1 A;  3RBB B;  1R0C B;  2K2V A;  2C06 A;  2DL7 A;  2RQU A;  1WLF A;  4J9C A;  3A8L B;  3NMZ C;  1X43 A;  3ZBD A;  2Q19 X;  3CPW P;  2QQR A;  5GAO p;  3FC3 A;  4KO8 A;  2JM8 A;  5A0D A;  4KUD K;  1EFN A;  3CC2 Q;  1HXD A;  3S3N A;  4JRQ A;  3S3M A;  2MWO A;  2JMC A;  3Q1J A;  3MEA A;  3L2Z A;  3X26 B;  5IXB A;  3QUI A;  4DBR A;  1OPL A;  1T3S A;  2EJ9 A;  2LNH B;  1I8F A;  2F5K A;  4QQD A;  4M75 D;  1CKB A;  3TCJ A;  2FYK A;  5HCK A;  1C0M A;  2KE9 A;  4FW2 A;  1VYT A;  1D3B B;  2YUP A;  1M3A A;  2HSE B;  5LJ5 d;  1VQ9 T;  2C0I A;  3SEM A;  3QZ9 B;  1GBR A;  3C94 A;  4OF1 A;  4JRK A;  5LJ3 j;  3SD4 A;  4M75 C;  3OW2 A;  1M27 C;  3LGA A;  2X3W D;  1IGU A;  3U23 A;  2RK2 A;  2JVV A;  4D6W A;  2CT3 A;  1XJW B;  4KOD A;  1KD1 R;  4DBF A;  4M75 A;  4KGX B;  1UDL A;  1XTD A;  2QGF B;  2DIQ A;  1MHN A;  3S3O A;  3HSB A;  1OV3 A;  2J6F A;  1BCM A;  8ATC B;  4WF2 A;  4C0Z A;  2DL8 A;  5GAN e;  1ZA1 B;  3JB9 J;  2JTM A;  3M55 A;  1KC8 C;  2COW A;  1VQO A;  4ZN1 A;  1YJW A;  1H3Z A;  2KT1 A;  4QT7 A;  3I5S A;  5CAI A;  4OMO A;  1G3T A;  1TUC A;  3HRU A;  3CCQ T;  1N8R R;  4GY5 A;  4F7U F;  3OMG A;  1LVK A;  5GAN h;  3VRZ A;  1H92 A;  3A8H B;  1BCO A;  7AT1 B;  3OYC A;  2LX9 A;  2ZPI B;  1Q82 C;  4HT8 A;  2E5Q A;  2ZAE A;  4K11 A;  4RTZ A;  2BZY A;  2MM2 A;  2J06 A;  2RQV A;  3QJY A;  4HVU A;  2QYZ A;  1TOV A;  4DEY A;  3OYG A;  5DLO A;  5IHK A;  2KDS A;  2P4R A;  4WCI A;  1JJ2 A;  1JXO A;  2HKQ B;  1RAA B;  3M4Y A;  3M5A A;  5DYI A;  1U8R A;  4IUT A;  4KGV B;  1WIE A;  4M75 B;  2EYZ A;  4DOV A;  5CVI A;  3CCU Q;  5CKF A;  1JEG A;  2H3E B;  5CO7 A;  2JN0 A;  2J7I A;  1WYX A;  3I56 Q;  2K5L A;  1QWF A;  5C1B A;  3CF2 A;  3PMI A;  2EQM A;  4HCZ A;  2DPP B;  4PJN A;  2JV2 A;  3UA6 A;  2FVU A;  4RG2 A;  2LMJ A;  1MMN A;  1SKU B;  4BB7 A;  3V7R A;  2DXT A;  4RUG A;  5J26 A;  3G6E Q;  1YJN Q;  4HKE A;  1K73 U;  1UHF A;  3ASK A;  4II1 A;  4IUR A;  1R77 A;  2FPE A;  4F7U A;  2DKG A;  4TVR A;  1T3L A;  1B34 B;  2P0P A;  2WAC A;  5GAN 7;  1YIT Q;  4C0G A;  3I35 A;  4M7D F;  2QDL A;  4XU0 A;  3L2V A;  1X6G A;  2LCC A;  4KGZ B;  4IIO A;  4RMO A;  2VWF A;  1NLO C;  2DL5 A;  2ZZD A;  2YLC A;  3E19 A;  3JCM b;  2L8D A;  3QXE B;  1M1K C;  2J6O A;  2F69 A;  3CCR T;  5EQJ B;  2F2W A;  2O2O A;  2PUO B;  3LWH A;  1BI1 A;  1Y71 A;  2EGA A;  3RMS A;  2O9S A;  3OW2 S;  4C5I A;  1U1S A;  1Y57 A;  4C92 F;  1JU5 C;  4JJC A;  4F17 A;  4RCC A;  4B6M A;  2OTJ T;  4C8Q E;  1R7R A;  3EG1 A;  3JCM J;  1I5L A;  4YTL A;  1VQ9 Q;  5FTM A;  4OVA A;  3BDU A;  1VQ6 A;  3L1A A;  3HU3 A;  5GAN g;  2IVW A;  5KYU B;  3QC8 A;  1WX6 A;  2EW3 A;  2XDD A;  1NM7 A;  4E7Z A;  4EIK A;  1PWT A;  1X6B A;  2NUP B;  1YHQ Q;  4M78 E;  1WHJ A;  2DXC A;  2XI9 A;  1ZQ1 A;  4OMP A;  2MWP A;  1YP5 A;  1H64 1;  2PVD B;  4ZGE B;  3CEY A;  3MEW A;  2YSQ A;  5FU7 C;  1WQW A;  4X1V A;  3CCJ A;  2ZPB B;  1XOV A;  4LE9 A;  1JJ2 S;  1DJ7 B;  4M7D A;  3L2R A;  3CCQ Q;  2D9T A;  3CXC A;  1K8A C;  3PNW C;  4MDX A;  1R0B G;  3EHR A;  2CH4 W;  2EQU