5D6WA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6wA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6wA02
3L42A 2NLUA 3MP8A 3OB9A 2EQUA 3L2WA 4BE2A 3S3OA 4BDZA 2BIVA 4IUVA 4C5IA 3ZEHA 3ASKA 3OYDA 2GFAA 2X4YA 5FRMA 3OYIA 3MEVA 4IKFA 3PFSA 4E7IA 5KE2A 2EQMA 3F70A 3Q1JA 3DB4A 3S3MA 1RI0A 2BKDN 3ME9A 3OS0A 2HQEA 2E6NA 4BDYA 2R5MA 4OVAA 2BUDA 2L3RA 3S6WA 2M0OA 4A4EA 4BACA 4N4GA 3OYEA 1OZ3A 3UT1A 5FROA 3OQ5A 3CEYA 4BE0A 2E5QA 3MP6A 4PL6A 4Z02A 3DB3A 3META 5J26A 4N4IA 2O4XA 3MO8A 3LGFA 3MEWA 4QQDA 4B9XA 3S3NA 2X35A 4NS5A 5C0MA 2RJFA 3QKJA 5D6WA 4EDUA 2RJDA 5KCHA 2LDMA 4BD3A 4ZTJA 2RHUA 3FDRA 4IUPA 4IUTA 4HCZA 3OYKA 2LVMA 4UC4A 3OYAA 3O8VA 1WJSA 2X4WA 3BDLA 1H3ZA 1OZ2A 2PQWA 2QQRA 5IN1A 3E9FA 4ZTFA 4A4HA 3OA6A 3FC3A 1WGSA 5KE3A 5KH6A 4E7LA 3PMIA 3M9QA 3E9GA 4IUQA 2LCCA 3KUFA 3OY9A 2O4XB 3OYMA 3GOXA 4E7JA 2G3RA 2RJCA 3OMGA 3OS2A 3OYHA 2R5AA 2QQSA 2P0KA 3P8DA 5J39A 4X34A 3OYGA 2CKKA 2B8AA 2RHZA 2X4XA 3FEOA 3P8HA 3OYNA 3L2QA 4A4GA 2RI2A 5FRNA 1WJQA 2FHDA 2RHXA 3MEAA 4PLLA 3C4SA 4A4FA 3QIIA 3OYLA 3OS1A 2JTFA 2MWPA 2IG0A 1KHCA 4GY5A 2YRVA 2LTOA 4QQGA 3OYBA 4PLIA 4C5HA 3H6ZA 2R58A 4B9WA 3QJ6A 3MEUA 3OMCA 5IAYA 4L59A 2F5KA 3LX7A 2L8DA 2MWOA 5D6YA 4C5EA 3NTIA 2RHYA 2L89A 2RJEA 2XK0A 2EQJA 4QQ6A 2WACA 4IUUA 4RG2A 5D6XA 2XDPA 4CRIA 2GFUA 3L2UA 1G5VA 3PNWC 2K3XA 3OYCA 4C5GA 2M1HA 3L2VA 2RI3A 1N27A 3NTKA 4IURA 4QVZA 4LD6A 4II1A 2D9TA 1MHNA 3LGLA 3PMTA 3SD4A 1OI1A 2VYTA 3OYJA 4E7HA 3NTHA 4FL6A 2EFIA 2LRQA 3LLRA 3FLGA 2DAQA 3OYFA 4E7KA 4QW2A 2R57A 3EAEA 2DIGA 3QBYA 2JZ2A 2RO0A 2EKOA 2RHIA 3DLMA 1OYXA 5CIUA 4Q5WA 3L2RA 2GF7A 4N4HA 2HQXA 3MP1A 5C6SA 1SSFA 5M9OA 2EQKA 1XNIA 2M16A 4FU6A 3LYIA 3UWNA 2K3YA 1WJRA 4BE1A 3H8ZA 2RI5A 2DIQA 5KCOA 3LH0A
chains in the Genus database with same CATH superfamily
1HYOA 2MCNA 1WFWA 2RQVA 3L2WA 2CP6A 2K79A 3A8LB 1GRIA 1QLYA 1M5Q1 1C0MA 2BKDN 4BDYA 3CCVT 2DZ9A 4ZN3A 4FYXB 2L3SA 1YI2Q 1VQNA 2LCSA 4Y28E 5GAMe 5IHNA 3S3NA 3VS0A 1W2BA 4AFUC 3CCQT 2VUBA 4XTXA 1MMDA 3G6ET 3CC7Q 3VS5A 3VYHB 1TSFA 3O8VA 2D8HA 1WHGA 5A0DA 1E6GA 3EGDB 4JRKA 3E9GA 3KUFA 4YTLA 3G4SA 4P5NA 3O5ZA 3QDRB 3JRZA 4EIKA 1PD0A 1KG1A 2QDYB 1IO6A 2VV5A 8ATCB 3P8DA 3SWNC 4J9EA 4OB2B 4M7AB 1JRIA 1VQ4A 4N0AA 3QIIA 3JCMJ 2IG0A 4OMMA 3CQTA 4Z8AA 3OYBA 3CCRT 3GF5A 1YN8A 4KH0B 1M4ZA 4KH1B 1Q7YC 3LX7A 4KRTA 1M1KC 1ZSGA 2K6DA 1YNZA 4LN2A 2EQJA 4RG2A 2CYZB 2XDPA 1QDNA 4OB3B 5KYUB 3PNWC 2PUKB 2L2PA 3QYGB 2QA4T 4OF1A 4CC3A 2C0OA 2AZVA 3LHDA 1S72T 2IVWA 1VQPT 1Y71A 3FRNA 4MZPA 2D8JA 3D7SB 4PJOC 1UE9A 2RA2A 3QBYA 5I11A 3GNGA 1WXUA 2RO0A 3DLMA 5GAMg 2AZSA 2ED1A 1X75C 3QDFA 3CCMA 3LWIA 2HQHA 3CCJA 2YUNA 3EH2A 1VQMQ 3U23A 3S3OA 1WDXA 2JMCA 3ER0A 3PFSA 4E7IA 1AWWA 4FYYB 4C92B 2PU9B 1RI0A 2VXFA 2QTVA 3R6OA 4J9FA 3CC4Q 3M57A 2CT4A 1H3HA 2LP5A 2ZAEA 4J9DA 4Z02A 2YUPA 1YITQ 1OPLA 2A0FB 2LX7A 1RAAB 2DTOA 1VQ4Q 5EPPA 3QXEB 4BD3A 1T3LA 2ABLA 4M7DB 2LCLA 2F1LA 4M75A 2QYZA 4EMHA 3E9FA 1YI2T 1JB0E 3A98A 1G3TA 1VQOQ 3JSCA 1UECA 3CXCA 3OMGA 3CC7T 4E2FB 1S1NA 1WJQA 2CUDA 1T0JA 3HRSA 3OW2S 3PVQA 2VB6A 4GY5A 1OX9A 4QQGA 2CZ7B 4PLIA 3CCUQ 1U06A 1BU1A 1X27A 1K9MU 4J6XA 2B86A 2QK0A 3MCAB 2QASA 4CRIA 1R8OB 1VIEA 4GBQA 2PVGB 2K5LA 1N27A 4J83A 4QVZA 2RNAA 1E6HA 3OYJA 1OULA 1M90U 3QWXX 1M8MA 2HD0A 1CZ5A 4XU3A 2DJQA 3I56A 4OMPA 2LJ1A 3QZ9B 3ZBDA 2EYXA 3RKYA 3JB9I 2EQUA 4BE2A 2CH4A 3ZEHA 3QJYA 2CH4W 4LDUA 2L0AA 3MEVA 1AT1B 3M53A 5KE2A 1YCSB 4CC7A 3IQLA 2A08A 1VQMT 2BUDA 2C0IA 3CEYA 3WXMB 3JCMd 1YJNA 2JVVA 1PC0A 1VIFA 2EYZA 4AS1A 3LW5E 4EMKC 2L3QA 2O88A 3BDUA 2OX7A 2QG9B 1I81A 1X69A 4R56A 3TVTA 3CC4T 3HU3A 3BDLA 1M9SA 4LUDA 2MOXA 3OA6A 5KYWB 2EGCA 1YITT 2I2LA 1VQ4T 1SF9A 5KYYA 3M0QA 2KROA 1KQSS 3OYNA 3DKMA 1M2OA 5FRNA 3M55A 1WQ7A 2LQWA 1WIEA 2RB6A 2EGAA 3PT9A 4Y92A 1VQOT 1TG0A 2R58A 4B9WA 2J06A 5IH2A 2DXCA 2RHYA 1PRMC 4XAXB 2ATCB 4C5GA 3CCUT 1VQLA 5FW9A 4QW2A 5CKHA 1ZQ1A 2JZ2A 4X9CA 3A1PA 3VS2A 2YUJA 4ARIA 3OW2P 4M75D 1G3WA 1RADB 1IREB 4Z89A 1QVGS 1I07A 3CCSA 3NPFA 1BI0A 1B7TA 4FYWB 5CKBA 1J3TA 3X28B 4KUIA 1VA7A 4KGVB 2X4YA 1IGQA 2Y90A 5GAN4 4NOYA 2DL3A 3CC2Q 3QC8A 2LNHB 3ME9A 1PRLC 3MKDA 4RV0A 1SRLA 2QGFB 1OZ3A 3EGDA 4BE0A 1TH7A 3L1AA 2K57A 1W2BS 5IT9E 3RR6A 2F5TX 2O2OA 2HKQB 4B9XA 2X35A 1MNDA 2RJFA 5CKEA 1I5OB 4PFOA 4M7AA 4HCZA 4ME7A 3L2ZA 4D8KA 1VOMA 1BKBA 2HSPA 9ATCB 1KFZA 3QWZA 4OMFB 3JB9J 2KT8A 3OYGA 4JUVA 4DBFA 5KYUA 2RHXA 3EFOB 4C8QG 2EYYA 3CCVA 4LDYA 1BI1A 1WA7A 3CPWP 3HRUA 4HVUA 5GAOq 4MMKA 3C0CA 2OTJQ 3CCQA 2WACA 3G6EA 2EW3A 3EFRA 4JLGA 1TOVA 2CZ1B 3M0SA 2BZXA 2H3EB 2VGNA 4PFZA 2SRCA 2VYTA 4CC4B 5GMKj 2X3XD 4FL6A 2QDLA 2E6ZA 1B34B 2R57A 5CK9A 1KQSP 1BBZA 2H3JA 2VGMA 3HU1A 1P92A 4J7FA 1U1SA 4FCYA 1N5ZA 4FU6A 4C92A 3CCRA 2F2WA 3LYIA 4XTVA 1G8XA 5KYXB 4ORZA 1Y57A 1SEMA 2EAYA 4D8DA 1FMKA 4LDXA 4C0ZA 2CS7A 1GFCA 2LC4A 4ESRA 3X20B 1JBMA 3VJPA 3OYIA 2QA4A 4M7DA 2J7IA 1Q81U 2EJFA 4TVRA 1S72A 1M1KU 1OPKA 2CP5A 1VQPA 2M0OA 4OP0A 4N4GA 3QWYA 1BIAA 3H0HA 3BFMA 4O5VA 2EYWA 1JJ2P 3CC2T 3FDRA 3TU4K 2K3BA 4AG1C 1D1BA 2MK5A 1NBEB 3LH5A 1FXXA 1WYXA 1UGRB 4C8QF 5LJ5j 4RTZA 3FEOA 3P8HA 2RI2A 2FHDA 3PIPA 1ZX6A 4L6V5 1WXBA 1I4K1 3OS1A 2JTFA 3BW1A 4M77C 2LX9A 4C5HA 2ZGWA 3QJ6A 3SEMA 1W2BP 2LQKA 4FIBA 1EZZB 2L8DA 2MF2A 2RF0A 1GL5A 2RJEA 3ULRB 2XK0A 4PKCC 1QMCA 4LD9K 3ZJTA 4WCIA 3CD6Q 1BYMA 1YI2A 4II1A 4A53A 1D0YA 2PNIA 2FZKB 2OTJT 2BE7D 2GNCA 4PJOG 2E41A 3CC7A 1QCSA 2BTTA 3JCMV 1GXIE 1SPKA 2ZPEB 4B6MA 4KO8A 1NEBA 3G7ZA 3MP1A 1GCQC 4PJJA 4LXCA 5C6SA 4M7AD 1C1AA 2M0YA 4KODA 3H8ZA 4V2SA 5C18A 4OB1B 2A7YA 3TIWA 4C0DB 1CSKA 3EG1A 3M0UA 4J9IA 2GFAA 1MMGA 1OX8A 5FRMA 4IKFA 3F70A 2DTIA 4F7UG 2DKGA 4RCBA 4PJOE 2NWMA 5KYWA 1S3SA 3DB3A 2QGGA 1T0HA 4E7SA 5LJ3e 1QVFA 2FEIA 5GANd 1LOJA 1TUCA 2JV2A 1YBYA 1XOVA 1AZGB 4M78D 3CBOA 5CKDA 5EQJB 1ZSZB 1SSHA 4CI0C 1ZA2B 2RH2A 4M78C 3EHRA 3M0RA 1AEYA 2FG0A 3RESA 2KYBA 1RACB 3OYHA 5J39A 2OAWA 5GAMj 1K8AR 2RHZA 2X4XA 1NLPC 3INZA 2K5FA 1QW1A 4PLLA 2QXFA 3OYLA 4FT2A 4F7UE 3CPFA 5FU7B 1VQMA 4C92D 2DL4A 5CVIA 5DM7R 1K73R 1KSWA 4HCCA 1SG5A 2HBWA 5A0LA 4HT8A 2P0QA 4XTZA 2DEUA 1NJIC 2MYSA 2EGEA 1KJWA 4J5YA 1QCFA 2BE9B 1G5VA 2MI6A 3CC4A 5HCKA 4M7DD 4BY6C 2K4YA 4PJOF 4LD6A 1AWOA 1YITA 3I5SA 1GCPA 2NYSA 2PZ1A 5GJVB 3UF4A 1PHTA 3G71Q 3CXCP 5GAN8 1VQ9Q 3QZ5B 4C8QB 2XDDA 3VUZA 3V8KA 1N9SA 4IIMA 4JRIA 2E3IA 1AVZC 4F16A 2RHIA 2ESWA 4J9BA 4DOVA 3JCMW 1I1JA 3RBBB 1W4SA 4QVDA 3CD6T 4OMNA 5I21A 4RTTA 2DVJA 3GLXA 1QP2A 5M9OA 1MUZA 2KMTA 1VQOA 2I0NA 3UWNA 6AT1B 2YWWA 2RQTA 3H0FA 1I5LA 1ACMB 3V8JA 3QG1A 2RN8A 4JLIA 4F7UF 4LE9A 1D1AA 3CCUA 2YUOA 4LDWA 2A28A 2HQEA 2Z0WA 3G1JA 1YIJA 4AG2C 2HAXA 2F2VA 1W1FA 4XU1A 2J6KA 2EIFA 1B3QA 3I5RA 3RDVA 2YSQA 5HK0A 2C0TA 3QKJA 5GAN5 2QQBA 5KCHA 2Y4XA 1R7RA 3EFOA 2X4WA 2YLCA 4ZTFA 1UFFA 3BQBA 5LJ5f 3M9QA 3MPUB 3OYMA 4HA8A 1UB4A 1AWXA 5I2SA 2R5AA 4PJMA 2CGHA 2KRMA 2QQSA 2LJ3A 1YJ9Q 1GFDA 4ZN1A 1NG2A 1TS9A 1YFNA 4FW1A 5ERGB 4JPBW 1LJOA 3JCMQ 