5D6WA

Crystal structure of double tudor domain of human lysine demethylase kdm4a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4A
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5d6wA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5d6wA02
2MWPA 3LH0A 2DIQA 2LDMA 4QQDA 4E7KA 4E7LA 4PLIA 4PLLA 4UC4A 3FC3A 3LLRA 5KH6A 3META 3OMGA 3OMCA 4ZTJA 3H6ZA 3L2WA 4CRIA 1SSFA 2P0KA 3OYLA 4BE0A 2E6NA 3MEWA 3ASKA 1OI1A 2CKKA 2EQJA 3LGLA 2XK0A 3QJ6A 2LTOA 4N4HA 2RI3A 3EAEA 5FROA 2RJEA 3OS2A 3OY9A 4X34A 1N27A 2PQWA 3PMTA 4BACA 3DB3A 2L3RA 3FEOA 3S3NA 3S3OA 4BE1A 5FRMA 4LD6A 4IUTA 2XDPA 2EFIA 4Q5WA 3MP6A 3DB4A 3UT1A 3OS1A 3UWNA 3KUFA 2X4YA 3Q1JA 4E7HA 4C5GA 1OYXA 3MEVA 3OYAA 1WJRA 2K3XA 2RHYA 2YRVA 4RG2A 1WGSA 3OYGA 2R57A 4II1A 4B9XA 5CIUA 4C5HA 4IUVA 3P8HA 2RHXA 3QKJA 4QW2A 3E9GA 3M9QA 4FU6A 2RI5A 3MEUA 4FL6A 4E7JA 5IN1A 3OYDA 2G3RA 3BDLA 3MP8A 5M9OA 4HCZA 2F5KA 2BKDN 4ZTFA 4IUPA 3FLGA 4IUUA 2O4XB 2RJFA 3PFSA 4BDZA 2L8DA 3L42A 4IKFA 3QIIA 3QBYA 3ZEHA 4BE2A 3OYMA 2O4XA 3OQ5A 3S6WA 3FDRA 3PMIA 3OS0A 3CEYA 4NS5A 3OYFA 2EQMA 4BDYA 5KE2A 4E7IA 3F70A 5KCHA 3OYCA 3C4SA 2E5QA 1XNIA 2VYTA 4IURA 3MEAA 2WACA 2M1HA 2MWOA 4A4HA 4C5EA 2RJCA 2RJDA 1MHNA 2RHZA 2RI2A 5FRNA 2IG0A 2L89A 2QQSA 3L2RA 2GF7A 3OYEA 3OYIA 1OZ3A 4A4FA 3LGFA 4QVZA 3OB9A 5C6SA 2HQXA 2R5MA 2HQEA 3NTHA 5IAYA 5KE3A 3L2UA 4QQGA 2FHDA 3O8VA 1G5VA 2LRQA 2RHUA 4EDUA 2R5AA 4OVAA 5KCOA 2EQUA 3OYKA 3OA6A 3LX7A 2LVMA 4A4GA 4B9WA 1KHCA 4N4IA 3ME9A 2BIVA 5D6WA 3NTIA 2GFUA 2X35A 4QQ6A 5D6XA 2M0OA 3MO8A 2EQKA 1WJQA 3OYJA 2BUDA 2D9TA 2JTFA 3OYNA 3DLMA 3E9FA 2R58A 2RHIA 5C0MA 3P8DA 3SD4A 4BD3A 3L2VA 4IUQA 2DIGA 2LCCA 2RO0A 5D6YA 2NLUA 3LYIA 2X4XA 3S3MA 4GY5A 4L59A 3GOXA 3MP1A 2B8AA 3NTKA 2QQRA 5J26A 1OZ2A 1H3ZA 3OYBA 3H8ZA 3OYHA 1WJSA 4N4GA 2M16A 1RI0A 4Z02A 5J39A 2K3YA 2JZ2A 4C5IA 3L2QA 3PNWC 4PL6A 2GFAA 2X4WA 2EKOA 2DAQA 4A4EA