A;  1WZO A;  1MMA A;  2I0N A;  1IXD A;  1RLP C;  4BE2 A;  3VYG A;  2M16 A;  3PMT A;  2YRD A;  2JS2 A;  5L8R E;  1M90 C;  4XTZ A;  1VQO T;  2IG0 A;  5AYF A;  3NGP A;  1NE8 A;  1U5S A;  3KUF A;  1SRL A;  1WHG A;  1PG5 B;  5I2S A;  4ORZ A;  6AT1 B;  2B86 A;  5ECA A;  3RNJ A;  1SF9 A;  2FZK B;  5I11 A;  2MAM A;  1XQH A;  4C5G A;  3HPW A;  3JSC A;  2HZY A;  1FYN A;  5FWC A;  5GMK m;  1NG2 A;  3C12 A;  4KT0 E;  1KIK A;  5CCX A;  3OW2 P;  5FRO A;  3HU2 A;  4C8Q D;  5I22 A;  2BZX A;  3FPU A;  1CZ5 A;  4PFP A;  2FG0 A;  1UEB A;  3THK A;  4C5E A;  4J7F A;  1VQK T;  1VUB A;  5D6W A;  3ULR B;  2RI5 A;  4M7A D;  4M77 F;  2E6N A;  5FTJ A;  3MJX A;  5GAN 2;  4C0D B;  2K9G A;  5GAO m;  4C8Q C;  3VS6 A;  5HK3 A;  3VS4 A;  1KHI A;  4GLM A;  3C4S A;  3QO3 A;  1ZSG A;  2H8H A;  2H3J A;  1BU1 A;  3GP8 A;  3RDV A;  2CZ6 B;  4C8Q A;  1XNI A;  5HK0 A;  4ARI A;  2W10 A;  3H41 A;  4M78 D;  1FMW A;  2E1H A;  2L2P A;  2M02 A;  4Y28 E;  1I9G A;  5GLF A;  3O5Z A;  4N0A C;  1YWO A;  2DRK A;  2RHZ A;  1VQ5 A;  3I55 T;  3CCR Q;  3GOX A;  1RAE B;  1W70 A;  4FSS A;  1IO6 A;  4Z02 A;  1FX7 A;  2KBT A;  2LQN A;  3SHW A;  2VC8 A;  4N0A A;  5GAM d;  3UPU A;  4RKU E;  4JDS A;  4J9G A;  1VQ8 Q;  1WHL A;  3EGX B;  4IIM A;  1D1B A;  4XQ3 A;  5CR2 A;  1JJ2 P;  1FWZ A;  5CQY A;  1D1C A;  2YUQ A;  4AFZ C;  2DBM A;  3E2U A;  2OTJ Q;  3JCM c;  2G3R A;  4AT1 B;  2X4Y A;  3CCM A;  5I2M A;  1RUW A;  2KI7 A;  1SHG A;  2CP0 A;  3OYF A;  2K57 A;  2KSS A;  2COY A;  4C92 G;  3PIO A;  5FU6 C;  2V1Q A;  2FHD A;  1BI0 A;  1UG1 A;  2GFU A;  3EAE A;  4BI3 A;  2PVG B;  4PK4 A;  5EG2 A;  2RI3 A;  1D0X A;  5LL6 S;  1NJI C;  4LUD A;  2HNI A;  1WJS A;  4LDW A;  4C8Q B;  5FTK A;  5EPP A;  3VRY A;  4RTV A;  2MMP A;  2L5Q A;  3SWN C;  1ZSZ C;  1ZC1 A;  2P84 A;  3EFS A;  1NYG A;  2E3I A;  5KCH A;  4XTV A;  4M7A B;  2EWN A;  1EIF A;  1M2V A;  3SWN A;  1ZSZ A;  4BI8 B;  2KY9 A;  2KAF A;  2WSC E;  2K3Y A;  3TEE A;  3MB5 A;  1I4K 1;  2O4X A;  4X34 A;  5IXF A;  1G8X A;  4PL6 A;  1SG5 A;  4J6W A;  1GFD A;  2CH4 A;  1R8O B;  4OB0 B;  2KK4 A;  2LP5 A;  1VQ6 T;  4NOY A;  2R57 A;  2ZPE B;  4M78 B;  2RHI A;  3NHN A;  2K4Y A;  3JRZ A;  3DLM A;  2HL5 C;  2Z0W A;  3X20 B;  2KMT A;  3V8K A;  2O01 E;  2EKH A;  2RHX A;  4FT2 A;  2L3P A;  2GQI A;  4XTW A;  1YIJ A;  2RQT A;  4XTU A;  3HFN A;  2XID A;  2E4H A;  2EQJ A;  4A4G A;  2YRC A;  4O6J A;  2JXB A;  3NTI A;  1PRM C;  1VQO Q;  1LNX A;  2E64 A;  1YJW Q;  2RMO A;  3JCM W;  1IHV A;  3M4G A;  3CCJ T;  2COZ A;  2D0Q B;  4QKU A;  4Z89 A;  3HFO A;  3HKS A;  1TG0 A;  2BE9 B;  4LXC A;  2DD4 A;  1GFC A;  3SWN B;  2RO0 A;  2LZ6 B;  2PUK B;  1ZSZ B;  1S1N A;  4J9F A;  5GAN f;  3CCE T;  3ZFJ A;  2DZC A;  4AS1 A;  3PVQ A;  2DEU A;  2OTJ A;  1KD1 U;  4XU3 A;  3CMA T;  5D7U A;  2GBQ A;  2HBP A;  2DET A;  1JQQ A;  2QA4 T;  1VQN A;  2LT1 A;  4FW1 A;  4FM4 B;  5C0M A;  3CBO A;  1WGS A;  1HJD A;  3SB2 A;  3HU1 A;  1OX8 A;  1PCX A;  2CKK A;  4BY6 C;  1I07 A;  1N8R U;  2Q1C X;  2PVO B;  4OMM A;  2AZV A;  5C6S A;  3JCM