1IZ6A 3KFVA 2X9HA 2RMOA 4F14A 1CR5A 3TEEA 1B34A 4QQ6A 2RQUA 4AT1B 5CAIA 3EG0A 2X3WD 4ZGDB 3SWNB 3LGLA 1K9MR 3FB9A 4QKUA 5FU6C 5KYXA 2EFIA 2M51A 3LLRA 4JJBA 1TWBA 3VS6A 1U1TA 1UGQB 5CR2A 5GAN3 3RERA 4OMOA 1JEGA 2EKOA 2D6FA 3L2RA 1YIJQ 2ZPIB 1RI9A 1M90R 1XNIA 2EPDA 2H8HA 2DILA 4PJLA 3G71T 1VQ9T 4NL2A 2Q19X 4DA4A 2KBTA 1VYUA 4PK4A 1N9RA 2COWA 4C5IA 2KK4A 4BUGA 2DFUA 2FRWA 2JM9A 4PJOB 4JJNK 3S3MA 1KC8U 2ENMA 3WVDB 2JJ9A 2K2MA 2R5MA 4A4EA 3VKIA 3REBB 3AT1B 2VKNA 2E5QA 4N4IA 1YJWQ 2JNGA 1VQ7Q 1BI2A 2DVEA 5D6WA 4ZTJA 4IUTA 3CMEQ 1MGQA 1K0XA 2J6OA 4DOWA 1ZUUA 4XU0A 4MDXA 1JQQA 5I2MA 1I9GA 1U8RA 1V29B 4ANJA 4RG8A 2LCCA 5GAMf 1W70A 3EGUA 4F7UB 4N0AC 3CPWS 2LW6A 4M4ZA 4X34A 1SHFA 3GP8A 1VQKQ 2AK5A 1HJDA 4DEYA 3TSWA 1KK7A 2PVDB 2HMAA 1K8AC 2OJ2A 4AQ7A 1OV3A 2G6FX 3QQ7A 1ZBXA 1G3SA 4OGEA 1WZOA 1YJ9T 4FSXA 3A8OB 5FTNA 3RMSA 3CC2A 1K73C 5D6XA 4IUUA 1UGVA 2GFUA 4KGZB 5IXBA 3OYCA 3J7AF 1FMWA 1YWOA 2FB7A 1RAEB 1QP3A 1VQ8Q 2B25A 2VVKA 1NM7A 5B6CA 1M3CA 2QI2A 3VS4A 2GTJA 4CC2A 2FL7A 1QCNA 3VRZA 1T3SA 2HQXA 2LT4A 1M30A 5FTLA 1SSFA 2NUPB 1Q86U 2DD5A 2P84A 3HTRA 3M59A 3EGXB 1HK9A 1KIKA 3SFMA 4X9DA 3JCMe 4IIOA 2BIVA 2F2XA 1YIJT 1N8RR 4J9CA 3T9NA 2KQWA 5HY6A 3ZFJA 2IIMA 3EFSA 3QUIA 1JJ2S 3PVLA 2OTJA 3QQ8A 4KGXB 4A63B 1Q82U 1ZSZA 2DM1A 4MZTA 5FLXE 2CSQA 3FJPA 3MP6A 2DMOA 3JB9H 1I8FA 3LGAA 4M75C 1N6AA 4EDUA 2LDMA 5CCAA 3J81E 4RMOA 1M8VA 5IXFA 1SKUB 1BIBA 4OGCA 2AT1B 1NYGA 2CP7A 1YJWT 2AKKA 3DLLA 1ZUKA 1CKAA 1VQ7T 5I22A 2CZ0B 3OS2A 5GMKi 3CMET 1WXTA 4KT0E 1BCMA 1MMNA 3C4SA 4A4FA 4EMKB 4M77G 1E32A 5EC7A 4RTYA 5FWCA 2KRNA 2LTOA 1OU8A 4XK8E 2C06A 1LPLA 3CCEQ 2QQ9A 2Q1DX 4C8QA 1VQKT 2L89A 2K3XA 4ATOA 5FTMA 4IURA 5GAOn 1UDLA 2E65A 3QYHB 2DK3A 4E7HA 2O01E 1X2KA 2KRSA 3JCMc 1U3OA 2DO3A 3CCLQ 1NJIR 3X26B 1ZA1B 5L23A 1QCOA 1K9MC 2RM4A 1OYXA 2IPOB 5CIUA 1YHQQ 2JMAA 3V7SA 4M77E 1VQ8T 2KYMA 5LJ3h 3JB9G 2M16A 3VU3C 1RAFB 4QT7A 5IHIA 2RI5A 2DIQA 5KCOA 3LH0A 2O9SA 1RAHB 1NYFA 4Y91A 2PJHB 1M90C 2CZ6B 3RKXA 1H92A 2ECZA 3ASKA 3KXTA 4FYVB 2XMFA 1ABOA 2Q18X 1PG5B 1UG1A 2CP0A 3QO3A 3SDZA 5GAN2 2COZA 2K2VA 2SEMA 4C8QE 2FPFA 4J9HA 1M2VB 4OVAA 4BACA 1KD1R 2CT3A 3OYEA 3HU2A 2JN0A 1O9SA 1PD1A 2DA9A 3PGGA 3CD6A 1A0NB 2FVUA 4IUPA 1WHMA 2KVQG 5GLFA 1H3ZA 3REAB 4DQ2A 3FC3A 1Q7YU 1QWFA 1V76A 3OY9A 3KBGA 2XICA 3MJXA 5LJ5d 1MMAA 3GOXA 2DE0X 2RJCA 4M77F 2P0PA 1BB9A 5GANh 3QPHA 3UPUA 1OEBA 3EH1A 3H9NA 4BB7A 2E10A 3UA6A 4D6WA 2KAFA 3SWNA 5CO7A 2HCKA 2DRKA 1WNLA 3VS1A 1QVFP 2F5KA 2XKOC 3PE0A 1D3BB 3CXCS 1WHJA 2KEAA 3HFNA 2KNBB 4E47A 4HT9A 2M1HA 3C95A 3HRTA 3C12A 3PMTA 3CCET 2KXDA 3RMQA 1FX7A 2YUQA 3TREA 1NLOC 3FJ5A 3FLGA 5FTKA 1M1GA 1VQ6Q 1JXOA 1QKXA 3JB9F 4PFPA 2EKHA 4JJCA 5C1BA 2PUOB 3RKWA 4PJOA 4DBQA 4XTUA 4BE1A 4XQ3A 3CCLT 1TUDA 2RPNA 1G2BA 1TUGB 1JXMA 3MP8A 1YHQT 3OYDA 1E7OA 4AFZC 2GGRA 8AT1B 3A8HB 2GQVA 4J6YA 2OTLQ 3BY7A 2HSEB 2J05A 4OMQA 2E6NA 1N8RC 2L3RA 3S6WA 1VQ5Q 2KXCA 1BK2A 4KDLA 4PL6A 2V1QA 4C8QD 1M3BA 3META 4M7AC 4MMLA 3MEWA 2A36A 4F7UA 4OB0B 4JS5A 4JRPA 1WPYA 4OMLA 2QEXQ 2QAZA 3G71A 1VQ9A 1IXDA 1WJSA 1R0CB 4KUDK 4JJDA 4E7LA 4KULA 2FYKA 1GBQA 5FTJA 2ED0A 5GAMd 1SHGA 3C94A 2D1XA 3CMAQ 2ZPBB 1UJ0A 2JS2A 1YP5A 2B8AA 5LJ3j 3H41A 3VRYA 2DL7A 4HVWA 2NUZA 3EG2A 3H6ZA 3OMCA 3HKSA 3NTIA 1ARKA 1GBRA 5D7UA 4KDIA 1ZUYA 2L5QA 3L2UA 1BCOA 1ZLMA 4XTWA 2RI3A 2E64A 2NUPA 1QVGA 1OQKA 3NMZC 1JO8A 3SD4A 2CDTA 1OI1A 3EGXA 4A4KA 1MV0B 2DPPB 2L3PA 4M77B 3R6NA 2DAQA 2GCXA 4C92C 3THKA 3ZJVA 1NEGA 2YRCA 1DJ7B 2LJ0A 2NLUA 1VQ6T 1YJ9A 3OB9A 4HXJA 1CZ4A 2K7AA 3I55Q 4M7DC 1G3YA 2YXYA 5GANj 1UHFA 1K76A 4NL3A 5GANe 3HHTB 1AHJB 2VC8A 2JTEA 2D0NA 1K8AU 3QHSA 1JU5C 2W0ZA 2KSSA 2P4RA 1G83A 5LJ3g 3RNJA 1K73U 2DXTA 5FROA 3OQ5A 1PKTA 3MO8A 2YHTA 4QQDA 5AT1B 5C0MA 5HKCA 1Y0MA 1KD1C 1HXDA 2MM0A 2PTKA 2OTLT 3PIOA 2XG8D 4KBMB 2DF6A 2M9UA 4UC4A 1VQ5T 4EMKA 1QWEA 3A8GB 1Q81C 3V7CA 4JDSA 5KE3A 3CF2A 2E5KA 3GIBA 4E7JA 1VYVA 2CP3A 1WHKA 2QEXT 4WTOB 2LMJA 1NPPA 4EMGA 3L2QA 3I9QA 1RAGB 2FZGB 3X24B 1AWJA 3PTAA 4PJOD 1O75A 1WQWA 2FPEA 3MHXA 3TSZA 4LNPA 2E12A 1KHCA 1XTDA 4F04B 1IB8A 1K9AA 1ZHIA 2YT6A 1Z9ZA 5CD1A 4AFSC 1UGSB 3CMAT 2Q1AX 1ABQA 5D6YA 2NUTB 2DZCA 2J6FA 1BI3A 4M78B 5CCBA 3JCMh 1M3AA 3CBMA 3E2UA 1PSFA 5GANg 1VQNQ 2V26A 2XI9A 3HP9A 3RIRA 3NTKA 1PWTA 5J3BA 4JZ3A 1YJWA 5GAN6 1VQ7A 5EG2A 2VXEA 1U5SA 2V8IA 4E7KA 1RUWA 2O31A 4PNOA 3VS3A 3CMEA 2EVRA 2DIGA 2V8KA 1LNXA 2DLPA 4Q5WA 2HDAA 2FO0A 4QVCA 2ZPFB 3A5ZB 4N4HA 3G4SQ 2EQKA 4ELYC 1VUBA 3M0TA 4C0GA 2CREA 2DTHA 3NTHA 1M2VA 4BY6B 2JTMA 5KYNA 1VQKA 4K11A 1Y96B 1D1CA 1NPRA 2X4JA 4FSSA 4KLNA 3Q1JA 3QSUA 3DB4A 1WHHA 2COYA 3JAME 1D0XA 1M1FA 1UHCA 2E70A 4BI8B 5GJWB 2YLBA 2PWYA 1PKSA 1K0SA 5LL6S 3UT1A 3I55T 3EG9B 3OBWA 2AHJB 4RTXA 1LCKA 5GAOl 3LGFA 1KC8R 4M75G 3AHUA 2DJZA 2RJDA 1VQ8A 2EQIA 3OYKA 3E19A 3HPWA 4EPCA 4JRQA 2QQRA 1Z9QA 4A4HA 2AKLA 1RLQC 1WGSA 5CKFA 5KH6A 1VYTA 3CCMQ 2O4XB 2DL5A 5LJ3f 1D0ZA 3CCJQ 1H641 2K9GA 1F1BB 2P0KA 1D3BA 1EX4A 2M02A 2DBMA 3MEAA 4ZGEB 2K5IA 2MWPA 5IAYA 3I35A 3M4YA 4M75E 4C5EA 4PJNA 3VYGA 4R0KA 1O54A 1FWZA 2DYIA 1NE8A 1X01A 1LVKA 4L5GA 3L2VA 5GAN7 5DYIA 1MHNA 2FPDA 2Y4YA 1UGPB 2LRQA 2X51A 2KDSA 3SB2A 3OYFA 1VQNT 3SHWA 7AT1B 3VUBA 4CQNA 3NFCA 2DBKA 2HNIA 5GMKh 3EHQA 4FM4B 2K3YA 1WJRA 1K1ZA 5GANf 1WLPB 5ECAA 2CP2A 3L42A 3V7RA 3WVEB 2XIDA 3UDCA 4FT4A 2HBPA 2JT4A 3FPTA 4IUVA 5FU6B 1X6OA 1XQHA 1Q86R 3G4ST 1TU0B 4J8OA 1OOTA 1TXQA 5A2QE 5A0GA 3CCEA 1D09B 2XD0A 4Z88A 4M75F 1EFNA 4RTWA 3ZGZA 3P8BB 1QKWA 2F69A 1X43A 4NS5A 2ZCFB 4BI3A 3LWHA 2QQAA 3HSBA 2OI3A 3TCJA 4HCBA 3FPUA 1Q82R 3JCMb 3URGA 4RKUE 2DEQA 3CCLA 1B07A 4J7IA 3I56Q 4XU2A 1WLFA 3M56A 5GAOm 3N5BB 3PMIA 2EJ9A 1YHQA 1FYNA 4C0FA 5GMKl 3OBYA 2G3RA 2VASA 2E3HA 4XTYA 1RLPC 4LDVA 1KQ2A 2MPXC 1QVFS 2CKKA 3OSSC 2CSIA 2JW4A 1XJWB 2EJGA 1ZC1A 1CKBA 4E6RA 3CCMT 1MV3A 2E4HA 1HD3A 3MEUA 1IGUA 2ZPHB 3CCJT 2V1RA 3X25B 2DETA 5LJ5h 4M77A 2DL8A 4ELZC 4O6JA 2JM8A 2V8JA 4R55A 4BI4A 1YJNQ 1N8RU 4DBRA 3H0IA 5L8RE 2RD1A 2CUBA 4ARCA 2YDLA 1EIFA 1KHIA 2JOYA 5AYFA 4E7ZA 1X2QA 2DXBA 2WSCE 2GF7A 3JCMg 3NGPA 4AFQC 2JXBA 2DXUA 2LQNA 2QTXA 3CBPA 4HKEA 2KI7A 2WSFE 2Q1CX 2KT1A 1GCQA 5DY9A 4WF2A 3GBQA 2MM2A 1Y07A 1AZEA 4BDZA 2PVOB 1IHVA 2AIRB 3FIFA 4AMCA 4GLMA 5GAOp 3NHNA 2YRDA 4VUBA 3OS0A 2MAMA 3VV0A 3M5AA 4FW2A 2EBPA 1UJYA 4M7AG 1UUEA 1AD5A 3HFOA 2BZYA 4DEXA 3JCMX 1VQLQ 4J6WA 2RHUA 3M58A 4MDWA 2LQ8A 1WI7A 3A8MB 2LVMA 3OYAA 5IHKA 1RABB 1KC8C 1VQ6A 1PM3A 1FMVA 1UEBA 4ZGJB 5GAOr 2DNUA 2LT1A 2JUFA 1NJIU 1NZ9A 3J80E 2NUTA 2DRMA 3CCSQ 1UTIA 2DD4A 2HKNA 4M78A 5CQXA 3M4GA 1Q7YR 3I56T 2O9VA 3E1SA 3UA7A 1Q81R 2FRYA 4M75B 5GMKe 1M1KR 2LNVA 1PNJA 1OU9A 2KR3A 3OW2A 5GMKm 2OAUA 4M7AE 1IHWA 4L59A 2MWOA 2BZ8A 4JZ4A 5GAMh 1MNEA 2HL3A 4M78G 2OTLA 2JS0A 5HK3A 4HVVA 1V1CA 1YCYA 1VQ5A 3VS7A 2MIOA 1K4US 5CQYA 2D9TA 5FWBA 4C0DC 3BE3A 2E1HA 3OS5A 1R77A 1KD1U 2KE9A 1R0BG 2KY9A 2QEXA 1Y96A 1QQJA 1HSQA 4C92G 1YJNT 2YVLA 1RAIB 3TQ7P 1H8KA 2VWFA 3OSVA 2A37A 2ZPGB 1X6BA 2XU8A 3FPRA 2P4TA 4RTVA 3CMAA 4GLKA 4F17A 2DX1A 1ZBJA 3EG9A 3CCVQ 5DLQE 2WSEE 5CCXA 4M7DG 4M78E 4LUEA 2RK1A 1TTHB 3ZL7C 2GTOA 2EWNA 1QVGP 3M54A 4X1VA 1ZSZC 2EQMA 4DBHA 2ROTA 2FZCB 1Y7XA 3CCQQ 4M7AF 3G6EQ 1Q86C 1WHLA 2DYBA 3JCMf 4MZMA 3RUXA 3V8LA 5LJ5e 2A3LA 2RQWA 4C92E 5J26A 4M77D 2GQIA 2O4XA 1RL2A 5DLOA 1C6VX 3CPWA 3GNFB 1IRXA 1QVPA 5FU7C 3HL8A 1SRMA 1W6XA 4A54A 4JS4A 1Q95G 1PSEA 4RTUA 3UATA 1OZ2A 2W10A 2PQWA 5IN1A 2EYQA 2HEQA 1Q82C 4M7DE 2GBQA 4IUQA 1PCXA 4J9GA 3CCRQ 1M27C 2ZZDA 1VQLT 3JCMP 3GPLA 5LJ3d 3OYYA 4A4GA 1KQSA 2HZYA 4ZNXA 4C8QC 3EG3A 2MMPA 1I0CA 3I55A 4M78F 2YRVA 4RUGA 2QA4Q 2LZ6B 3CCST 5KYYB 1S72Q 2DERA 3JB9D 3ZJUA 3M0PA 1VQPQ 2HL5C 2RQRA 2RK2A 1YWPA 4C92F 4RCCA 2D0QB 1KQ1A 2XDBA 5LJ5g 1X6GA 3EAEA 3MB5A 4HCKA 1WX6A 1JJ2A 2KGTA 4M7DF 3JV3A 1AOJA 2XHCA 5DYGA 2ROLA