chains in the Genus database with same CATH superfamily
1ZSZB 1D3BA 3I9QA 3LH0A 4BY6C 3EFSA 4XU2A 4PK4A 2DKGA 3TIWA 4ELZC 2HNIA 4BB7A 5A2QE 1M2VA 3SWNB 2YLCA 2JUFA 1IREB 2CKKA 1GCQC 4M78E 1OQKA 3DB3A 1G8XA 1SEMA 4FIBA 1I81A 5KYUA 3CXCA 2HMAA 2LX9A 3H0FA 4HVUA 1WGSA 4F04B 4IUVA 4M7DG 1KC8C 2J05A 1NLOC 2KT1A 1TS9A 3G4ST 1OPKA 1PG5B 3E2UA 2GTJA 3SHWA 2CP6A 3EG2A 3RUXA 1IZ6A 4NS5A 1E7OA 3CC2T 4M7DF 1YJ9A 1M90R 1F1BB 3J80E 2SRCA 2YRCA 2QTXA 2DBMA 3NGPA 3CMEA 1M5Q1 2GQIA 5GMKe 2YUJA 2DF6A 3M54A 1WHJA 2MI6A 5GMKh 1KD1C 1M8VA 4C8QG 4RTXA 2E10A 5ECAA 3PIOA 5GAMe 4B9WA 1YCYA 3TREA 4C92A 2E4HA 3OSSC 5GAMh 4A53A 2F2WA 2GBQA 1KIKA 2MF2A 2EJFA 4ESRA 3A8LB 1MMNA 2NUPA 1HSQA 2ZPHB 3H0HA 1RAIB 4M75A 4OGCA 2QQRA 3OYHA 1WJSA 3LH5A 3QYHB 1RADB 5J39A 5C18A 2PVOB 3CMEQ 1M8MA 2ZAEA 1WFWA 2NYSA 3L2WA 1YI2T 1C0MA 2KGTA 2QQ9A 2JXBA 4M77C 2MYSA 3ASKA 5KYXA 2PJHB 2SEMA 2XK0A 1I5LA 1SHFA 1AHJB 3QQ7A 1K9AA 2A0FB 5CCBA 3UF4A 1IO6A 2O2OA 2J7IA 1YWPA 1TWBA 3MJXA 2P4RA 4FM4B 4J9GA 2GCXA 1X69A 3UT1A 1U1TA 8ATCB 2ROTA 2DTHA 2DVEA 1GBQA 2YVLA 3L2ZA 1M3BA 2K3XA 3MCAB 2JNGA 1K8AC 1UEBA 3EHRA 2GQVA 2EW3A 4E7JA 1ZLMA 2ENMA 1VQKA 3BDLA 3MP8A 1VQ5T 1AWWA 1K9MR 1M4ZA 1BIBA 3FLGA 1Y0MA 2DEQA 3CC7T 3VRYA 3BE3A 3V8LA 4M7AE 3JCMe 1K8AR 4FT4A 2KK4A 3G6EA 3JCMh 3JSCA 1Y7XA 3M4YA 1SF9A 2NUTA 4DOVA 3GNGA 1U06A 1E6GA 2EPDA 1G83A 3FPTA 2R5MA 1VQ4A 2FHDA 4LDXA 3WVEB 1TU0B 2EYXA 1NPRA 3MKDA 5GAMd 1VQMA 4OB2B 1VQKQ 3CCMT 2ECZA 3CCRT 1QLYA 2AHJB 1VYVA 2KY9A 2BUDA 1PHTA 2I0NA 3HRTA 3HKSA 3OSVA 2QGGA 4DBRA 1K1ZA 3LYIA 3G6EQ 1UUEA 3THKA 2K3BA 3GOXA 5FTLA 3VS5A 2L5QA 3EG9B 3CCST 1D3BB 2KVQG 4J9EA 4A4EA 5I11A 2AKKA 2DTOA 2DMOA 1M2VB 4EMGA 1VQ4Q 4N0AA 1MMGA 1WYXA 4JZ3A 3OMCA 3CCLA 