Q;  3JCM d;  3FJP A;  4PJO G;  3IQL A;  2LQ8 A;  2NYS A;  4F7U E;  1OZ3 A;  1VQ7 A;  1Q81 C;  3INZ A;  4M77 G;  4OB1 B;  4BD3 A;  2M1H A;  1WJR A;  5AT1 B;  3CC7 T;  4L59 A;  1K9A A;  2CRE A;  1MV0 B;  4LNP A;  2DIG A;  2HL3 A;  3VYH B;  1HK9 A;  4LD9 K;  1QDN A;  2LTO A;  3MPU B;  4RTW A;  2D1X A;  2LJ3 A;  2GQV A;  1NPR A;  4AQ7 A;  3BW1 A;  1GXI E;  2QAZ A;  5LJ3 d;  1G3W A;  2DNU A;  2Y90 A;  1PHT A;  5LJ5 e;  2A0F B;  1EZZ B;  1KHC A;  1OZ2 A;  2Y4Y A;  4CC4 B;  2X4X A;  4MDW A;  1RAH B;  1C6V X;  4JPB W;  3OYD A;  1Q86 U;  2FZG B;  2NUT A;  2V8K A;  5LJ3 e;  5GAN j;  1QWE A;  2JTE A;  2EYQ A;  3VS3 A;  5LJ5 h;  5GMK l;  1VQ5 T;  2ZGW A;  5D6X A;  1WQ7 A;  1M5Q 1;  2DO3 A;  3FJ5 A;  1IZ6 A;  2KVQ G;  1YI2 A;  1YJ9 A;  2E12 A;  1QMC A;  4J9B A;  3OSV A;  3NPF A;  2W0Z A;  1B7T A;  4E7L A;  4DBH A;  1QQJ A;  5LJ3 h;  1SRM A;  4QVD A;  1Y0M A;  3FB9 A;  3QQ7 A;  1UTI A;  2MI6 A;  2FL7 A;  4PJL A;  3AHU A;  3GBQ A;  5KYX A;  3CCM T;  5GAO l;  3P8H A;  2OTL T;  1I1J A;  2RJE A;  2MM0 A;  4QQ6 A;  3A8O B;  2KYM A;  2RQW A;  2D8J A;  1BKB A;  2ZPG B;  3TSZ A;  3OYK A;  3KXT A;  4ZN3 A;  3VUZ A;  1WI7 A;  3CD6 T;  2V8J A;  1NPP A;  1VQ6 Q;  4M7D E;  1NEG A;  3FLG A;  2XHC A;  1VQK A;  3FIF A;  1Q7Y R;  2LQK A;  2RPN A;  2C0T A;  1ZBJ A;  1WHK A;  1QCN A;  1K76 A;  2EJG A;  2GFA A;  1WPY A;  2NUT B;  3OYN A;  4OB3 B;  2IIM A;  1UUE A;  3HRT A;  3J81 E;  2DL4 A;  3VS5 A;  2K3X A;  1QCO A;  4WTO B;  1Q86 R;  3R6O A;  2K5I A;  3QYH B;  3CCJ Q;  5CQX A;  4C92 E;  3QPH A;  2A7Y A;  2L0A A;  3CCS A;  3RKW A;  4ZTF A;  2PTK A;  1ARK A;  3OBW A;  3I55 A;  4PLL A;  2CUD A;  3VS7 A;  1GBQ A;  4FYX B;  3QQ8 A;  2NLU A;  1OQK A;  2YXY A;  5IT9 E;  3EG9 A;  1JO8 A;  4AFQ C;  1V1C A;  5GAN 8;  4FIB A;  5IH2 A;  4HVV A;  1M2O A;  2RJC A;  1X6O A;  2CS7 A;  2L3R A;  1YIJ T;  1AOJ A;  3P8B B;  4PFO A;  2LX7 A;  4LUE A;  2HAX A;  2QA4 Q;  3QII A;  2QQB A;  4HCK A;  1MGQ A;  3V8L A;  4BUG A;  1VQM A;  5KYY A;  1PKS A;  1KSW A;  2PQW A;  1M8M A;  3E1S A;  4KH0 B;  3BDL A;  2YUN A;  3EH1 A;  2VAS A;  4A4K A;  1M3B A;  1QCF A;  1SPK A;  1MMD A;  4JRI A;  1JBM A;  4JJD A;  5GAN 6;  1W4S A;  2I2L A;  1AWJ A;  2ZCF B;  5FTN A;  2CGH A;  4JJB A;  1A0N B;  1BI2 A;  2CSQ A;  4F14 A;  4E7H A;  4HCB A;  2EFI A;  3OS2 A;  3E9F A;  3X28 B;  2DER A;  1OU9 A;  4PKC C;  1RAD B;  3CCL A;  1ZA2 B;  5FRM A;  4RTT A;  3L2U A;  4AMC A;  2QTX A;  4AG1 C;  5LJ5 g;  1VQN T;  1K9M C;  2X51 A;  4C0F A;  1FMV A;  2DK3 A;  1Y07 A;  2GTO A;  2JOY A;  2BTT A;  3G7Z A;  1W2B A;  5J3B A;  1KFZ A;  5IAY A;  2X3X D;  3M57 A;  4F7U B;  5LJ3 g;  4AG2 C;  4M7D D;  4EMG A;  3OMC A;  1TUG B;  2AK5 A;  1X01 A;  2XMF A;  1Y7X A;  3EFO A;  1NJI R;  3DLL A;  3OYM A;  3C95 A;  2RD1 A;  5KYY B;  2OX7 A;  1VQ7 T;  3M56 A;  1QW1 A;  5C18 A;  1VQL A;  1E6G A;  1FXX A;  4M7D C;  1B3Q A;  2LC4 A;  1QVF A;  5DYG A;  1W6X A;  1VQ5 Q;  1QP3 A;  5CK9 A;  2XU8 A;  5CCA A;  3EG3 A;  1KD1 C;  4B9X A;  4B9W A;  1QCS A;  3NTK A;  2XG8 D;  5GAO n;  