chains in the Genus database with same CATH topology
3SFMA 2JTMA 4X9DA 3JCMe 1VQKA 4LDXA 1Y96B 3L2WA 4C0ZA 1NPRA 2BIVA 2CS7A 2X4JA 2LC4A 1YIJT 3X20B 3A8LB 3T9NA 1JBMA 3VJPA 3OYIA 1M5Q1 4KLNA 2KQWA 5HY6A 3Q1JA 2QA4A 3QSUA 3DB4A 4M7DA 3JAME 3ZFJA 3EFSA 1Q81U 3QUIA 2BKDN 1M1FA 1JJ2S 2E70A 2EJFA 4TVRA 2YLBA 4BI8B 4BDYA 1S72A 1M1KU 2OTJA 2PWYA 3QQ8A 1VQPA 3CCVT 2DZ9A 2M0OA 4OP0A 5LL6S 4N4GA 1Q82U 3UT1A 1BIAA 4MZTA 5FLXE 4ZN3A 3I55T 3OBWA 3FJPA 2AHJB 3MP6A 3BFMA 1VQNA 5GAOl 3JB9H 3LGFA 4O5VA 4Y28E 5GAMe 1I8FA 4M75G 3S3NA 3AHUA 3LGAA 4M75C 1W2BA 1N6AA 2DJZA 2RJDA 4EDUA 1VQ8A 2LDMA 3CCQT 5CCAA 2VUBA 3J81E 3CC2T 3FDRA 4XTXA 4RMOA 3G6ET 3TU4K 1M8VA 4BY6C 3VYHB 3OYKA 3E19A 3O8VA 3HPWA 4EPCA 4JRQA 1BIBA 2QQRA 4OGCA 5A0DA 4A4HA 1WGSA 5CKFA 1YJWT 5KH6A 4JRKA 3DLLA 3E9GA 3KUFA 1FXXA 2O4XB 1VQ7T 1UGRB 5LJ3f 4YTLA 3G4SA 4C8QF 2CZ0B 4P5NA 3QDRB 1H641 3JRZA 5GMKi 3OS2A 1KG1A 5LJ5j 2QDYB 2VV5A 2P0KA 3P8DA 1D3BA 3SWNC 3CMET 3FEOA 3P8HA 4OB2B 4M7AB 1JRIA 2RI2A 4KT0E 2FHDA 3MEAA 3PIPA 4ZGEB 3C4SA 4L6V5 3QIIA 1I4K1 4M77G 2K5IA 4N0AA 2JTFA 2MWPA 2IG0A 3BW1A 4M77C 3OS1A 3JCMJ 2LTOA 2LX9A 4XK8E 3OYBA 2C06A 3CCRT 4C5HA 3GF5A 2ZGWA 3QJ6A 1M4ZA 2QQ9A 5IAYA 1Q7YC 1ZC1A 2Q1DX 3M4YA 2LQKA 4FIBA 4C8QA 3LX7A 2L8DA 4M75E 4C5EA 2MF2A 1M1KC 3VYGA 2L89A 2RJEA 1VQKT 2XK0A 2EQJA 4PKCC 1O54A 4RG2A 2CYZB 2XDPA 1QDNA 4OB3B 4LD9K 1FWZA 2K3XA 2PUKB 3PNWC 1NE8A 4ATOA 3ZJTA 1X01A 3QYGB 5FTMA 4L5GA 3L2VA 1BYMA 4IURA 1YI2A 5GAN7 4II1A 4A53A 4OF1A 5GAOn 2QA4T 1MHNA 5DYIA 2E65A 3QYHB 2Y4YA 2DK3A 3LHDA 4E7HA 2O01E 1S72T 3JCMc 2IVWA 2OTJT 1UGPB 2LRQA 1Y71A 1VQPT 3FRNA 2DO3A 2KDSA 4MZPA 4PJOG 3SB2A 3OYFA 4PJOC 2E41A 3X26B 3CC7A 2RA2A 1QCSA 3QBYA 3JCMV 3GNGA 1K9MC 2RO0A 2RM4A 3DLMA 5GAMg 1OYXA 5CIUA 1VQNT 1GXIE 2ZPEB 4KO8A 3VUBA 3V7SA 1X75C 3G7ZA 3MP1A 4M77E 3NFCA 5C6SA 1VQ8T 4M7AD 4CQNA 2HNIA 5LJ3h 3JB9G 5GMKh 3CCMA 2M16A 3VU3C 1E32A 3LWIA 4FM4B 2K3YA 1WJRA 3CCJA 4KODA 3H8ZA 2RI5A 4V2SA 2DIQA 4OB1B 3LH0A 5KCOA 5GANf 5C18A 3V7RA 3L42A 4Y91A 2A7YA 3TIWA 3WVEB 2PJHB 2XIDA 3UDCA 4FT4A 2HBPA 1M90C 3FPTA 2CZ6B 4C0DB 3S3OA 3RKXA 4IUVA 5FU6B 1X6OA 3ASKA 1XQHA 3KXTA 2GFAA 3G4ST 5FRMA 4IKFA 3ER0A 3PFSA 4J8OA 5A2QE 4E7IA 3F70A 5A0GA 2Q18X 2DTIA 3QO3A 3SDZA 2PU9B 4C92B 1RI0A 2VXFA 5GAN2 3CCEA 2K2VA 2XD0A 3R6OA 4F7UG 4M75F 4C8QE 4OVAA 2DKGA 4RCBA 4BACA 3M57A 3OYEA 4PJOE 3ZGZA 3HU2A 2JN0A 4Z02A 3DB3A 1S3SA 3P8BB 2F69A 1O9SA 4NS5A 4BI3A 2ZCFB 3LWHA 3PGGA 5LJ3e 2QQAA 2DTOA 1QVFA 3CD6A 3HSBA 5EPPA 2FVUA 3QXEB 5GANd 3TCJA 1LOJA 4BD3A 4HCBA 3FPUA 4IUPA 3JCMb 3URGA 4M7DB 2JV2A 1YBYA 4RKUE 2LCLA 1XOVA 2DEQA 2KVQG 4M75A 5GLFA 3CCLA 1H3ZA 4J7IA 4M78D 4EMHA 3CBOA 4XU2A 5CKDA 3E9FA 1WLFA 5EQJB 4DQ2A 3M56A 1YI2T 3FC3A 1JB0E 1Q7YU 4CI0C 2RH2A 5GAOm 3N5BB 3PMIA 4M78C 2EJ9A 3OY9A 1YHQA 3KBGA 1G3TA 2XICA 4C0FA 5GMKl 5LJ5d 3RESA 3GOXA 3OBYA 2G3RA 3JSCA 4M77F 2RJCA 3OMGA 3OYHA 3CXCA 4XTYA 4LDVA 2P0PA 3CC7T 1KQ2A 5J39A 5GANh 5GAMj 1QVFS 2CKKA 2RHZA 2X4XA 3OSSC 3QPHA 3UPUA 3INZA 2K5FA 1WJQA 1QW1A 2EJGA 4PLLA 2QXFA 3OYLA 4FT2A 3HRSA 3CPFA 5FU7B 2E10A 4BB7A 4D6WA 4C92D 2KAFA 3SWNA 4F7UE 5CO7A 3OW2S 4GY5A 5CVIA 4QQGA 5DM7R 2CZ7B 3CCMT 4PLIA 1WNLA 3MEUA 4HCCA 2ZPHB 5A0LA 3CCJT 4HT8A 2P0QA 3X25B 4XTZA 2F5KA 5LJ5h 4M77A 4ELZC 2XKOC 4O6JA 1K9MU 5DLOA 4J6XA 1NJIC 1D3BB 2V8JA 3MCAB 4BI4A 4R55A 3CXCS 1VQ4A 4J5YA 4CRIA 1N8RU 1G5VA 2MI6A 1R8OB 1VIEA 3HFNA 5L8RE 3CC4A 4E47A 4HT9A 4M7DD 2M1HA 2K4YA 2K5LA 2PVGB 2RD1A 1N27A 3C95A 4J83A 4PJOF 4QVZA 4LD6A 3HRTA 3C12A 3PMTA 3CCET 1YITA 3OYJA 4ARCA 3RMQA 1FX7A 1EIFA 5GAN8 1KHIA 3QZ5B 4C8QB 2XDDA 3TREA 3VUZA 1M90U 2JOYA 5AYFA 5FTKA 2HD0A 3FLGA 1CZ5A 3V8KA 4XU3A 1M1GA 1N9SA 3JB9F 4JRIA 2DXBA 2WSCE 2RHIA 3JCMW 4DOVA 3I56A 2GF7A 1W4SA 4QVDA 2PUOB 3CD6T 3RKWA 3JCMg 5I21A 5C1BA 4PJOA 3QZ9B 3GLXA 1QP2A 3ZBDA 5M9OA 2KMTA 2DXUA 2QTXA 3CBPA 1VQOA 4HKEA 3UWNA 2Q1CX 2WSFE 4XTUA 4BE1A 4XQ3A 3CCLT 5DY9A 4WF2A 3RKYA 3JB9I 1I5LA 3MP8A 2EQUA 2MM2A 4BE2A 1Y07A 4BDZA 2PVOB 3ZEHA 3V8JA 3OYDA 3QG1A 1YHQT 4JLIA 3QJYA 4LDUA 4F7UF 3FIFA 3MEVA 3A8HB 3M53A 5KE2A 5GAOp 2GQVA 4J6YA 3CCUA 4LDWA 4VUBA 3BY7A 3OS0A 2HQEA 2MAMA 2E6NA 3VV0A 1VQMT 1YIJA 2BUDA 2L3RA 3S6WA 1N8RC 2HAXA 3M5AA 3CEYA 4KDLA 4PL6A 4M7AG 3WXMB 3JCMd 4C8QD 1YJNA 3META 2JVVA 4M7AC 4XU1A 4MMLA 3MEWA 1VIFA 2EIFA 3HFOA 4F7UA 4OB0B 4AS1A 5HK0A 3LW5E 3QKJA 4EMKC 3JCMX 1WPYA 2QQBA 5KCHA 5GAN5 4JRPA 4JS5A 4J6WA 2RHUA 3M58A 4MDWA 3BDUA 2Y4XA 1R7RA 2LQ8A 3A8MB 1I81A 2LVMA 4R56A 3OYAA 3G71A 1VQ9A 1WJSA 2X4WA 3CC4T 1KC8C 3BDLA 3HU3A 1M9SA 2YLCA 1VQMA 4KUDK 4ZTFA 1VQ6A 1UEBA 3OA6A 4ZGJB 5GAOr 3BQBA 5LJ5f 2LT1A 1YITT 4E7LA 3M9QA 2FYKA 2I2LA 2JUFA 4HA8A 4KULA 3OYMA 1VQ4T 5FTJA 1UB4A 1NJIU 1NZ9A 5I2SA 5GAMd 3J80E 3C94A 2R5AA 2ZPBB 2CGHA 2QQSA 2DD4A 4M78A 1KQSS 2B8AA 5CQXA 3OYNA 4ZN1A 3DKMA 5LJ3j 3M4GA 5FRNA 3I56T 3E1SA 3M55A 4M75B 5GMKe 1WQ7A 5ERGB 1LJOA 2RB6A 2LNVA 3PT9A 3JCMQ 1IZ6A 1VQOT 3OW2A 3H6ZA 2R58A 2OAUA 4B9WA 5GMKm 4M7AE 3OMCA 4L59A 2DXCA 3HKSA 2MWOA 1CR5A 3NTIA 2RHYA 3TEEA 5GAMh 4M78G 1B34A 4QQ6A 2OTLA 5HK3A 4KDIA 4XAXB 2L5QA 3L2UA 1YCYA 5CAIA 1VQ5A 4C5GA 5CQYA 4XTWA 2RI3A 3SWNB 2E64A 4ZGDB 1QVGA 3CCUT 2D9TA 3LGLA 3SD4A 4C0DC 1OI1A 3FB9A 2E1HA 3OS5A 5FU6C 4A4KA 1KD1U 2EFIA 3LLRA 1VQLA 2DPPB 2KY9A 4M77B 2QEXA 1U1TA 2DAQA 1UGQB 1Y96A 2GCXA 4QW2A 5CKHA 5CR2A 4C92G 5GAN3 1ZQ1A 1YJNT 2JZ2A 3RERA 2YVLA 4C92C 2EKOA 4X9CA 2D6FA 3L2RA 3ZJVA 2YUJA 3OSVA 4ARIA 2ZPIB 2ZPGB 4A4FA 4EMKB 1XNIA 4M75D 2XU8A 1G3WA 1DJ7B 3G71T 1IREB 4NL2A 1VQ9T 2Q19X 1QVGS 3FPRA 4DA4A 2P4TA 3CMAA 4GLKA 3CCSA 1BI0A 2NLUA 1VQ6T 5CKBA 1YJ9A 3OB9A 5CCXA 5DLQE 2WSEE 1CZ4A 4M7DG 4M78E 1N9RA 3X28B 4KUIA 1G3YA 2KK4A 4C5IA 4M7DC 5GANj 4BUGA 2RK1A 4NL3A 2X4YA 5GANe 2Y90A 5GAN4 3HHTB 1AHJB 2EWNA 2VC8A 3M54A 4PJOB 4NOYA 1K8AU 2EQMA 3QHSA 4JJNK 2KSSA 3S3MA 1Y7XA 1KC8U 4M7AF 3QC8A 3WVDB 3ME9A 5LJ3g 1Q86C 2R5MA 4RV0A 4A4EA 3VKIA 3JCMf 1K73U 1OZ3A 2DXTA 4MZMA 5FROA 3OQ5A 4BE0A 1TH7A 2E5QA 2K57A 3L1AA 3RUXA 3V8LA 5LJ5e 2A3LA 4C92E 1W2BS 5J26A 4M77D 2O4XA 3MO8A 1RL2A 2F5TX 2YHTA 4N4IA 