2P4TA 1TXQA 4EMKA 2MOXA 2FB7A 2LCLA 1VQMQ 3V8JA 4AFUC 2PQWA 5KYUB 2KRNA 2OTJT 5DY9A 5FRMA 1VQ6T 1WZOA 4ANJA 5IXBA 4OMFB 5GLFA 1Q86C 1JJ2P 2L0AA 3Q1JA 3VYHB 1SG5A 1OYXA 4PJOG 4XTVA 4J9FA 1OU8A 2RHXA 5I2SA 4LUEA 1FXXA 1YJNA 5FWCA 4M77D 3HFNA 2XMFA 1WXTA 2RB6A 5LJ5g 4IKFA 2M9UA 4JDSA 3QC8A 3S6WA 4ELYC 3A98A 3A8GB 1Q7YU 3F70A 2BTTA 1QDNA 1D0XA 3H0IA 1BI2A 2A3LA 1AZGB 2RJDA 3RKYA 4R55A 1NJIU 2YUPA 4MDXA 1QKXA 3NFCA 1YN8A 3VS0A 4HCBA 1EX4A 1U5SA 4XTYA 1BKBA 3HHTB 1N9SA 4XU0A 4EDUA 4XK8E 3I56A 3EGXA 4M7DE 3VS1A 5GMKl 4LXCA 4C92B 4BI4A 1YJNQ 2PTKA 3I55T 1NYFA 1I0CA 1BK2A 2ZGWA 1I8FA 2PU9B 3X25B 3EGUA 2NUPB 3A5ZB 5D7UA 2R58A 2KR3A 3EGDA 3DKMA 4M75B 1Z9ZA 5GAN6 5GANe 2L3PA 2RQUA 3NHNA 5GANh 5I22A 2DAQA 1YITT 3RMSA 2DVJA 2EYZA 4AG2C 4UC4A 4R0KA 3META 5KYXB 2J06A 4C8QE 5GAN4 2HZYA 4QKUA 3I56Q 3ZJVA 3OS5A 2ZZDA 4X34A 8AT1B 2IIMA 5CKBA 3S3NA 3CD6A 1VQNA 4R56A 3JB9F 4F17A 2DJQA 3KUFA 2HKNA 5I21A 1YJ9T 4LUDA 2XD0A 1M1KC 2RQTA 3CMET 3FPRA 2JTMA 1M90U 3TSZA 3LHDA 3P8HA 1T3LA 4FU6A 1LNXA 2VV5A 2MM2A 2QASA 3G71A 4OMNA 3I5SA 1S1NA 1OX8A 2PVGB 4OGEA 2ZPEB 1TOVA 5LJ5f 4F7UF 4DOWA 3H41A 1GCQA 3C95A 1W2BS 5CD1A 2NUTB 1SPKA 2AK5A 2Y90A 2DILA 5IH2A 1B3QA 3HPWA 2RHZA 2RI2A 3SDZA 1VQNQ 3CD6Q 3NPFA 3HU1A 2QDYB 3HP9A 2GF7A 2DJZA 1WDXA 5KYNA 1GXIE 4X9DA 2HQXA 2HQEA 4IIMA 5KE3A 4KRTA 1YI2A 1QCFA 1PRMC 6AT1B 3KBGA 4OP0A 4JJBA 4OVAA 4KULA 2E65A 1GL5A 2KRSA 4JJCA 4C0DB 3G71Q 2MMPA 4CI0C 2LJ0A 2D6FA 1XOVA 2GFUA 1NLPC 1VUBA 5D6XA 3EG1A 1VQLT 2QDLA 1UGRB 4L5GA 3TEEA 1RUWA 4FW2A 2EIFA 3N5BB 2L3QA 5J26A 1UE9A 3M53A 1M30A 2DL4A 2FZGB 4N4GA 1VQ5A 5B6CA 1S72A 1KHIA 2RQRA 2K57A 1YI2Q 2WSFE 1V1CA 1VQKT 4J9CA 3MEWA 2NWMA 4AMCA 4L6V5 1ZBXA 3OY9A 3ULRB 2Q18X 1K9MU 4F7UA 4D6WA 3G6ET 2K7AA 3BY7A 1K8AU 3E1SA 2DK3A 1FX7A 2JTEA 3FIFA 3TSWA 1PWTA 