1BIB A;  2HQE A;  3DKM A;  1AZG B;  4KBM B;  2RHU A;  4PJM A;  2CP7 A;  2DAQ A;  3UA7 A;  1N27 A;  2CUB A;  2DJZ A;  3A1P A;  3DB3 A;  3KFV A;  4M77 E;  3P8D A;  2KT8 A;  3QKJ A;  4C92 C;  3CCM Q;  1WXT A;  4NL3 A;  3CCE A;  1KG1 A;  1N8R C;  1AVZ C;  3EH2 A;  3ME9 A;  3ZEH A;  3CMA A;  1IHW A;  4MMK A;  4PNO A;  4C92 A;  2QQ9 A;  3CD6 Q;  2QA4 A;  1OEB A;  3SFM A;  4ME7 A;  5FTL A;  4J9D A;  3OS5 A;  3EGD A;  3RIR A;  1Z9Z A;  4LN2 A;  4AFS C;  1HD3 A;  2V26 A;  1YI2 T;  1OPK A;  1I5O B;  1YJ9 T;  3QDR B;  1UE9 A;  2RQR A;  1F1B B;  4GBQ A;  2ED1 A;  1UJY A;  4PLI A;  5D6Y A;  1HSQ A;  2QEX T;  2QAS A;  4D8D A;  1IRE B;  1WHH A;  5GJW B;  2YUJ A;  4M7D B;  4KDI A;  2EYW A;  2DL3 A;  3ZGZ A;  1BYM A;  2DA9 A;  2DYB A;  3GNF B;  3BE3 A;  5FU7 B;  3CC7 A;  3CC4 T;  4JRP A;  4XTY A;  3DB4 A;  2YRV A;  2FO0 A;  3OY9 A;  2HQH A;  2EBP A;  4PJO F;  4DEX A;  1I0C A;  3M0S A;  5CKD A;  3RKX A;  2RK1 A;  2RN8 A;  1TUD A;  4Z8A A;  2YUO A;  2HQX A;  4EMK C;  4F04 B;  3WVE B;  2M9U A;  3FRN A;  3PT9 A;  2XK0 A;  3H0I A;  2JT4 A;  4CC2 A;  1YCS B;  2F5T X;  2AKL A;  4ZGD B;  1VIE A;  3RR6 A;  1YIJ Q;  1VOM A;  1WFW A;  4EMK A;  2YWW A;  3EFR A;  4OB2 B;  1KQ1 A;  2EKO A;  4OML A;  2O9V A;  1M9S A;  1PRL C;  1Q82 U;  5CCB A;  3V7S A;  4QQG A;  3TSW A;  3HRS A;  3CCS T;  2CT4 A;  3CC2 T;  2ENM A;  1WXB A;  1IB8 A;  4XU1 A;  2F2X A;  1M3C A;  4FYY B;  1W2B S;  4ELZ C;  2GF7 A;  1QVG A;  1X2Q A;  1PSE A;  2Q1D X;  4RTU A;  2X4W A;  1CZ4 A;  5GAN 5;  4ARC A;  1UGQ B;  4M77 D;  5GAM e;  2OTL A;  5L23 A;  2QI2 A;  3QBY A;  1VQM T;  1VQN Q;  3CBP A;  4MZP A;  3OA6 A;  1QVF S;  2J05 A;  3V7C A;  4LDU A;  1VQ4 T;  3M0P A;  3N5B B;  4MML A;  1G83 A;  5GAO q;  3CD6 A;  4PJO C;  1TH7 A;  3JCM P;  1M8V A;  1KC8 R;  4IUP A;  3JCM V;  1SSF A;  5GAN 3;  3CXC S;  4E7J A;  4JLI A;  2DTI A;  3BY7 A;  4M77 C;  3OYB A;  5GAM h;  3HTR A;  5DM7 R;  3F70 A;  4EMK B;  2AKK A;  3NTH A;  1T0J A;  4PJO A;  4JZ3 A;  3R6N A;  1Y96 A;  2D8H A;  2DVE A;  4FU6 A;  1VQ7 Q;  2AIR B;  4M77 A;  3RES A;  1K73 C;  2ECZ A;  2V1R A;  1ZHI A;  2X4J A;  3CCL T;  1BIA A;  1Q82 R;  3JB9 I;  8AT1 B;  5FWB A;  3OSS C;  1MND A;  3M0R A;  4VUB A;  4XTX A;  1X27 A;  2SEM A;  1K0S A;  3JB9 F;  5CKH A;  3VV0 A;  3CME A;  3MET A;  3OYA A;  3GPL A;  4MZT A;  1RAB B;  4IUV A;  3A8M B;  3CBM A;  1BK2 A;  5EC7 A;  3FEO A;  1M1K U;  2XDP A;  3L2W A;  4R0K A;  1V76 A;  2GCX A;  2KRS A;  4DQ2 A;  2PWY A;  2LCS A;  4BDZ A;  2NUZ A;  2MCN A;  1VQL T;  1O54 A;  2EGE A;  3CCV A;  5FRN A;  1O75 A;  1GL5 A;  2D6F A;  3H8Z A;  3PGG A;  5GMK j;  1M30 A;  4BDY A;  3BQB A;  5FU6 B;  1YI2 Q;  1KQS A;  1YJ9 Q;  2VGN A;  4OMF B;  4KLN A;  4M77 B;  5LJ5 f;  1U3O A;  4OMQ A;  2QQA A;  1VA7 A;  3A5Z B;  2C0O A;  1VYV A;  3KBG A;  5KCO A;  2CP3 A;  2VB6 A;  3MP6 A;  4J9E A;  1M2V B;  5A0L A;  1MNE A;  3OBY A;  3M9Q A;  5B6C A;  3OYJ A;  1JRI A;  1W2B P;  1MMG A;  2O4X B;  2LCL A;  3I9Q A;  1AD5 A;  2LT4 A;  5CKB A;  3QYG B;  4M7A G;  4KUL A;  1LOJ A;  