4QQDA 4B9XA 2X35A 3CPWA 3GNFB 2JNGA 5C0MA 2RJFA 1BI2A 2DVEA 1QVPA 5D6WA 3HL8A 5CKEA 5FU7C 1HXDA 5HKCA 5IT9E 1KD1C 2MM0A 4ZTJA 2OTLT 4JS4A 4A54A 4IUTA 3PIOA 4M7AA 4HCZA 2XG8D 4KBMB 1MGQA 2M9UA 3L2ZA 1PSEA 4ME7A 4UC4A 1VQ5T 4EMKA 4DOWA 3A8GB 1Q81C 1OZ2A 1BKBA 2PQWA 4XU0A 5IN1A 2EYQA 3V7CA 4MDXA 4JDSA 5I2MA 5KE3A 1I9GA 1Q82C 1U8RA 4M7DE 1V29B 4IUQA 4RG8A 2LCCA 5GAMf 3CF2A 3GIBA 2ZZDA 4F7UB 4E7JA 1VQLT 3QWZA 4OMFB 2QEXT 4N0AC 3GPLA 3CPWS 3JCMP 3JB9J 5LJ3d 2LW6A 4X34A 1NPPA 3OYGA 3GP8A 3OYYA 4EMGA 3L2QA 4JUVA 3X24B 4A4GA 2RHXA 3PTAA 4PJOD 4C8QG 1KQSA 1O75A 1WQWA 3MHXA 4C8QC 3CCVA 4LDYA 2E12A 1BI1A 1KHCA 1XTDA 2MMPA 2PVDB 3I55A 1ZHIA 2YRVA 4M78F 5CD1A 3HRUA 1K8AC 5GAOq 1UGSB 4AQ7A 3CMAT 3CCST 2Q1AX 3QQ7A 4MMKA 5D6YA 1ZBXA 3JB9D 1G3SA 4OGEA 3ZJUA 1YJ9T 4FSXA 2DZCA 3A8OB 5FTNA 3RMSA 3CCQA 3CC2A 1BI3A 1K73C 2WACA 4IUUA 4M78B 5D6XA 3G6EA 3JCMh 5CCBA 3CBMA 3EFRA 4JLGA 1PSFA 2GFUA 5GANg 3OYCA 3J7AF 2RK2A 2CZ1B 2XI9A 3HP9A 2FB7A 3RIRA 3NTKA 5J3BA 1QP3A 2B25A 1YJWA 2VGNA 4C92F 2VYTA 5GAN6 5GMKj 5B6CA 1VQ7A 5EG2A 4FL6A 2QI2A 2VXEA 4RCCA 2D0QB 2V8IA 2E6ZA 1KQ1A 4E7KA 2FL7A 4PNOA 2XDBA 5LJ5g 1B34B 2R57A 2DIGA 2V8KA 3EAEA 3CMEA 3MB5A 5CK9A 1LNXA 4Q5WA 2H3JA 4QVCA 2VGMA 2ZPFB 2HQXA 3A5ZB 1P92A 4J7FA 4N4HA 3HU1A 1U1SA 2LT4A 5FTLA 1SSFA 1JJ2A 1Q86U 2DD5A 2EQKA 4FU6A 4C92A 4M7DF 4ELYC 3CCRA 3LYIA 3M59A 1VUBA 4C0GA 4XTVA 2DTHA 3NTHA 2XHCA 1HK9A 4BY6B 5DYGA 2EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L42 A;  2NLU A;  3MP8 A;  3OB9 A;  2EQU A;  3L2W A;  4BE2 A;  3S3O A;  4BDZ A;  2BIV A;  4IUV A;  4C5I A;  3ZEH A;  3ASK A;  3OYD A;  2GFA A;  2X4Y A;  5FRM A;  3OYI A;  3MEV A;  4IKF A;  3PFS A;  4E7I A;  5KE2 A;  2EQM A;  3F70 A;  3Q1J A;  3DB4 A;  3S3M A;  1RI0 A;  2BKD N;  3ME9 A;  3OS0 A;  2HQE A;  2E6N A;  4BDY A;  2R5M A;  4OVA A;  2BUD A;  2L3R A;  3S6W A;  2M0O A;  4A4E A;  4BAC A;  4N4G A;  3OYE A;  1OZ3 A;  3UT1 A;  5FRO A;  3OQ5 A;  3CEY A;  4BE0 A;  2E5Q A;  3MP6 A;  4PL6 A;  4Z02 A;  3DB3 A;  3MET A;  5J26 A;  4N4I A;  2O4X A;  3MO8 A;  3LGF A;  3MEW A;  4QQD A;  4B9X A;  3S3N A;  2X35 A;  4NS5 A;  5C0M A;  2RJF A;  3QKJ A;  5D6W A;  4EDU A;  2RJD A;  5KCH A;  2LDM A;  4BD3 A;  4ZTJ A;  2RHU A;  3FDR A;  4IUP A;  4IUT A;  4HCZ A;  3OYK A;  2LVM A;  4UC4 A;  3OYA A;  3O8V A;  1WJS A;  2X4W A;  3BDL A;  1H3Z A;  1OZ2 A;  2PQW A;  2QQR A;  5IN1 A;  3E9F A;  4ZTF A;  4A4H A;  3OA6 A;  3FC3 A;  1WGS A;  5KE3 A;  5KH6 A;  4E7L A;  3PMI A;  3M9Q A;  3E9G A;  4IUQ A;  2LCC A;  3KUF A;  3OY9 A;  2O4X B;  3OYM A;  3GOX A;  4E7J A;  2G3R A;  2RJC A;  3OMG A;  3OS2 A;  3OYH A;  2R5A A;  2QQS A;  2P0K A;  3P8D A;  5J39 A;  4X34 A;  3OYG A;  2CKK A;  2B8A A;  2RHZ A;  2X4X A;  3FEO A;  3P8H A;  3OYN A;  3L2Q A;  4A4G A;  2RI2 A;  5FRN A;  1WJQ A;  2FHD A;  2RHX A;  3MEA A;  4PLL A;  3C4S A;  4A4F A;  3QII A;  3OYL A;  3OS1 A;  2JTF A;  2MWP A;  2IG0 A;  1KHC A;  4GY5 A;  2YRV A;  2LTO A;  4QQG A;  3OYB A;  4PLI A;  4C5H A;  3H6Z A;  2R58 A;  4B9W A;  3QJ6 A;  3MEU A;  3OMC A;  5IAY A;  4L59 A;  2F5K A;  3LX7 A;  2L8D A;  2MWO A;  5D6Y A;  4C5E A;  3NTI A;  2RHY A;  2L89 A;  2RJE A;  2XK0 A;  2EQJ A;  4QQ6 A;  2WAC A;  4IUU A;  4RG2 A;  5D6X A;  2XDP A;  4CRI A;  2GFU A;  3L2U A;  1G5V A;  3PNW C;  2K3X A;  3OYC A;  4C5G A;  2M1H A;  3L2V A;  2RI3 A;  1N27 A;  3NTK A;  4IUR A;  4QVZ A;  4LD6 A;  4II1 A;  2D9T A;  1MHN A;  3LGL A;  3PMT A;  3SD4 A;  1OI1 A;  2VYT A;  3OYJ A;  4E7H A;  3NTH A;  4FL6 A;  2EFI A;  2LRQ A;  3LLR A;  3FLG A;  2DAQ A;  3OYF A;  4E7K A;  4QW2 A;  2R57 A;  3EAE A;  2DIG A;  3QBY A;  2JZ2 A;  2RO0 A;  2EKO A;  2RHI A;  3DLM A;  1OYX A;  5CIU A;  4Q5W A;  3L2R A;  2GF7 A;  4N4H A;  2HQX A;  3MP1 A;  5C6S A;  1SSF A;  5M9O A;  2EQK A;  1XNI A;  2M16 A;  4FU6 A;  3LYI A;  3UWN A;  2K3Y A;  1WJR A;  4BE1 A;  3H8Z A;  2RI5 A;  2DIQ A;  5KCO A;  3LH0 A; 
#chains in the Genus database with same CATH topology
 1HYO A;  2MCN A;  1WFW A;  2RQV A;  3L2W A;  2CP6 A;  2K79 A;  3A8L B;  1GRI A;  1QLY A;  1M5Q 1;  1C0M A;  2BKD N;  4BDY A;  3CCV T;  2DZ9 A;  4ZN3 A;  4FYX B;  2L3S A;  1YI2 Q;  1VQN A;  2LCS A;  4Y28 E;  5GAM e;  5IHN A;  3S3N A;  3VS0 A;  1W2B A;  4AFU C;  3CCQ T;  2VUB A;  4XTX A;  1MMD A;  3G6E T;  3CC7 Q;  3VS5 A;  3VYH B;  1TSF A;  3O8V A;  2D8H A;  1WHG A;  5A0D A;  1E6G A;  3EGD B;  4JRK A;  3E9G A;  3KUF A;  4YTL A;  3G4S A;  4P5N A;  3O5Z A;  3QDR B;  3JRZ A;  4EIK A;  1PD0 A;  1KG1 A;  2QDY B;  1IO6 A;  2VV5 A;  8ATC B;  3P8D A;  3SWN C;  4J9E A;  4OB2 B;  4M7A B;  1JRI A;  1VQ4 A;  4N0A A;  3QII A;  3JCM J;  2IG0 A;  4OMM A;  3CQT A;  4Z8A A;  3OYB A;  3CCR T;  3GF5 A;  1YN8 A;  4KH0 B;  1M4Z A;  4KH1 B;  1Q7Y C;  3LX7 A;  4KRT A;  1M1K C;  1ZSG A;  2K6D A;  1YNZ A;  4LN2 A;  2EQJ A;  4RG2 A;  2CYZ B;  2XDP A;  1QDN A;  4OB3 B;  5KYU B;  3PNW C;  2PUK B;  2L2P A;  3QYG B;  2QA4 T;  4OF1 A;  4CC3 A;  2C0O A;  2AZV A;  3LHD A;  1S72 T;  2IVW A;  1VQP T;  1Y71 A;  3FRN A;  4MZP A;  2D8J A;  3D7S B;  4PJO C;  1UE9 A;  2RA2 A;  3QBY A;  5I11 A;  3GNG A;  1WXU A;  2RO0 A;  3DLM A;  5GAM g;  2AZS A;  2ED1 A;  1X75 C;  3QDF A;  3CCM A;  3LWI A;  2HQH A;  3CCJ A;  2YUN A;  3EH2 A;  1VQM Q;  3U23 A;  3S3O A;  1WDX A;  2JMC A;  3ER0 A;  3PFS A;  4E7I A;  1AWW A;  4FYY B;  4C92 B;  2PU9 B;  1RI0 A;  2VXF A;  2QTV A;  3R6O A;  4J9F A;  3CC4 Q;  3M57 A;  2CT4 A;  1H3H A;  2LP5 A;  2ZAE A;  4J9D A;  4Z02 A;  2YUP A;  1YIT Q;  1OPL A;  2A0F B;  2LX7 A;  1RAA B;  2DTO A;  1VQ4 Q;  5EPP A;  3QXE B;  4BD3 A;  1T3L A;  2ABL A;  4M7D B;  2LCL A;  2F1L A;  4M75 A;  2QYZ A;  4EMH A;  3E9F A;  1YI2 T;  1JB0 E;  3A98 A;  1G3T A;  1VQO Q;  3JSC A;  1UEC A;  3CXC A;  3OMG A;  3CC7 T;  4E2F B;  1S1N A;  1WJQ A;  2CUD A;  1T0J A;  3HRS A;  3OW2 S;  3PVQ A;  2VB6 A;  4GY5 A;  1OX9 A;  4QQG A;  2CZ7 B;  4PLI A;  3CCU Q;  1U06 A;  1BU1 A;  1X27 A;  1K9M U;  4J6X A;  2B86 A;  2QK0 A;  3MCA B;  2QAS A;  4CRI A;  1R8O B;  1VIE A;  4GBQ A;  2PVG B;  2K5L A;  1N27 A;  4J83 A;  4QVZ A;  2RNA A;  1E6H A;  3OYJ A;  1OUL A;  1M90 U;  3QWX X;  1M8M A;  2HD0 A;  1CZ5 A;  4XU3 A;  2DJQ A;  3I56 A;  4OMP A;  2LJ1 A;  3QZ9 B;  3ZBD A;  2EYX A;  3RKY A;  3JB9 I;  2EQU A;  4BE2 A;  2CH4 A;  3ZEH A;  3QJY A;  2CH4 W;  4LDU A;  2L0A A;  3MEV A;  1AT1 B;  3M53 A;  5KE2 A;  1YCS B;  4CC7 A;  3IQL A;  2A08 A;  1VQM T;  2BUD A;  2C0I A;  3CEY A;  3WXM B;  3JCM d;  1YJN A;  2JVV A;  1PC0 A;  1VIF A;  2EYZ A;  4AS1 A;  3LW5 E;  4EMK C;  2L3Q A;  2O88 A;  3BDU A;  2OX7 A;  2QG9 B;  1I81 A;  1X69 A;  4R56 A;  3TVT A;  3CC4 T;  3HU3 A;  3BDL A;  1M9S A;  4LUD A;  2MOX A;  3OA6 A;  5KYW B;  2EGC A;  1YIT T;  2I2L A;  1VQ4 T;  1SF9 A;  5KYY A;  3M0Q A;  2KRO A;  1KQS S;  3OYN A;  3DKM A;  1M2O A;  5FRN A;  3M55 A;  1WQ7 A;  2LQW A;  1WIE A;  2RB6 A;  