2NUZA 2LC4A 2CZ6B 2XICA 3E9GA 3M9QA 1VQ5Q 1N8RC 1K0SA 1VQ4T 2KYBA 1ABOA 4OMQA 5CKDA 3CC7Q 4IUPA 3TQ7P 4EIKA 1VQMT 2L8DA 4DEYA 4F16A 3QBYA 3OYMA 1VYTA 4M77A 3FDRA 2CP7A 3O5ZA 1K76A 4F14A 2VYTA 5KYYA 5HCKA 5GAOq 4OMOA 1I9GA 4HVWA 4C5EA 2C0OA 1C6VX 3SFMA 2IG0A 2V8JA 1K73C 1X2KA 4KBMB 3VJPA 4ZN1A 1D1AA 4PJOE 4GBQA 3ZJUA 3RMQA 3EGXB 4JZ4A 1RAFB 5IXFA 2OI3A 4JLIA 5I2MA 2J6OA 3CCLT 2KXCA 3E19A 1K73R 1UB4A 3EGDB 2E3IA 3DLMA 2OAUA 3P8DA 2KSSA 3L2VA 2XDBA 1IGQA 1ZQ1A 2K6DA 4AFQC 2X4XA 3M0UA 3VV0A 1ABQA 1NZ9A 3OYBA 1DJ7B 2EYYA 1TUCA 4KGVB 2CZ0B 2ROLA 4KUIA 2C06A 3QO3A 2JVVA 3VS7A 1YJNT 1EFNA 4ZTJA 1VQ7A 3H6ZA 5ERGB 1VQ9A 2CZ7B 3LGLA 2COZA 2HSPA 2RI3A 3EAEA 1PD1A 3QG1A 1NPPA 5GMKj 4C92G 2LT4A 3GPLA 1WNLA 1JBMA 2DL8A 4LD6A 1G2BA 3MP6A 4RTWA 5FU6C 4PJOC 3EG9A 3V7CA 4M75G 3CPWS 2O88A 3I55A 1VQ8A 1FMKA 4C92F 3WVDB 1ZSZC 3I56T 1U3OA 1XTDA 3CBPA 1ZC1A 2LQKA 1D09B 4HVVA 4E6RA 1AT1B 1FYNA 3L42A 1VQ7Q 3OQ5A 1VQ9Q 4M75F 3OS0A 2CUDA 2KYMA 5KCHA 3MEAA 4J6YA 1YITA 2MK5A 3LGFA 5HK0A 3EH2A 2G6FX 4F7UE 2CSIA 2RHUA 5KCOA 3M0SA 1M1FA 3I55Q 3JCMX 4JRIA 4ZN3A 2X3XD 4N4IA 1VQ8Q 3VS3A 3PVLA 2EGEA 1KC8R 4J7FA 1QW1A 4ATOA 5LJ5h 4WF2A 2VKNA 4JLGA 2DIGA 4XTUA 4LN2A 2NLUA 3CD6T 1VQNT 4GY5A 1N6AA 1H8KA 4KT0E 2K79A 3V7SA 3VU3C 5EC7A 4RTYA 1OU9A 1NE8A 1YITQ 3QDRB 3L2RA 4M78C 3QZ5B 3FRNA 2FEIA 2RK2A 4E7KA 1NM7A 4RKUE 3FC3A 2DE0X 2FPDA 3CBOA 1OOTA 3G71T 3QQ8A 1SSFA 2K5LA 4F7UB 2W10A 5CCAA 1KD1R 1YHQA 1Q81C 3FEOA 4AT1B 4M4ZA 2CYZB 2X4JA 2LQNA 3CPFA 3M5AA 2HSEB 1YJ9Q 1ZUYA 1H641 3DB4A 4PJNA 4ORZA 3GIBA 3VRZA 3MEVA 4DBQA 5CKFA 4PFZA 1NG2A 2ZCFB 1BCMA 5CIUA 2DXTA 4MMLA 3QKJA 4EMHA 2E12A 3INZA 5GAOl 1NEGA 3CCEA 2RH2A 1BBZA 5FW9A 1VQLA 4CQNA 2ATCB 3T9NA 2OAWA 4M77B 1I5OB 2JN0A 1PC0A 2O4XA 3OYYA 5KYYB 4Z8AA 1KQ2A 2KRMA 2HDAA 1YHQQ 4JS5A 1QMCA 