2DXU A;  1UGP B;  2DJQ A;  2EQK A;  4LDV A;  2IPO B;  3FPT A;  1S72 T;  2CP2 A;  4M75 F;  3EGU A;  2RJD A;  3PIP A;  1VQK Q;  3UF4 A;  2OAW A;  2E41 A;  4P5N A;  2DE0 X;  3EG0 A;  1ZX6 A;  4JUV A;  1AEY A;  1U06 A;  1M1K R;  2Y4X A;  1G3S A;  4M78 G;  1QVF P;  3TRE A;  4LDY A;  2XIC A;  5IN1 A;  2LJ1 A;  2FPD A;  1RLQ C;  4HCC A;  2QK0 A;  4R55 A;  2A37 A;  1H8K A;  3CXC P;  2GNC A;  1KJW A;  2Q18 X;  2ABL A;  1WA7 A;  2HMA A;  2VVK A;  4NL2 A;  3E9G A;  1ZLM A;  3TIW A;  3CCS Q;  1OUL A;  2B8A A;  1VQP A;  3JCM e;  1M1G A;  2LRQ A;  3I55 Q;  2BKD N;  5A2Q E;  4BI4 A;  3NFC A;  5GAM g;  1K9M R;  4J7I A;  3ZJT A;  1M90 U;  3T9N A;  4CRI A;  1YBY A;  2HKN A;  2L3S A;  3BFM A;  2A08 A;  1QP2 A;  1E7O A;  3QG1 A;  1Q7Y U;  3JCM h;  3HL8 A;  2HD0 A;  3M0T A;  4BAC A;  4N4H A;  1T0H A;  3L2Q A;  2XDB A;  1PD0 A;  5LJ5 j;  3M53 A;  1EX4 A;  1G5V A;  2HEQ A;  4E7I A;  2XD0 A;  1MV3 A;  3LHD A;  2M0Y A;  1FMK A;  1VQM Q;  2ZPH B;  1YCY A;  3GLX A;  4OGE A;  4N4I A;  3QWY A;  2KEA A;  2FPF A;  3UWN A;  1VQ4 Q;  2BUD A; 
#chains in the Genus database with same CATH homology
 4C5G A;  3HPW A;  3JCM f;  5GAN 6;  3JSC A;  5CD1 A;  3UT1 A;  1W4S A;  2I2L A;  5GMK m;  2VXF A;  2ZCF B;  3WXM B;  5GAN d;  4CI0 C;  2V8I A;  3C12 A;  3V8J A;  5FTN A;  2CGH A;  4DA4 A;  4KT0 E;  3OS1 A;  2P4T A;  1BI2 A;  5CCX A;  5FRO A;  4JJN K;  4E7H A;  3HU2 A;  1UGR B;  4HCB A;  4C8Q D;  2EFI A;  4ELY C;  3OS2 A;  3FPU A;  3E9F A;  3X28 B;  2VV5 A;  4BY6 B;  1YHQ T;  1CZ5 A;  1UEB A;  3GF5 A;  4PKC C;  4A4F A;  3CCL A;  1LJO A;  4C5E A;  4J7F A;  5FRM A;  4PJO B;  1Y96 B;  1AHJ B;  3L2U A;  1VQK T;  1VUB A;  1JB0 E;  2QTX A;  5D6W A;  1N9R A;  2QEX A;  2RI5 A;  5LJ5 g;  3CCU T;  4M7A D;  4M77 F;  2E6N A;  5FTJ A;  3G4S A;  5I21 A;  1VQN T;  1K9M C;  3WVD B;  2CZ7 B;  3CPF A;  4C0F A;  4DOW A;  5GAN 2;  4C0D B;  3I56 T;  1VIF A;  3G71 A;  2Q1A X;  2DK3 A;  2LW6 A;  1Y07 A;  5GAO m;  4C8Q C;  2DTO A;  2JOY A;  2E70 A;  5HK3 A;  3G7Z A;  4JRI A;  1W2B A;  5J3B A;  4C8Q G;  1KHI A;  1X75 C;  5IAY A;  4FL6 A;  3C4S A;  3M57 A;  2OAU A;  4F7U B;  3QO3 A;  5GMK e;  5LJ3 g;  2PU9 B;  5LJ3 f;  4M7D D;  2H3J A;  3MO8 A;  3JB9 D;  3GP8 A;  4EMG A;  3CC4 A;  3OMC A;  2EIF A;  2CZ6 B;  4JLG A;  4C8Q A;  1XNI A;  3OYH A;  1X01 A;  5HK0 A;  4ARI A;  1Y7X A;  4Y91 A;  3DLL A;  4M78 D;  1I81 A;  1KQS S;  3OYM A;  4J83 A;  1WNL A;  3C95 A;  3CCR A;  2E1H A;  2R58 A;  2RD1 A;  3G6E T;  4X9C A;  4Y28 E;  2LVM A;  1I9G A;  5GLF A;  3LGF A;  1YJN T;  1VQ7 T;  4N0A C;  4XAX B;  5HKC A;  3M56 A;  2VXE A;  4E7K A;  1QW1 A;  5C18 A;  1D3B A;  5GMK h;  2MF2 A;  2RHZ A;  3H6Z A;  1VQL A;  1VQ5 A;  3I55 T;  3OS0 A;  2WSF E;  1FXX A;  3GOX A;  4M7D C;  2LC4 A;  1OI1 A;  4Z02 A;  4J8O A;  1VQ8 A;  1FX7 A;  1QVF A;  3M58 A;  3RKY A;  3JB9 G;  3ER0 A;  4A4E A;  2VC8 A;  1B34 A;  4N0A A;  4LDX A;  5DYG A;  5GAM d;  1QP3 A;  2P0K A;  5CK9 A;  4RKU E;  4JDS A;  3OYE A;  3M54 A;  2JNG A;  2XU8 A;  3S6W A;  4KDL A;  5CCA A;  2P0Q A;  