2EGA A;  3PT9 A;  4Y92 A;  1VQO T;  1TG0 A;  2R58 A;  4B9W A;  2J06 A;  5IH2 A;  2DXC A;  2RHY A;  1PRM C;  4XAX B;  2ATC B;  4C5G A;  3CCU T;  1VQL A;  5FW9 A;  4QW2 A;  5CKH A;  1ZQ1 A;  2JZ2 A;  4X9C A;  3A1P A;  3VS2 A;  2YUJ A;  4ARI A;  3OW2 P;  4M75 D;  1G3W A;  1RAD B;  1IRE B;  4Z89 A;  1QVG S;  1I07 A;  3CCS A;  3NPF A;  1BI0 A;  1B7T A;  4FYW B;  5CKB A;  1J3T A;  3X28 B;  4KUI A;  1VA7 A;  4KGV B;  2X4Y A;  1IGQ A;  2Y90 A;  5GAN 4;  4NOY A;  2DL3 A;  3CC2 Q;  3QC8 A;  2LNH B;  3ME9 A;  1PRL C;  3MKD A;  4RV0 A;  1SRL A;  2QGF B;  1OZ3 A;  3EGD A;  4BE0 A;  1TH7 A;  3L1A A;  2K57 A;  1W2B S;  5IT9 E;  3RR6 A;  2F5T X;  2O2O A;  2HKQ B;  4B9X A;  2X35 A;  1MND A;  2RJF A;  5CKE A;  1I5O B;  4PFO A;  4M7A A;  4HCZ A;  4ME7 A;  3L2Z A;  4D8K A;  1VOM A;  1BKB A;  2HSP A;  9ATC B;  1KFZ A;  3QWZ A;  4OMF B;  3JB9 J;  2KT8 A;  3OYG A;  4JUV A;  4DBF A;  5KYU A;  2RHX A;  3EFO B;  4C8Q G;  2EYY A;  3CCV A;  4LDY A;  1BI1 A;  1WA7 A;  3CPW P;  3HRU A;  4HVU A;  5GAO q;  4MMK A;  3C0C A;  2OTJ Q;  3CCQ A;  2WAC A;  3G6E A;  2EW3 A;  3EFR A;  4JLG A;  1TOV A;  2CZ1 B;  3M0S A;  2BZX A;  2H3E B;  2VGN A;  4PFZ A;  2SRC A;  2VYT A;  4CC4 B;  5GMK j;  2X3X D;  4FL6 A;  2QDL A;  2E6Z A;  1B34 B;  2R57 A;  5CK9 A;  1KQS P;  1BBZ A;  2H3J A;  2VGM A;  3HU1 A;  1P92 A;  4J7F A;  1U1S A;  4FCY A;  1N5Z A;  4FU6 A;  4C92 A;  3CCR A;  2F2W A;  3LYI A;  4XTV A;  1G8X A;  5KYX B;  4ORZ A;  1Y57 A;  1SEM A;  2EAY A;  4D8D A;  1FMK A;  4LDX A;  4C0Z A;  2CS7 A;  1GFC A;  2LC4 A;  4ESR A;  3X20 B;  1JBM A;  3VJP A;  3OYI A;  2QA4 A;  4M7D A;  2J7I A;  1Q81 U;  2EJF A;  4TVR A;  1S72 A;  1M1K U;  1OPK A;  2CP5 A;  1VQP A;  2M0O A;  4OP0 A;  4N4G A;  3QWY A;  1BIA A;  3H0H A;  3BFM A;  4O5V A;  2EYW A;  1JJ2 P;  3CC2 T;  3FDR A;  3TU4 K;  2K3B A;  4AG1 C;  1D1B A;  2MK5 A;  1NBE B;  3LH5 A;  1FXX A;  1WYX A;  1UGR B;  4C8Q F;  5LJ5 j;  4RTZ A;  3FEO A;  3P8H A;  2RI2 A;  2FHD A;  3PIP A;  1ZX6 A;  4L6V 5;  1WXB A;  1I4K 1;  3OS1 A;  2JTF A;  3BW1 A;  4M77 C;  2LX9 A;  4C5H A;  2ZGW A;  3QJ6 A;  3SEM A;  1W2B P;  2LQK A;  4FIB A;  1EZZ B;  2L8D A;  2MF2 A;  2RF0 A;  1GL5 A;  2RJE A;  3ULR B;  2XK0 A;  4PKC C;  1QMC A;  4LD9 K;  3ZJT A;  4WCI A;  3CD6 Q;  1BYM A;  1YI2 A;  4II1 A;  4A53 A;  1D0Y A;  2PNI A;  2FZK B;  2OTJ T;  2BE7 D;  2GNC A;  4PJO G;  2E41 A;  3CC7 A;  1QCS A;  2BTT A;  3JCM V;  1GXI E;  1SPK A;  2ZPE B;  4B6M A;  4KO8 A;  1NEB A;  3G7Z A;  3MP1 A;  1GCQ C;  4PJJ A;  4LXC A;  5C6S A;  4M7A D;  1C1A A;  2M0Y A;  4KOD A;  3H8Z A;  4V2S A;  5C18 A;  4OB1 B;  2A7Y A;  3TIW A;  4C0D B;  1CSK A;  3EG1 A;  3M0U A;  4J9I A;  2GFA A;  1MMG A;  1OX8 A;  5FRM A;  4IKF A;  3F70 A;  2DTI A;  4F7U G;  2DKG A;  4RCB A;  4PJO E;  2NWM A;  5KYW A;  1S3S A;  3DB3 A;  2QGG A;  1T0H A;  4E7S A;  5LJ3 e;  1QVF A;  2FEI A;  5GAN d;  1LOJ A;  1TUC A;  2JV2 A;  1YBY A;  1XOV A;  1AZG B;  4M78 D;  3CBO A;  5CKD A;  5EQJ B;  1ZSZ B;  1SSH A;  4CI0 C;  1ZA2 B;  2RH2 A;  4M78 C;  3EHR A;  3M0R A;  1AEY A;  2FG0 A;  3RES A;  2KYB A;  1RAC B;  3OYH A;  5J39 A;  2OAW A;  5GAM j;  1K8A R;  2RHZ A;  2X4X A;  1NLP C;  3INZ A;  2K5F A;  1QW1 A;  4PLL A;  2QXF A;  3OYL A;  4FT2 A;  4F7U E;  3CPF A;  5FU7 B;  1VQM A;  4C92 D;  2DL4 A;  5CVI A;  5DM7 R;  1K73 R;  1KSW A;  4HCC A;  1SG5 A;  2HBW A;  5A0L A;  4HT8 A;  2P0Q A;  4XTZ A;  2DEU A;  1NJI C;  2MYS A;  2EGE A;  1KJW A;  4J5Y A;  1QCF A;  2BE9 B;  1G5V A;  2MI6 A;  3CC4 A;  5HCK A;  4M7D D;  4BY6 C;  2K4Y A;  4PJO F;  4LD6 A;  1AWO A;  1YIT A;  3I5S A;  1GCP A;  2NYS A;  2PZ1 A;  5GJV B;  3UF4 A;  1PHT A;  3G71 Q;  3CXC P;  5GAN 8;  1VQ9 Q;  3QZ5 B;  4C8Q B;  2XDD A;  3VUZ A;  3V8K A;  1N9S A;  4IIM A;  4JRI A;  2E3I A;  1AVZ C;  4F16 A;  2RHI A;  2ESW A;  4J9B A;  4DOV A;  3JCM W;  1I1J A;  3RBB B;  1W4S A;  4QVD A;  3CD6 T;  4OMN A;  5I21 A;  4RTT A;  2DVJ A;  3GLX A;  1QP2 A;  5M9O A;  1MUZ A;  2KMT A;  1VQO A;  2I0N A;  3UWN A;  6AT1 B;  2YWW A;  2RQT A;  3H0F A;  1I5L A;  1ACM B;  3V8J A;  3QG1 A;  2RN8 A;  4JLI A;  4F7U F;  4LE9 A;  1D1A A;  3CCU A;  2YUO A;  4LDW A;  2A28 A;  2HQE A;  2Z0W A;  3G1J A;  1YIJ A;  4AG2 C;  2HAX A;  2F2V A;  1W1F A;  4XU1 A;  2J6K A;  2EIF A;  1B3Q A;  3I5R A;  3RDV A;  2YSQ A;  5HK0 A;  2C0T A;  3QKJ A;  5GAN 5;  2QQB A;  5KCH A;  2Y4X A;  1R7R A;  3EFO A;  2X4W A;  2YLC A;  4ZTF A;  1UFF A;  3BQB A;  5LJ5 f;  3M9Q A;  3MPU B;  3OYM A;  4HA8 A;  1UB4 A;  1AWX A;  5I2S A;  2R5A A;  4PJM A;  2CGH A;  2KRM A;  2QQS A;  2LJ3 A;  1YJ9 Q;  1GFD A;  4ZN1 A;  1NG2 A;  1TS9 A;  1YFN A;  4FW1 A;  5ERG B;  4JPB W;  1LJO A;  3JCM Q;  1IZ6 A;  3KFV A;  2X9H A;  2RMO A;  4F14 A;  1CR5 A;  3TEE A;  1B34 A;  4QQ6 A;  2RQU A;  4AT1 B;  5CAI A;  3EG0 A;  2X3W D;  4ZGD B;  3SWN B;  3LGL A;  1K9M R;  3FB9 A;  4QKU A;  5FU6 C;  5KYX A;  2EFI A;  2M51 A;  3LLR A;  4JJB A;  1TWB A;  3VS6 A;  1U1T A;  1UGQ B;  5CR2 A;  5GAN 3;  3RER A;  4OMO A;  1JEG A;  2EKO A;  2D6F A;  3L2R A;  1YIJ Q;  2ZPI B;  1RI9 A;  1M90 R;  1XNI A;  2EPD A;  2H8H A;  2DIL A;  4PJL A;  3G71 T;  1VQ9 T;  4NL2 A;  2Q19 X;  4DA4 A;  2KBT A;  1VYU A;  4PK4 A;  1N9R A;  2COW A;  4C5I A;  2KK4 A;  4BUG A;  2DFU A;  2FRW A;  2JM9 A;  4PJO B;  4JJN K;  3S3M A;  1KC8 U;  2ENM A;  3WVD B;  2JJ9 A;  2K2M A;  2R5M A;  4A4E A;  3VKI A;  3REB B;  3AT1 B;  2VKN A;  2E5Q A;  4N4I A;  1YJW Q;  2JNG A;  1VQ7 Q;  1BI2 A;  2DVE A;  5D6W A;  4ZTJ A;  4IUT A;  3CME Q;  1MGQ A;  1K0X A;  2J6O A;  4DOW A;  1ZUU A;  4XU0 A;  4MDX A;  1JQQ A;  5I2M A;  1I9G A;  1U8R A;  1V29 B;  4ANJ A;  4RG8 A;  2LCC A;  5GAM f;  1W70 A;  3EGU A;  4F7U B;  4N0A C;  3CPW S;  2LW6 A;  4M4Z A;  4X34 A;  1SHF A;  3GP8 A;  1VQK Q;  2AK5 A;  1HJD A;  4DEY A;  3TSW A;  1KK7 A;  2PVD B;  2HMA A;  1K8A C;  2OJ2 A;  4AQ7 A;  1OV3 A;  2G6F X;  3QQ7 A;  1ZBX A;  1G3S A;  4OGE A;  1WZO A;  1YJ9 T;  4FSX A;  3A8O B;  5FTN A;  3RMS A;  3CC2 A;  1K73 C;  5D6X A;  4IUU A;  1UGV A;  2GFU A;  4KGZ B;  5IXB A;  3OYC A;  3J7A F;  1FMW A;  1YWO A;  2FB7 A;  1RAE B;  1QP3 A;  1VQ8 Q;  2B25 A;  2VVK A;  1NM7 A;  5B6C A;  1M3C A;  2QI2 A;  3VS4 A;  2GTJ A;  4CC2 A;  2FL7 A;  1QCN A;  3VRZ A;  1T3S A;  2HQX A;  2LT4 A;  1M30 A;  5FTL A;  1SSF A;  2NUP B;  1Q86 U;  2DD5 A;  2P84 A;  3HTR A;  3M59 A;  3EGX B;  1HK9 A;  1KIK A;  3SFM A;  4X9D A;  3JCM e;  4IIO A;  2BIV A;  2F2X A;  1YIJ T;  1N8R R;  4J9C A;  3T9N A;  2KQW A;  5HY6 A;  3ZFJ A;  2IIM A;  3EFS A;  3QUI A;  1JJ2 S;  3PVL A;  2OTJ A;  3QQ8 A;  4KGX B;  4A63 B;  1Q82 U;  1ZSZ A;  2DM1 A;  4MZT A;  5FLX E;  2CSQ A;  3FJP A;  3MP6 A;  2DMO A;  3JB9 H;  1I8F A;  3LGA A;  4M75 C;  1N6A A;  4EDU A;  2LDM A;  5CCA A;  3J81 E;  4RMO A;  1M8V A;  5IXF A;  1SKU B;  1BIB A;  4OGC A;  2AT1 B;  1NYG A;  2CP7 A;  1YJW