3C94A 1Y07A 3RBBB 4JRKA 1WIEA 3VS4A 4VUBA 1OV3A 1S72T 4LDUA 4FSSA 2JW4A 1RACB 4E7ZA 3CCEQ 5LJ5d 1QVPA 1VQLQ 3QWXX 1QP2A 2D1XA 2JJ9A 3CMAA 4CC3A 3RESA 1SHGA 2H3EB 5IT9E 4IUQA 1WHLA 1ZBJA 2EKHA 2EYWA 5GMKm 1ACMB 2CSQA 4L59A 2QEXA 1HK9A 2PUOB 1KSWA 2M16A 2PZ1A 2K3YA 4C5IA 2PNIA 5IHKA 3H9NA 4KDLA 2LDMA 4QT7A 2YLBA 2RQVA 2PVDB 2E64A 3OMGA 3OW2S 2EJ9A 4N4HA 1FWZA 1GRIA 1N27A 3TU4K 5HK3A 5CQXA 3EG0A 4LE9A 2KEAA 3S3OA 4LDYA 3PVQA 4BUGA 3CMAQ 5FU7C 1ZA2B 2A7YA 5DYGA 4FCYA 1AVZC 1QVFS 5EQJB 3CCQT 4M78D 2QQAA 2FPEA 2R57A 3VS6A 4M7AC 3MEUA 2KBTA 3JCMJ 2J6FA 2AZSA 4ZTFA 1OX9A 1VYUA 4JUVA 2DD5A 2AIRB 3M0QA 3QIIA 5LJ3f 1KQSS 2DRKA 1J3TA 1MUZA 2E41A 3CEYA 1SSHA 1QCNA 1Z9QA 2LQ8A 1W70A 2JS2A 2XKOC 2B86A 3L1AA 4C92E 1K73U 4JS4A 2RK1A 3ZBDA 2QQSA 3A8OB 1U1SA 1RAHB 2YHTA 1OZ3A 1BYMA 4QVZA 5C6SA 1W2BP 1QCOA 4M75E 3BFMA 1S3SA 3EFOA 1PSEA 1QWEA 1WHMA 3ER0A 2DO3A 4HT9A 2E3HA 1Q86R 1QP3A 1EZZB 3CCLQ 2CDTA 1CKAA 2O9VA 3NTIA 2RMOA 1VQ7T 1OPLA 1CKBA 3R6OA 1JXOA 1PRLC 1VQ9T 1PKSA 2D9TA 4ZGEB 4RTTA 3I35A 2A36A 1KQSA 1IHWA 1UDLA 2QK0A 2XU8A 2V1QA 1WLPB 1M3AA 2KAFA 1H3ZA 4Z02A 2M02A 1O75A 1JQQA 1FMWA 1RLQC 2KT8A 3SB2A 1VQ8T 5GMKi 3OYLA 2Y4YA 2YUNA 2EQJA 2LTOA 4PFPA 2K4YA 2L3RA 3D7SB 5CQYA 1IHVA 2EFIA 2PUKB 1U8RA 3OBWA 2JT4A 1WQ7A 1EIFA 5FLXE 4PJJA 4NL3A 3JB9G 1E32A 3OYAA 2DPPB 4RG2A 1G3YA 3M0TA 2KMTA 2YWWA 4C5HA 2ZPIB 1AWOA 4FYVB 1M9SA 4C0GA 4FL6A 3A8MB 3M59A 4OB1B 3VUBA 2O4XB 5CCXA 5CVIA 4KGXB 2DYBA 5C1BA 3AT1B 4PJMA 4F7UG 2E1HA 1KC8U 2RJCA 4M7DC 1YP5A 5FRNA 1R77A 2L89A 3QXEB 4KH0B 3A8HB 2EJGA 4M7AD 3JV3A 3ZJTA 1WA7A 4CC7A 3NTHA 2ZPBB 1MV0B 1LOJA 2LRQA 3JCMV 1QVGS 3VUZA 2DXCA 2RM4A 4NL2A 1JB0E 1M1KR 5GAN5 2QGFB 1UFFA 2LNHB 1VIFA 3UDCA 2QYZA 5LJ3j 1MMDA 4A4KA 1D0YA 1HJDA 4GLKA 1HYOA 1YHQT 4BD3A 1BIAA 4M77G 3JCMc 2YUOA 1KD1U 