1RI0 A;  1KD1 C;  4ZTJ A;  1YIT T;  1ZBX A;  4XQ3 A;  3RUX A;  4B9X A;  2RA2 A;  4B9W A;  3NTK A;  5CR2 A;  4JS5 A;  1QCS A;  1FWZ A;  2K5F A;  5CQY A;  3JAM E;  2XG8 D;  5GAO n;  1QVG S;  1BIB A;  1K8A U;  3X25 B;  2HQE A;  2JZ2 A;  4UC4 A;  2VGM A;  4BE1 A;  3G6E A;  3DKM A;  4XK8 E;  2K2V A;  3JCM c;  2G3R A;  2C06 A;  2X4Y A;  1WLF A;  4KBM B;  3A8L B;  3LX7 A;  3CCM A;  2RHU A;  3CC2 A;  5I2M A;  3LYI A;  2DAQ A;  3ZBD A;  2Q19 X;  3CME T;  2QQR A;  5GAO p;  3FC3 A;  1N27 A;  2DJZ A;  4QVC A;  3DB3 A;  4KO8 A;  5A0D A;  3OYF A;  4M77 E;  2K57 A;  2KSS A;  3P8D A;  3QKJ A;  4C92 C;  4KUD K;  4NL3 A;  3CCE A;  1HXD A;  2RHY A;  1KG1 A;  4C92 G;  1N8R C;  3S3N A;  3PIO A;  5FU6 C;  4JRQ A;  3S3M A;  2FHD A;  4Q5W A;  2MWO A;  3ME9 A;  1BI0 A;  2VYT A;  2GFU A;  4J5Y A;  3Q1J A;  3EAE A;  3ZEH A;  2PVG B;  3MEA A;  3L2Z A;  4BI3 A;  5EG2 A;  2RI3 A;  3CMA A;  4MMK A;  4PNO A;  3X26 B;  3M59 A;  4C92 A;  2QQ9 A;  3QUI A;  5LL6 S;  3VU3 C;  1NJI C;  2FB7 A;  2QA4 A;  1NJI U;  2HNI A;  1WJS A;  3LLR A;  3SFM A;  4LDW A;  4C8Q B;  5FTK A;  2EJ9 A;  4ME7 A;  1UGS B;  3CCV T;  1I8F A;  2F5K A;  5EPP A;  5FTL A;  4QQD A;  4HT9 A;  3OS5 A;  3J80 E;  2BIV A;  2MMP A;  3RIR A;  2L5Q A;  3SWN C;  1YI2 T;  4M75 D;  1ZC1 A;  1YJ9 T;  3QDR B;  3TCJ A;  2FYK A;  3EFS A;  5KCH A;  3MHX A;  4XTV A;  4M7A B;  1VQ4 A;  1D3B B;  2EWN A;  5LJ5 d;  3FDR A;  3X24 B;  1EIF A;  3SWN A;  4PLI A;  5D6Y A;  1VQ9 T;  4BI8 B;  2QEX T;  2KY9 A;  3OYY A;  2KAF A;  4V2S A;  2WSC E;  2K3Y A;  3QZ9 B;  3TEE A;  2ZPF B;  3G4S T;  3MB5 A;  1I4K 1;  3C94 A;  4XU2 A;  4OF1 A;  2O4X A;  4JRK A;  4X34 A;  3JCM g;  5LJ3 j;  4CQN A;  3SD4 A;  4M75 C;  1IRE B;  4PL6 A;  2YUJ A;  3OW2 A;  4J6W A;  4M7D B;  4KDI A;  1R8O B;  3LGA A;  4OB0 B;  4M75 G;  2KK4 A;  1BYM A;  3ZGZ A;  3FPR A;  2RK2 A;  2JVV A;  3GNF B;  4D6W A;  1VQ6 T;  4NOY A;  2R57 A;  5FU7 B;  1N9S A;  3OYI A;  2ZPE B;  4M78 B;  2RHI A;  3CC7 A;  4KOD A;  3CC4 T;  2K4Y A;  4M75 A;  4XTY A;  1G3Y A;  3DB4 A;  2YRV A;  3JRZ A;  1XTD A;  4JRP A;  4QVZ A;  3DLM A;  2DIQ A;  1MHN A;  3S3O A;  3HSB A;  3X20 B;  2KMT A;  4J6Y A;  3OY9 A;  3V8K A;  2RB6 A;  2O01 E;  4PJO F;  2DEQ A;  2RHX A;  4WF2 A;  4FT2 A;  4C0Z A;  5CKD A;  5GAN e;  3RKX A;  2RK1 A;  3JB9 J;  4XTW A;  2JTM A;  3M55 A;  1KC8 C;  1YIJ A;  1VQO A;  2JUF A;  2HQX A;  4EMK C;  5GMK i;  2E65 A;  3WVE B;  4ZN1 A;  4XTU A;  2M9U A;  1YJW A;  3HFN A;  3FRN A;  3PT9 A;  2XID A;  1H3Z A;  2XK0 A;  5CAI A;  2EQJ A;  4A4G A;  1VQ8 T;  3ZJV A;  1G3T A;  2F5T X;  3HRU A;  4O6J A;  4ZGD B;  3CCQ T;  1VIE A;  3NTI A;  1LNX A;  2E64 A;  4GY5 A;  4F7U F;  3JCM W;  3M4G A;  3L42 A;  4EMK A;  3CCJ T;  3OMG A;  5GAN h;  3EFR A;  2D0Q B;  4OB2 B;  1KQ1 A;  3A8H B;  2EKO A;  3HFO A;  3HKS A;  3OYC A;  2LX9 A;  3MEV A;  2ZPI B;  1M9S A;  1Q82 C;  1Q82 U;  4HT8 A;  5CCB A;  3V7S A;  4QQG A;  2E5Q A;  2DD4 A;  3HRS A;  3CCS T;  4M7A E;  3CC2 T;  2MM2 A;  2RJF A;  5A0G A;  4EPC A;  4XU1 A;  4L6V 5;  3SWN B;  