T;  2AKK A;  3DLL A;  1ZUK A;  1CKA A;  1VQ7 T;  5I22 A;  2CZ0 B;  3OS2 A;  5GMK i;  3CME T;  1WXT A;  4KT0 E;  1BCM A;  1MMN A;  3C4S A;  4A4F A;  4EMK B;  4M77 G;  1E32 A;  5EC7 A;  4RTY A;  5FWC A;  2KRN A;  2LTO A;  1OU8 A;  4XK8 E;  2C06 A;  1LPL A;  3CCE Q;  2QQ9 A;  2Q1D X;  4C8Q A;  1VQK T;  2L89 A;  2K3X A;  4ATO A;  5FTM A;  4IUR A;  5GAO n;  1UDL A;  2E65 A;  3QYH B;  2DK3 A;  4E7H A;  2O01 E;  1X2K A;  2KRS A;  3JCM c;  1U3O A;  2DO3 A;  3CCL Q;  1NJI R;  3X26 B;  1ZA1 B;  5L23 A;  1QCO A;  1K9M C;  2RM4 A;  1OYX A;  2IPO B;  5CIU A;  1YHQ Q;  2JMA A;  3V7S A;  4M77 E;  1VQ8 T;  2KYM A;  5LJ3 h;  3JB9 G;  2M16 A;  3VU3 C;  1RAF B;  4QT7 A;  5IHI A;  2RI5 A;  2DIQ A;  5KCO A;  3LH0 A;  2O9S A;  1RAH B;  1NYF A;  4Y91 A;  2PJH B;  1M90 C;  2CZ6 B;  3RKX A;  1H92 A;  2ECZ A;  3ASK A;  3KXT A;  4FYV B;  2XMF A;  1ABO A;  2Q18 X;  1PG5 B;  1UG1 A;  2CP0 A;  3QO3 A;  3SDZ A;  5GAN 2;  2COZ A;  2K2V A;  2SEM A;  4C8Q E;  2FPF A;  4J9H A;  1M2V B;  4OVA A;  4BAC A;  1KD1 R;  2CT3 A;  3OYE A;  3HU2 A;  2JN0 A;  1O9S A;  1PD1 A;  2DA9 A;  3PGG A;  3CD6 A;  1A0N B;  2FVU A;  4IUP A;  1WHM A;  2KVQ G;  5GLF A;  1H3Z A;  3REA B;  4DQ2 A;  3FC3 A;  1Q7Y U;  1QWF A;  1V76 A;  3OY9 A;  3KBG A;  2XIC A;  3MJX A;  5LJ5 d;  1MMA A;  3GOX A;  2DE0 X;  2RJC A;  4M77 F;  2P0P A;  1BB9 A;  5GAN h;  3QPH A;  3UPU A;  1OEB A;  3EH1 A;  3H9N A;  4BB7 A;  2E10 A;  3UA6 A;  4D6W A;  2KAF A;  3SWN A;  5CO7 A;  2HCK A;  2DRK A;  1WNL A;  3VS1 A;  1QVF P;  2F5K A;  2XKO C;  3PE0 A;  1D3B B;  3CXC S;  1WHJ A;  2KEA A;  3HFN A;  2KNB B;  4E47 A;  4HT9 A;  2M1H A;  3C95 A;  3HRT A;  3C12 A;  3PMT A;  3CCE T;  2KXD A;  3RMQ A;  1FX7 A;  2YUQ A;  3TRE A;  1NLO C;  3FJ5 A;  3FLG A;  5FTK A;  1M1G A;  1VQ6 Q;  1JXO A;  1QKX A;  3JB9 F;  4PFP A;  2EKH A;  4JJC A;  5C1B A;  2PUO B;  3RKW A;  4PJO A;  4DBQ A;  4XTU A;  4BE1 A;  4XQ3 A;  3CCL T;  1TUD A;  2RPN A;  1G2B A;  1TUG B;  1JXM A;  3MP8 A;  1YHQ T;  3OYD A;  1E7O A;  4AFZ C;  2GGR A;  8AT1 B;  3A8H B;  2GQV A;  4J6Y A;  2OTL Q;  3BY7 A;  2HSE B;  2J05 A;  4OMQ A;  2E6N A;  1N8R C;  2L3R A;  3S6W A;  1VQ5 Q;  2KXC A;  1BK2 A;  4KDL A;  4PL6 A;  2V1Q A;  4C8Q D;  1M3B A;  3MET A;  4M7A C;  4MML A;  3MEW A;  2A36 A;  4F7U A;  4OB0 B;  4JS5 A;  4JRP A;  1WPY A;  4OML A;  2QEX Q;  2QAZ A;  3G71 A;  1VQ9 A;  1IXD A;  1WJS A;  1R0C B;  4KUD K;  4JJD A;  4E7L A;  4KUL A;  2FYK A;  1GBQ A;  5FTJ A;  2ED0 A;  5GAM d;  1SHG A;  3C94 A;  2D1X A;  3CMA Q;  2ZPB B;  1UJ0 A;  2JS2 A;  1YP5 A;  2B8A A;  5LJ3 j;  3H41 A;  3VRY A;  2DL7 A;  4HVW A;  2NUZ A;  3EG2 A;  3H6Z A;  3OMC A;  3HKS A;  3NTI A;  1ARK A;  1GBR A;  5D7U A;  4KDI A;  1ZUY A;  2L5Q A;  3L2U A;  1BCO A;  1ZLM A;  4XTW A;  2RI3 A;  2E64 A;  2NUP A;  1QVG A;  1OQK A;  3NMZ C;  1JO8 A;  3SD4 A;  2CDT A;  1OI1 A;  3EGX A;  4A4K A;  1MV0 B;  2DPP B;  2L3P A;  4M77 B;  3R6N A;  2DAQ A;  2GCX A;  4C92 C;  3THK A;  3ZJV A;  1NEG A;  2YRC A;  1DJ7 B;  2LJ0 A;  2NLU A;  1VQ6 T;  1YJ9 A;  3OB9 A;  4HXJ A;  1CZ4 A;  2K7A A;  3I55 Q;  4M7D C;  1G3Y A;  2YXY A;  5GAN j;  1UHF A;  1K76 A;  4NL3 A;  5GAN e;  3HHT B;  1AHJ B;  2VC8 A;  2JTE A;  2D0N A;  1K8A U;  3QHS A;  1JU5 C;  2W0Z A;  2KSS A;  2P4R A;  1G83 A;  5LJ3 g;  3RNJ A;  1K73 U;  2DXT A;  5FRO A;  3OQ5 A;  1PKT A;  3MO8 A;  2YHT A;  4QQD A;  5AT1 B;  5C0M A;  5HKC A;  1Y0M A;  1KD1 C;  1HXD A;  2MM0 A;  2PTK A;  2OTL T;  3PIO A;  2XG8 D;  4KBM B;  2DF6 A;  2M9U A;  4UC4 A;  1VQ5 T;  4EMK A;  1QWE A;  3A8G B;  1Q81 C;  3V7C A;  4JDS A;  5KE3 A;  3CF2 A;  2E5K A;  3GIB A;  4E7J A;  1VYV A;  2CP3 A;  1WHK A;  2QEX T;  4WTO B;  2LMJ A;  1NPP A;  4EMG A;  3L2Q A;  3I9Q A;  1RAG B;  2FZG B;  3X24 B;  1AWJ A;  3PTA A;  4PJO D;  1O75 A;  1WQW A;  2FPE A;  3MHX A;  3TSZ A;  4LNP A;  2E12 A;  1KHC A;  1XTD A;  4F04 B;  1IB8 A;  1K9A A;  1ZHI A;  2YT6 A;  1Z9Z A;  5CD1 A;  4AFS C;  1UGS B;  3CMA T;  2Q1A X;  1ABQ A;  5D6Y A;  2NUT B;  2DZC A;  2J6F A;  1BI3 A;  4M78 B;  5CCB A;  3JCM h;  1M3A A;  3CBM A;  3E2U A;  1PSF A;  5GAN g;  1VQN Q;  2V26 A;  2XI9 A;  3HP9 A;  3RIR A;  3NTK A;  1PWT A;  5J3B A;  4JZ3 A;  1YJW A;  5GAN 6;  1VQ7 A;  5EG2 A;  2VXE A;  1U5S A;  2V8I A;  4E7K A;  1RUW A;  2O31 A;  4PNO A;  3VS3 A;  3CME A;  2EVR A;  2DIG A;  2V8K A;  1LNX A;  2DLP A;  4Q5W A;  2HDA A;  2FO0 A;  4QVC A;  2ZPF B;  3A5Z B;  4N4H A;  3G4S Q;  2EQK A;  4ELY C;  1VUB A;  3M0T A;  4C0G A;  2CRE A;  2DTH A;  3NTH A;  1M2V A;  4BY6 B;  2JTM A;  5KYN A;  1VQK A;  4K11 A;  1Y96 B;  1D1C A;  1NPR A;  2X4J A;  4FSS A;  4KLN A;  3Q1J A;  3QSU A;  3DB4 A;  1WHH A;  2COY A;  3JAM E;  1D0X A;  1M1F A;  1UHC A;  2E70 A;  4BI8 B;  5GJW B;  2YLB A;  2PWY A;  1PKS A;  1K0S A;  5LL6 S;  3UT1 A;  3I55 T;  3EG9 B;  3OBW A;  2AHJ B;  4RTX A;  1LCK A;  5GAO l;  3LGF A;  1KC8 R;  4M75 G;  3AHU A;  2DJZ A;  2RJD A;  1VQ8 A;  2EQI A;  3OYK A;  3E19 A;  3HPW A;  4EPC A;  4JRQ A;  2QQR A;  1Z9Q A;  4A4H A;  2AKL A;  1RLQ C;  1WGS A;  5CKF A;  5KH6 A;  1VYT A;  3CCM Q;  2O4X B;  2DL5 A;  5LJ3 f;  1D0Z A;  3CCJ Q;  1H64 1;  2K9G A;  1F1B B;  2P0K A;  1D3B A;  1EX4 A;  2M02 A;  2DBM A;  3MEA A;  4ZGE B;  2K5I A;  2MWP A;  5IAY A;  3I35 A;  3M4Y A;  4M75 E;  4C5E A;  4PJN A;  3VYG A;  4R0K A;  1O54 A;  1FWZ A;  2DYI A;  1NE8 A;  1X01 A;  1LVK A;  4L5G A;  3L2V A;  5GAN 7;  5DYI A;  1MHN A;  2FPD A;  2Y4Y A;  1UGP B;  2LRQ A;  2X51 A;  2KDS A;  3SB2 A;  3OYF A;  1VQN T;  3SHW A;  7AT1 B;  3VUB A;  4CQN A;  3NFC A;  2DBK A;  2HNI A;  5GMK h;  3EHQ A;  4FM4 B;  2K3Y A;  1WJR A;  1K1Z A;  5GAN f;  1WLP B;  5ECA A;  2CP2 A;  3L42 A;  3V7R A;  3WVE B;  2XID A;  3UDC A;  4FT4 A;  2HBP A;  2JT4 A;  3FPT A;  4IUV A;  5FU6 B;  1X6O A;  1XQH A;  1Q86 R;  3G4S T;  1TU0 B;  4J8O A;  1OOT A;  1TXQ A;  5A2Q E;  5A0G A;  3CCE A;  1D09 B;  2XD0 A;  4Z88 A;  4M75 F;  1EFN A;  4RTW A;  3ZGZ A;  3P8B B;  1QKW A;  2F69 A;  1X43 A;  4NS5 A;  2ZCF B;  4BI3 A;  3LWH A;  2QQA A;  3HSB A;  2OI3 A;  3TCJ A;  4HCB A;  3FPU A;  1Q82 R;  3JCM b;  3URG A;  4RKU E;  2DEQ A;  3CCL A;  1B07 A;  4J7I A;  3I56 Q;  4XU2 A;  1WLF A;  3M56 A;  5GAO m;  3N5B B;  3PMI A;  2EJ9 A;  1YHQ A;  1FYN A;  4C0F A;  5GMK l;  3OBY A;  2G3R A;  2VAS A;  2E3H A;  4XTY A;  1RLP C;  4LDV A;  1KQ2 A;  2MPX C;  1QVF S;  2CKK A;  3OSS C;  2CSI A;  2JW4 A;  1XJW B;  2EJG A;  1ZC1 A;  1CKB A;  4E6R A;  3CCM T;  1MV3 A;  2E4H A;  1HD3 A;  3MEU A;  1IGU A;  2ZPH B;  3CCJ T;  2V1R A;  3X25 B;  2DET A;  5LJ5 h;  4M77 A;  2DL8 A;  4ELZ C;  4O6J A;  2JM8 A;  2V8J A;  4R55 A;  4BI4 A;  1YJN Q;  1N8R U;  4DBR A;  3H0I A;  5L8R E;  2RD1 A;  2CUB A;  4ARC A;  2YDL A;  1EIF A;  1KHI A;  2JOY A;  5AYF A;  4E7Z A;  1X2Q A;  2DXB A;  2WSC E;  2GF7 A;  3JCM g;  3NGP A;  4AFQ C;  2JXB A;  2DXU A;  