3QJY A;  2RO0 A;  2PUK B;  2EJF A;  3HP9 A;  1W2B S;  5GAN f;  3URG A;  3OYG A;  3CCE T;  3LWI A;  3ZFJ A;  4ELZ C;  5DLO A;  2KDS A;  1O54 A;  1VQP T;  4FSX A;  3UPU A;  2DZC A;  1JJ2 A;  2GF7 A;  3MP1 A;  4AS1 A;  3RER A;  3M4Y A;  2B25 A;  3M5A A;  5DYI A;  1U8R A;  5KH6 A;  1KD1 U;  1QVG A;  4XU3 A;  2OTJ A;  3CMA T;  4C92 D;  4IUT A;  1M1F A;  2HBP A;  1PSE A;  2Q1D X;  3CCU A;  2X4W A;  5DY9 A;  2QA4 T;  2DTH A;  1CZ4 A;  5GAN 5;  4M75 B;  1VQN A;  2LT1 A;  3I56 A;  3CPW A;  1N6A A;  4DOV A;  4ARC A;  2YVL A;  4ZGJ B;  4IUU A;  4FM4 B;  5CVI A;  5C0M A;  4RV0 A;  3CBO A;  3RMQ A;  1UGQ B;  1WGS A;  4M77 D;  5CKF A;  5GAM e;  2OTL A;  4PJO E;  5CO7 A;  2JN0 A;  2QI2 A;  3SB2 A;  3QBY A;  1VQM T;  3CBP A;  4MZP A;  2K5L A;  3HU1 A;  3OA6 A;  1QVF S;  3JB9 H;  5C1B A;  2CKK A;  3V7C A;  4LDU A;  1VQ4 T;  3CF2 A;  2R5A A;  3PMI A;  5M9O A;  2EQM A;  4BY6 C;  5KE2 A;  4HCZ A;  3N5B B;  4MML A;  5GAO q;  1N8R U;  1KQ2 A;  2DPP B;  2Q1C X;  3CD6 A;  2JV2 A;  2PVO B;  4EDU A;  4PJO C;  4R56 A;  1TH7 A;  2FVU A;  4RG2 A;  3JCM P;  1M8V A;  5C6S A;  3JCM Q;  3JCM d;  3FJP A;  4IUP A;  3JCM V;  4PJO G;  1SSF A;  4LD6 A;  4OGC A;  5GAN 3;  3CXC S;  2LQ8 A;  4JLI A;  2DTI A;  3BY7 A;  4M77 C;  3OYB A;  4F7U E;  5GAM h;  4BB7 A;  1OZ3 A;  5DM7 R;  3F70 A;  5HY6 A;  3V7R A;  4EMK B;  1YJN A;  1Q81 C;  1Q81 U;  1VQ7 A;  3INZ A;  3LW5 E;  3NTH A;  4M77 G;  4OB1 B;  4C0D C;  1S72 A;  4BD3 A;  1WJQ A;  2DXT A;  4C8Q F;  4PJO A;  3O8V A;  3ZJU A;  1Y96 A;  2DVE A;  2M1H A;  1V29 B;  1WJR A;  5J26 A;  1NZ9 A;  4FU6 A;  3PFS A;  3CC7 T;  4MZM A;  4HKE A;  4M77 A;  1S3S A;  4L59 A;  3RES A;  1K73 C;  1K73 U;  2R5M A;  4F7U G;  2EAY A;  3ASK A;  1ZHI A;  2X4J A;  3HHT B;  4RCB A;  3CCL T;  1BIA A;  4M7A F;  3OQ5 A;  4II1 A;  3JB9 I;  1YIT A;  2DIG A;  4IUR A;  5GAM f;  2WSE E;  3VYH B;  1HK9 A;  2VUB A;  3OSS C;  4F7U A;  4LD9 K;  1QDN A;  2DKG A;  2LTO A;  5ERG B;  2X35 A;  4TVR A;  4VUB A;  1B34 B;  2P0P A;  2WAC A;  5GAN 7;  1YJW T;  2GQV A;  2QXF A;  4XTX A;  4C0G A;  3G71 T;  1NPR A;  1Q7Y C;  4AQ7 A;  3BW1 A;  4M7D F;  1GXI E;  3JB9 F;  3GNG A;  4XU0 A;  5CKH A;  5LJ3 d;  3L2V A;  3VV0 A;  3CME A;  1G3W A;  2LCC A;  2DZ9 A;  2Y90 A;  3MCA B;  3MET A;  3UDC A;  3OYA A;  5LJ5 e;  4RMO A;  1U1T A;  3GPL A;  1KHC A;  4MZT A;  1BI3 A;  1OZ2 A;  2Y4Y A;  4M78 F;  4IUV A;  2X4X A;  2YLB A;  3A8M B;  2ZZD A;  2YLC A;  3E19 A;  3QJ6 A;  4MDW A;  3J7A F;  3CBM A;  2A3L A;  3JCM b;  1OYX A;  2L8D A;  3QXE B;  1M1K C;  1M1K U;  3FEO A;  2XDP A;  2F69 A;  3CCR T;  2LNV A;  4O5V A;  3OYD A;  3L2W A;  1Q86 C;  1Q86 U;  5EQJ B;  2GCX A;  2PUO B;  4DQ2 A;  2V8K A;  5LJ3 e;  3LWH A;  5GAN j;  1P92 A;  2PWY A;  2EYQ A;  1BI1 A;  4BDZ A;  1Y71 A;  4X9D A;  1KC8 U;  2E10 A;  5LJ5 h;  3QHS A;  4L5G A;  3LGL A;  4OP0 A;  3RMS A;  5GMK l;  3CCV A;  1VQ5 T;  1VQL T;  2ZGW A;  5D6X A;  1WQ7 A;  3OW2 S;  5FRN A;  1O75 A;  1M5Q 1;  4C5I A;  2DO3 A;  3MP8 A;  1U1S A;  1IZ6 A;  2KVQ G;  1YI2 A;  4ATO A;  1YJ9 A;  2E12 A;  4C92 B;  2D6F A;  3H8Z A;  4C92 F;  3PGG A;  5GMK j;  3SDZ A;  3OSV A;  4BDY A;  2AHJ B;  4RCC A;  3BQB A;  4E7L A;  5FU6 B;  2OTJ T;  5LJ3 h;  4C8Q E;  4QVD A;  2RM4 A;  1R7R A;  1KQS A;  1K9M U;  3JCM J;  4E47 A;  3FB9 A;  3QQ7 A;  2VGN A;  4OMF B;  2MI6 A;  4EMH A;  3JCM X;  1VQ9 A;  4RG8 A;  1E32 A;  4KLN A;  4M77 B;  5LJ5 f;  2FL7 A;  1I5L A;  3AHU A;  4YTL A;  2QQA A;  3A5Z B;  1M4Z A;  2KQW A;  3KBG A;  5KCO A;  3CCM T;  5DLQ E;  5GAO l;  3P8H A;  3MP6 A;  2OTL T;  5FTM A;  2RJE A;  4OVA A;  3BDU A;  5A0L A;  2MM0 A;  3OBY A;  1VQ6 A;  4E7J A;  3L1A A;  3A8O B;  4QQ6 A;  3M9Q A;  3HU3 A;  5B6C A;  5GAN g;  2IVW A;  4QW2 A;  3OYJ A;  2M0O A;  2YHT A;  1JRI A;  3QC8 A;  2L89 A;  1BKB A;  2ZPG B;  3OYK A;  2O4X B;  4HA8 A;  3KXT A;  4M7A C;  2LCL A;  3VUZ A;  4ZN3 A;  2XDD A;  1YHQ A;  2CZ1 B;  3CD6 T;  4A4H A;  2V8J A;  1NPP A;  4M7D E;  2LT4 A;  5CKB A;  3FLG A;  3QYG B;  3VJP A;  4M7A G;  2XHC A;  4KUL A;  4KUI A;  4IKF A;  5GAO r;  4J6X A;  1LOJ A;  2RI2 A;  3FIF A;  2DXU A;  1VQK A;  1UGP B;  3VUB A;  4N4G A;  2LQK A;  4M78 E;  3OB9 A;  2EQK A;  4LDV A;  4M7A A;  3FPT A;  1S72 T;  4PJO D;  2DXC A;  2XI9 A;  4M75 F;  2LDM A;  1ZQ1 A;  4IUQ A;  2MWP A;  2RJD A;  5FLX E;  3PIP A;  1H64 1;  2PVD B;  2E6Z A;  4M7D G;  4ZGE B;  5GAM j;  3CEY A;  3MEW A;  2EJG A;  2E41 A;  2GFA A;  3CCQ A;  1WPY A;  5FU7 C;  4P5N A;  3OYN A;  4M78 C;  1WQW A;  4JUV A;  4OB3 B;  3QSU A;  3HRT A;  2Y4X A;  3J81 E;  1G3S A;  4M78 G;  3CCJ A;  2K3X A;  1XOV A;  1UB4 A;  2ZPB B;  1DJ7 B;  3TRE A;  3L2R A;  1JJ2 S;  4M7D A;  3R6O A;  2K5I A;  4LDY A;  1RL2 A;  2XIC A;  2D9T A;  3QYH B;  5IN1 A;  3PTA A;  3CXC A;  1K8A C;  3PNW C;  4M78 A;  4NS5 A;  4MDX A;  4HCC A;  3VKI A;  5CQX A;  4C92 E;  5CKE A;  4R55 A;  3LH0 A;  3QPH A;  2A7Y A;  4FT4 A;  3OYL A;  3CCS A;  3RKW A;  3CPW S;  4ZTF A;  2Q18 X;  2EQU A;  3OBW A;  5J39 A;  3I55 A;  2QQS A;  2CYZ B;  4NL2 A;  3E9G A;  4A54 A;  4A53 A;  2JTF A;  4PLL A;  3TIW A;  2QDY B;  4BE2 A;  3VYG A;  2M16 A;  2B8A A;  3PMT A;  3QQ8 A;  1VQP A;  2NLU A;  2RH2 A;  3JCM e;  5CIU A;  1M1G A;  2LRQ A;  1PSF A;  1O9S A;  2DD5 A;  2BKD N;  5IT9 E;  3MEU A;  5A2Q E;  4BI4 A;  3NFC A;  2XKO C;  5GAM g;  1CR5 A;  4J7I A;  4FIB A;  5GAN 8;  4JS4 A;  4C5H A;  3TU4 K;  3ZJT A;  5L8R E;  1M90 C;  1M90 U;  2DXB A;  2RJC A;  1X6O A;  3T9N A;  2CS7 A;  2L3R A;  3QWZ A;  4XTZ A;  4CRI A;  1VQO T;  1YIJ T;  1YBY A;  2IG0 A;  5AYF A;  3BFM A;  3QZ5 B;  1QVP A;  3P8B B;  1QP2 A;  3A8G B;  1NE8 A;  3KUF A;  3QG1 A;  1Q7Y U;  3JCM h;  3HL8 A;  2HD0 A;  4BAC A;  2HAX A;  4N4H A;  3QII A;  2QQB A;  3V8L A;  1MGQ A;  5I2S A;  4BUG A;  1VQM A;  3L2Q A;  2XDB A;  5LJ5 j;  2PQW A;  4BE0 A;  3M53 A;  3E1S A;  1G5V A;  2PJH B;  4E7I A;  2XD0 A;  3LHD A;  4M75 E;  5GAN 4;  2CZ0 B;  5KE3 A;  3BDL A;  2ZPH B;  4GLK A;  1YCY A;  3GLX A;  4OGE A;  4A4K A;  4N4I A;  3GIB A;  2MAM A;  1XQH A;  3UWN A;  1JBM A;  2BUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...