2LQN A;  2QTX A;  3CBP A;  4HKE A;  2KI7 A;  2WSF E;  2Q1C X;  2KT1 A;  1GCQ A;  5DY9 A;  4WF2 A;  3GBQ A;  2MM2 A;  1Y07 A;  1AZE A;  4BDZ A;  2PVO B;  1IHV A;  2AIR B;  3FIF A;  4AMC A;  4GLM A;  5GAO p;  3NHN A;  2YRD A;  4VUB A;  3OS0 A;  2MAM A;  3VV0 A;  3M5A A;  4FW2 A;  2EBP A;  1UJY A;  4M7A G;  1UUE A;  1AD5 A;  3HFO A;  2BZY A;  4DEX A;  3JCM X;  1VQL Q;  4J6W A;  2RHU A;  3M58 A;  4MDW A;  2LQ8 A;  1WI7 A;  3A8M B;  2LVM A;  3OYA A;  5IHK A;  1RAB B;  1KC8 C;  1VQ6 A;  1PM3 A;  1FMV A;  1UEB A;  4ZGJ B;  5GAO r;  2DNU A;  2LT1 A;  2JUF A;  1NJI U;  1NZ9 A;  3J80 E;  2NUT A;  2DRM A;  3CCS Q;  1UTI A;  2DD4 A;  2HKN A;  4M78 A;  5CQX A;  3M4G A;  1Q7Y R;  3I56 T;  2O9V A;  3E1S A;  3UA7 A;  1Q81 R;  2FRY A;  4M75 B;  5GMK e;  1M1K R;  2LNV A;  1PNJ A;  1OU9 A;  2KR3 A;  3OW2 A;  5GMK m;  2OAU A;  4M7A E;  1IHW A;  4L59 A;  2MWO A;  2BZ8 A;  4JZ4 A;  5GAM h;  1MNE A;  2HL3 A;  4M78 G;  2OTL A;  2JS0 A;  5HK3 A;  4HVV A;  1V1C A;  1YCY A;  1VQ5 A;  3VS7 A;  2MIO A;  1K4U S;  5CQY A;  2D9T A;  5FWB A;  4C0D C;  3BE3 A;  2E1H A;  3OS5 A;  1R77 A;  1KD1 U;  2KE9 A;  1R0B G;  2KY9 A;  2QEX A;  1Y96 A;  1QQJ A;  1HSQ A;  4C92 G;  1YJN T;  2YVL A;  1RAI B;  3TQ7 P;  1H8K A;  2VWF A;  3OSV A;  2A37 A;  2ZPG B;  1X6B A;  2XU8 A;  3FPR A;  2P4T A;  4RTV A;  3CMA A;  4GLK A;  4F17 A;  2DX1 A;  1ZBJ A;  3EG9 A;  3CCV Q;  5DLQ E;  2WSE E;  5CCX A;  4M7D G;  4M78 E;  4LUE A;  2RK1 A;  1TTH B;  3ZL7 C;  2GTO A;  2EWN A;  1QVG P;  3M54 A;  4X1V A;  1ZSZ C;  2EQM A;  4DBH A;  2ROT A;  2FZC B;  1Y7X A;  3CCQ Q;  4M7A F;  3G6E Q;  1Q86 C;  1WHL A;  2DYB A;  3JCM f;  4MZM A;  3RUX A;  3V8L A;  5LJ5 e;  2A3L A;  2RQW A;  4C92 E;  5J26 A;  4M77 D;  2GQI A;  2O4X A;  1RL2 A;  5DLO A;  1C6V X;  3CPW A;  3GNF B;  1IRX A;  1QVP A;  5FU7 C;  3HL8 A;  1SRM A;  1W6X A;  4A54 A;  4JS4 A;  1Q95 G;  1PSE A;  4RTU A;  3UAT A;  1OZ2 A;  2W10 A;  2PQW A;  5IN1 A;  2EYQ A;  2HEQ A;  1Q82 C;  4M7D E;  2GBQ A;  4IUQ A;  1PCX A;  4J9G A;  3CCR Q;  1M27 C;  2ZZD A;  1VQL T;  3JCM P;  3GPL A;  5LJ3 d;  3OYY A;  4A4G A;  1KQS A;  2HZY A;  4ZNX A;  4C8Q C;  3EG3 A;  2MMP A;  1I0C A;  3I55 A;  4M78 F;  2YRV A;  4RUG A;  2QA4 Q;  2LZ6 B;  3CCS T;  5KYY B;  1S72 Q;  2DER A;  3JB9 D;  3ZJU A;  3M0P A;  1VQP Q;  2HL5 C;  2RQR A;  2RK2 A;  1YWP A;  4C92 F;  4RCC A;  2D0Q B;  1KQ1 A;  2XDB A;  5LJ5 g;  1X6G A;  3EAE A;  3MB5 A;  4HCK A;  1WX6 A;  1JJ2 A;  2KGT A;  4M7D F;  3JV3 A;  1AOJ A;  2XHC A;  5DYG A;  2ROL A; 
#chains in the Genus database with same CATH homology
 3SFM A;  2JTM A;  4X9D A;  3JCM e;  1VQK A;  4LDX A;  1Y96 B;  3L2W A;  4C0Z A;  1NPR A;  2BIV A;  2CS7 A;  2X4J A;  2LC4 A;  1YIJ T;  3X20 B;  3A8L B;  3T9N A;  1JBM A;  3VJP A;  3OYI A;  1M5Q 1;  4KLN A;  2KQW A;  5HY6 A;  3Q1J A;  2QA4 A;  3QSU A;  3DB4 A;  4M7D A;  3JAM E;  3ZFJ A;  3EFS A;  1Q81 U;  3QUI A;  2BKD N;  1M1F A;  1JJ2 S;  2E70 A;  2EJF A;  4TVR A;  2YLB A;  4BI8 B;  4BDY A;  1S72 A;  1M1K U;  2OTJ A;  2PWY A;  3QQ8 A;  1VQP A;  3CCV T;  2DZ9 A;  2M0O A;  4OP0 A;  5LL6 S;  4N4G A;  1Q82 U;  3UT1 A;  1BIA A;  4MZT A;  5FLX E;  4ZN3 A;  3I55 T;  3OBW A;  3FJP A;  2AHJ B;  3MP6 A;  3BFM A;  1VQN A;  5GAO l;  3JB9 H;  3LGF A;  4O5V A;  4Y28 E;  5GAM e;  1I8F A;  4M75 G;  3S3N A;  3AHU A;  3LGA A;  4M75 C;  1W2B A;  1N6A A;  2DJZ A;  2RJD A;  4EDU A;  1VQ8 A;  2LDM A;  3CCQ T;  5CCA A;  2VUB A;  3J81 E;  3CC2 T;  3FDR A;  4XTX A;  4RMO A;  3G6E T;  3TU4 K;  1M8V A;  4BY6 C;  3VYH B;  3OYK A;  3E19 A;  3O8V A;  3HPW A;  4EPC A;  4JRQ A;  1BIB A;  2QQR A;  4OGC A;  5A0D A;  4A4H A;  1WGS A;  5CKF A;  1YJW T;  5KH6 A;  4JRK A;  3DLL A;  3E9G A;  3KUF A;  1FXX A;  2O4X B;  1VQ7 T;  1UGR B;  5LJ3 f;  4YTL A;  3G4S A;  4C8Q F;  2CZ0 B;  4P5N A;  3QDR B;  1H64 1;  3JRZ A;  5GMK i;  3OS2 A;  1KG1 A;  5LJ5 j;  2QDY B;  2VV5 A;  2P0K A;  3P8D A;  1D3B A;  3SWN C;  3CME T;  3FEO A;  3P8H A;  4OB2 B;  4M7A B;  1JRI A;  2RI2 A;  4KT0 E;  2FHD A;  3MEA A;  3PIP A;  4ZGE B;  3C4S A;  4L6V 5;  3QII A;  1I4K 1;  4M77 G;  2K5I A;  4N0A A;  2JTF A;  2MWP A;  2IG0 A;  3BW1 A;  4M77 C;  3OS1 A;  3JCM J;  2LTO A;  2LX9 A;  4XK8 E;  3OYB A;  2C06 A;  3CCR T;  4C5H A;  3GF5 A;  2ZGW A;  3QJ6 A;  1M4Z A;  2QQ9 A;  5IAY A;  1Q7Y C;  1ZC1 A;  2Q1D X;  3M4Y A;  2LQK A;  4FIB A;  4C8Q A;  3LX7 A;  2L8D A;  4M75 E;  4C5E A;  2MF2 A;  1M1K C;  3VYG A;  2L89 A;  2RJE A;  1VQK T;  2XK0 A;  2EQJ A;  4PKC C;  1O54 A;  4RG2 A;  2CYZ B;  2XDP A;  1QDN A;  4OB3 B;  4LD9 K;  1FWZ A;  2K3X A;  2PUK B;  3PNW C;  1NE8 A;  4ATO A;  3ZJT A;  1X01 A;  3QYG B;  5FTM A;  4L5G A;  3L2V A;  1BYM A;  4IUR A;  1YI2 A;  5GAN 7;  4II1 A;  4A53 A;  4OF1 A;  5GAO n;  2QA4 T;  1MHN A;  5DYI A;  2E65 A;  3QYH B;  2Y4Y A;  2DK3 A;  3LHD A;  4E7H A;  2O01 E;  1S72 T;  3JCM c;  2IVW A;  2OTJ T;  1UGP B;  2LRQ A;  1Y71 A;  1VQP T;  3FRN A;  2DO3 A;  2KDS A;  4MZP A;  4PJO G;  3SB2 A;  3OYF A;  4PJO C;  2E41 A;  3X26 B;  3CC7 A;  2RA2 A;  1QCS A;  3QBY A;  3JCM V;  3GNG A;  1K9M C;  2RO0 A;  2RM4 A;  3DLM A;  5GAM g;  1OYX A;  5CIU A;  1VQN T;  1GXI E;  2ZPE B;  4KO8 A;  3VUB A;  3V7S A;  1X75 C;  3G7Z A;  3MP1 A;  4M77 E;  3NFC A;  5C6S A;  1VQ8 T;  4M7A D;  4CQN A;  2HNI A;  5LJ3 h;  3JB9 G;  5GMK h;  3CCM A;  2M16 A;  3VU3 C;  1E32 A;  3LWI A;  4FM4 B;  2K3Y A;  1WJR A;  3CCJ A;  4KOD A;  3H8Z A;  2RI5 A;  4V2S A;  2DIQ A;  4OB1 B;  3LH0 A;  5KCO A;  5GAN f;  5C18 A;  3V7R A;  3L42 A;  4Y91 A;  2A7Y A;  3TIW A;  3WVE B;  2PJH B;  2XID A;  3UDC A;  4FT4 A;  2HBP A;  1M90 C;  3FPT A;  2CZ6 B;  4C0D B;  3S3O A;  3RKX A;  4IUV A;  5FU6 B;  1X6O A;  3ASK A;  1XQH A;  3KXT A;  2GFA A;  3G4S T;  5FRM A;  4IKF A;  3ER0 A;  3PFS A;  4J8O A;  5A2Q E;  4E7I A;  3F70 A;  5A0G A;  2Q18 X;  2DTI A;  3QO3 A;  3SDZ A;  2PU9 B;  4C92 B;  1RI0 A;  2VXF A;  5GAN 2;  3CCE A;  2K2V A;  2XD0 A;  3R6O A;  4F7U G;  4M75 F;  4C8Q E;  4OVA A;  2DKG A;  4RCB A;  4BAC A;  3M57 A;  3OYE A;  4PJO E;  3ZGZ A;  3HU2 A;  2JN0 A;  4Z02 A;  3DB3 A;  1S3S A;  3P8B B;  2F69 A;  1O9S A;  4NS5 A;  4BI3 A;  2ZCF B;  3LWH A;  3PGG A;  5LJ3 e;  2QQA A;  2DTO A;  1QVF A;  3CD6 A;  3HSB A;  5EPP A;  2FVU A;  3QXE B;  5GAN d;  3TCJ A;  1LOJ A;  4BD3 A;  4HCB A;  3FPU A;  4IUP A;  3JCM b;  3URG A;  4M7D B;  2JV2 A;  1YBY A;  4RKU E;  2LCL A;  1XOV A;  2DEQ A;  2KVQ G;  4M75 A;  5GLF A;  3CCL A;  1H3Z A;  4J7I A;  4M78 D;  4EMH A;  3CBO A;  4XU2 A;  5CKD A;  3E9F A;  1WLF A;  5EQJ B;  4DQ2 A;  3M56 A;  1YI2 T;  3FC3 A;  1JB0 E;  1Q7Y U;  4CI0 C;  2RH2 A;  5GAO m;  3N5B B;  3PMI A;  4M78 C;  2EJ9 A;  3OY9 A;  1YHQ A;  3KBG A;  1G3T A;  2XIC A;  4C0F A;  5GMK l;  5LJ5 d;  3RES A;  3GOX A;  3OBY A;  2G3R A;  3JSC A;  4M77 F;  2RJC A;  3OMG A;  3OYH A;  3CXC A;  4XTY A;  4LDV A;  2P0P A;  3CC7 T;  1KQ2 A;  5J39 A;  5GAN h;  5GAM j;  1QVF S;  2CKK A;  2RHZ A;  2X4X A;  3OSS C;  3QPH A;  3UPU A;  3INZ A;  2K5F A;  1WJQ A;  1QW1 A;  2EJG A;  4PLL A;  2QXF A;  3OYL A;  4FT2 A;  3HRS A;  3CPF A;  5FU7 B;  2E10 A;  4BB7 A;  4D6W A;  4C92 D;  2KAF A;  3SWN A;  4F7U E;  5CO7 A;  3OW2 S;  4GY5 A;  5CVI A;  4QQG A;  5DM7 R;  2CZ7 B;  3CCM T;  4PLI A;  1WNL A;  3MEU A;  4HCC A;  2ZPH B;  5A0L A;  3CCJ T;  4HT8 A;  2P0Q A;  3X25 B;  4XTZ A;  2F5K A;  5LJ5 h;  4M77 A;  4ELZ C;  2XKO C;  4O6J A;  1K9M U;  5DLO A;  4J6X A;  1NJI C;  1D3B B;  2V8J A;  3MCA B;  4BI4 A;  4R55 A;  3CXC S;  1VQ4 A;  4J5Y A;  4CRI A;  1N8R U;  1G5V A;  2MI6 A;  1R8O B;  1VIE A;  3HFN A;  5L8R E;  3CC4 A;  4E47 A;  4HT9 A;  4M7D D;  2M1H A;  2K4Y A;  2K5L A;  2PVG B;  2RD1 A;  1N27 A;  3C95 A;  4J83 A;  4PJO F;  4QVZ A;  4LD6 A;  3HRT A;  3C12 A;  3PMT A;  3CCE T;  1YIT A;  3OYJ A;  4ARC A;  3RMQ A;  1FX7 A;  1EIF A;  5GAN 8;  1KHI A;  3QZ5 B;  4C8Q B;  2XDD A;  3TRE A;  3VUZ A;  1M90 U;  2JOY A;  5AYF A;  5FTK A;  2HD0 A;  3FLG A;  1CZ5 A;  3V8K A;  4XU3 A;  1M1G A;  1N9S A;  3JB9 F;  4JRI A;  2DXB A;  2WSC E;  2RHI A;  3JCM W;  4DOV A;  3I56 A;  2GF7 A;  1W4S A;  4QVD A;  2PUO B;  3CD6 T;  3RKW A;  3JCM g;  5I21 A;  5C1B A;  4PJO A;  3QZ9 B;  3GLX A;  1QP2 A;  3ZBD A;  5M9O A;  2KMT A;  2DXU A;  2QTX A;  3CBP A;  1VQO A;  4HKE A;  3UWN A;  2Q1C X;  2WSF E;  4XTU A;  4BE1 A;  4XQ3 A;  3CCL T;  5DY9 A;  4WF2 A;  3RKY A;  3JB9 I;  1I5L A;  3MP8 A;  2EQU A;  2MM2 A;  4BE2 A;  1Y07 A;  4BDZ A;  2PVO B;  3ZEH A;  3V8J A;  3OYD A;  3QG1 A;  1YHQ T;  4JLI A;  3QJY A;  4LDU A;  4F7U F;  3FIF A;  3MEV A;  3A8H B;  3M53 A;  5KE2 A;  5GAO p;  2GQV A;  4J6Y A;  3CCU A;  4LDW A;  4VUB A;  3BY7 A;  3OS0 A;  2HQE A;  2MAM A;  2E6N A;  3VV0 A;  1VQM T;  1YIJ A;  2BUD A;  2L3R A;  3S6W A;  1N8R C;  2HAX A;  3M5A A;  3CEY A;  4KDL A;  4PL6 A;  4M7A G;  3WXM B;  3JCM d;  4C8Q D;  1YJN A;  3MET A;  2JVV A;  4M7A C;  4XU1 A;  4MML A;  3MEW A;  1VIF A;  2EIF A;  3HFO A;  4F7U A;  4OB0 B;  4AS1 A;  5HK0 A;  3LW5 E;  3QKJ A;  4EMK C;  3JCM X;  1WPY A;  2QQB A;  5KCH A;  5GAN 5;  4JRP A;  4JS5 A;  4J6W A;  2RHU A;  3M58 A;  4MDW A;  3BDU A;  2Y4X A;  1R7R A;  2LQ8 A;  3A8M B;  1I81 A;  2LVM A;  4R56 A;  3OYA A;  3G71 A;  1VQ9 A;  1WJS A;  2X4W A;  3CC4 T;  1KC8 C;  3BDL A;  3HU3 A;  1M9S A;  2YLC A;  1VQM A;  4KUD K;  4ZTF A;  1VQ6 A;  1UEB A;  3OA6 A;  4ZGJ B;  5GAO r;  3BQB A;  5LJ5 f;  2LT1 A;  1YIT T;  4E7L A;  3M9Q A;  2FYK A;  2I2L A;  2JUF A;  4HA8 A;  4KUL A;  3OYM A;  1VQ4 T;  5FTJ A;  1UB4 A;  1NJI U;  1NZ9 A;  5I2S A;  5GAM d;  3J80 E;  3C94 A;  2R5A A;  2ZPB B;  2CGH A;  2QQS A;  2DD4 A;  4M78 A;  1KQS S;  2B8A A;  5CQX A;  3OYN A;  4ZN1 A;  3DKM A;  5LJ3 j;  3M4G A;  5FRN A;  3I56 T;  3E1S A;  3M55 A;  4M75 B;  5GMK e;  1WQ7 A;  5ERG B;  1LJO A;  2RB6 A;  2LNV A;  3PT9 A;  3JCM Q;  1IZ6 A;  1VQO T;  3OW2 A;  3H6Z A;  2R58 A;  2OAU A;  4B9W A;  5GMK m;  4M7A E;  3OMC A;  4L59 A;  2DXC A;  3HKS A;  2MWO A;  1CR5 A;  3NTI A;  2RHY A;  3TEE A;  5GAM h;  4M78 G;  1B34 A;  4QQ6 A;  2OTL A;  5HK3 A;  4KDI A;  4XAX B;  2L5Q A;  3L2U A;  1YCY A;  5CAI A;  1VQ5 A;  4C5G A;  5CQY A;  4XTW A;  2RI3 A;  3SWN B;  2E64 A;  4ZGD B;  1QVG A;  3CCU T;  2D9T A;  3LGL A;  3SD4 A;  4C0D C;  1OI1 A;  3FB9 A;  2E1H A;  3OS5 A;  5FU6 C;  4A4K A;  1KD1 U;  2EFI A;  3LLR A;  1VQL A;  2DPP B;  2KY9 A;  4M77 B;  2QEX A;  1U1T A;  2DAQ A;  1UGQ B;  1Y96 A;  2GCX A;  4QW2 A;  5CKH A;  5CR2 A;  4C92 G;  5GAN 3;  1ZQ1 A;  1YJN T;  2JZ2 A;  3RER A;  2YVL A;  4C92 C;  2EKO A;  4X9C A;  2D6F A;  3L2R A;  3ZJV A;  2YUJ A;  3OSV A;  4ARI A;  2ZPI B;  2ZPG B;  4A4F A;  4EMK B;  1XNI A;  4M75 D;  2XU8 A;  1G3W A;  1DJ7 B;  3G71 T;  1IRE B;  4NL2 A;  1VQ9 T;  2Q19 X;  1QVG S;  3FPR A;  4DA4 A;  2P4T A;  3CMA A;  4GLK A;  3CCS A;  1BI0 A;  2NLU A;  1VQ6 T;  5CKB A;  1YJ9 A;  3OB9 A;  5CCX A;  5DLQ E;  2WSE E;  1CZ4 A;  4M7D G;  4M78 E;  1N9R A;  3X28 B;  4KUI A;  1G3Y A;  2KK4 A;  4C5I A;  4M7D C;  5GAN j;  4BUG A;  2RK1 A;  4NL3 A;  2X4Y A;  5GAN e;  2Y90 A;  5GAN 4;  3HHT B;  1AHJ B;  2EWN A;  2VC8 A;  3M54 A;  4PJO B;  4NOY A;  1K8A U;  2EQM A;  3QHS A;  4JJN K;  2KSS A;  3S3M A;  1Y7X A;  1KC8 U;  4M7A F;  3QC8 A;  3WVD B;  3ME9 A;  5LJ3 g;  1Q86 C;  2R5M A;  4RV0 A;  4A4E A;  3VKI A;  3JCM f;  1K73 U;  1OZ3 A;  2DXT A;  4MZM A;  5FRO A;  3OQ5 A;  4BE0 A;  1TH7 A;  2E5Q A;  2K57 A;  3L1A A;  3RUX A;  3V8L A;  5LJ5 e;  2A3L A;  4C92 E;  1W2B S;  5J26 A;  4M77 D;  2O4X A;  3MO8 A;  1RL2 A;  2F5T X;  2YHT A;  4N4I A;  4QQD A;  4B9X A;  2X35 A;  3CPW A;  3GNF B;  2JNG A;  5C0M A;  2RJF A;  1BI2 A;  2DVE A;  1QVP A;  5D6W A;  3HL8 A;  5CKE A;  5FU7 C;  1HXD A;  5HKC A;  5IT9 E;  1KD1 C;  2MM0 A;  4ZTJ A;  2OTL T;  4JS4 A;  4A54 A;  4IUT A;  3PIO A;  4M7A A;  4HCZ A;  2XG8 D;  4KBM B;  1MGQ A;  2M9U A;  3L2Z A;  1PSE A;  4ME7 A;  4UC4 A;  1VQ5 T;  4EMK A;  4DOW A;  3A8G B;  1Q81 C;  1OZ2 A;  1BKB A;  2PQW A;  4XU0 A;  5IN1 A;  2EYQ A;  3V7C A;  4MDX A;  4JDS A;  5I2M A;  5KE3 A;  1I9G A;  1Q82 C;  1U8R A;  4M7D E;  1V29 B;  4IUQ A;  4RG8 A;  2LCC A;  5GAM f;  3CF2 A;  3GIB A;  2ZZD A;  4F7U B;  4E7J A;  1VQL T;  3QWZ A;  4OMF B;  2QEX T;  4N0A C;  3GPL A;  3CPW S;  3JCM P;  3JB9 J;  5LJ3 d;  2LW6 A;  4X34 A;  1NPP A;  3OYG A;  3GP8 A;  3OYY A;  4EMG A;  3L2Q A;  4JUV A;  3X24 B;  4A4G A;  2RHX A;  3PTA A;  4PJO D;  4C8Q G;  1KQS A;  1O75 A;  1WQW A;  3MHX A;  4C8Q C;  3CCV A;  4LDY A;  2E12 A;  1BI1 A;  1KHC A;  1XTD A;  2MMP A;  2PVD B;  3I55 A;  1ZHI A;  2YRV A;  4M78 F;  5CD1 A;  3HRU A;  1K8A C;  5GAO q;  1UGS B;  4AQ7 A;  3CMA T;  3CCS T;  2Q1A X;  3QQ7 A;  4MMK A;  5D6Y A;  1ZBX A;  3JB9 D;  1G3S A;  4OGE A;  3ZJU A;  1YJ9 T;  4FSX A;  2DZC A;  3A8O B;  5FTN A;  3RMS A;  3CCQ A;  3CC2 A;  1BI3 A;  1K73 C;  2WAC A;  4IUU A;  4M78 B;  5D6X A;  3G6E A;  3JCM h;  5CCB A;  3CBM A;  3EFR A;  4JLG A;  1PSF A;  2GFU A;  5GAN g;  3OYC A;  3J7A F;  2RK2 A;  2CZ1 B;  2XI9 A;  3HP9 A;  2FB7 A;  3RIR A;  3NTK A;  5J3B A;  1QP3 A;  2B25 A;  1YJW A;  2VGN A;  4C92 F;  2VYT A;  5GAN 6;  5GMK j;  5B6C A;  1VQ7 A;  5EG2 A;  4FL6 A;  2QI2 A;  2VXE A;  4RCC A;  2D0Q B;  2V8I A;  2E6Z A;  1KQ1 A;  4E7K A;  2FL7 A;  4PNO A;  2XDB A;  5LJ5 g;  1B34 B;  2R57 A;  2DIG A;  2V8K A;  3EAE A;  3CME A;  3MB5 A;  5CK9 A;  1LNX A;  4Q5W A;  2H3J A;  4QVC A;  2VGM A;  2ZPF B;  2HQX A;  3A5Z B;  1P92 A;  4J7F A;  4N4H A;  3HU1 A;  1U1S A;  2LT4 A;  5FTL A;  1SSF A;  1JJ2 A;  1Q86 U;  2DD5 A;  2EQK A;  4FU6 A;  4C92 A;  4M7D F;  4ELY C;  3CCR A;  3LYI A;  3M59 A;  1VUB A;  4C0G A;  4XTV A;  2DTH A;  3NTH A;  2XHC A;  1HK9 A;  4BY6 B;  5DYG A;  2EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...