2L3SA 3C0CA 1W6XA 2BE7D 4WTOB 1GFCA 3H8ZA 4C8QC 4DA4A 1WHKA 3TCJA 1X27A 2JZ2A 3L2QA 2VGMA 2CP3A 4PL6A 1GCPA 1WI7A 1OEBA 1SRMA 1TUGB 1T0HA 4PLIA 1T0JA 2D8HA 5FTKA 4J9IA 4AS1A 2EQIA 3CCET 1CSKA 4J6XA 4MMKA 4M77F 1VA7A 1OI1A 3QJ6A 2DL7A 4KH1B 4C0DC 3REAB 5CKEA 4E7SA 5GAMf 1W2BA 5FWBA 4BE1A 1AWXA 5CK9A 2DZ9A 2A08A 2ABLA 5HY6A 4E7HA 3GNFB 1PSFA 2RHYA 3EFRA 1JO8A 3U23A 5A0LA 4ME7A 2BZXA 3CBMA 2DA9A 2QQBA 4QW2A 3HU3A 3REBB 3LGAA 2LJ3A 2YSQA 1UTIA 4M78A 4JJNK 1NEBA 4N0AC 3CPWP 4KODA 5CR2A 1BU1A 4Z89A 4EMKC 1VQPA 4TVRA 4BE2A 3CMAT 4AQ7A 3OYFA 1R0CB 4E7IA 2QAZA 2FZCB 1KQ1A 1V76A 3C4SA 2Q1DX 1VQOA 2FPFA 2K5IA 2LJ1A 1WXUA 1H3HA 2EWNA 5FTNA 1S72Q 3EFOB 3OB9A 2QEXT 5DLOA 4HCCA 2RD1A 3FJPA 2O31A 2LP5A 2F2VA 4D8KA 4V2SA 3BQBA 2LVMA 2YUQA 5DLQE 2DXBA 3JB9H 1N8RR 2M0OA 2OX7A 1WPYA 1VQPQ 3CCQA 4KGZB 4M7DD 1R7RA 1YFNA 1CZ4A 3WXMB 3UATA 4PNOA 3JAME 3JCMf 2BE9B 2B8AA 3M4GA 3NTKA 2EVRA 4C0ZA 1Q82C 2F1LA 4Y91A 5A0GA 1BI1A 1VQOQ 4OMPA 4BI3A 1QKWA 1X2QA 4XTWA 2QI2A 1MV3A 3UA6A 3CCJA 3HFOA 2WSCE 2H8HA 3HRUA 1B7TA 1ARKA 2DYIA 1ZA1B 2P0KA 4BE0A 3DLLA 2AT1B 4YTLA 1AEYA 1Q82R 4O5VA 3EH1A 1AD5A 1JXMA 1Y71A 2X9HA 2I2LA 3JCMW 2CS7A 1V29B 2XIDA 4C8QD 3OS1A 3CCQQ 4E2FB 3QZ9B 5DM7R 4MZPA 3OYGA 4B9XA 5GAN8 2OTLA 2YT6A 1RAAB 2DFUA 2VXEA 1UGSB 1NJIC 4D8DA 4QVDA 2CT3A 3CCJQ 4A54A 2DLPA 4CC4B 1Q86U 2P84A 4J6WA 5EPPA 2X3WD 2MIOA 4X9CA 3QYGB 5GAMj 2M1HA 5IHIA 2XDDA 1UHCA 4J8OA 1P92A 2COWA 3OYEA 4OMMA 4BY6B 1GBRA 5L8RE 3C12A 2IPOB 5IAYA 3O8VA 1JEGA 1G5VA 1HXDA 1X43A 5EG2A 2EQUA 2D0NA 2OTLQ 2YRDA 4M7AA 4A4GA 4FYYB 2P0QA 1YCSB 3ME9A 3SWNC 4OF1A 5LJ3d 2O01E 1R0BG 4DQ2A 5FTJA 1KG1A 3MO8A 4RTUA 3SD4A 2DZCA 2A37A 2W0ZA 2DBKA 2DM1A 3UPUA 2XHCA 2Q19X 3HL8A 1MGQA 3URGA 3CPWA 1LVKA 1D1BA 4MDWA 1MNEA 4FSXA 4AFZC 4MZTA 1N5ZA 2EYQA 5LJ5e 4XTZA 1PNJA 1BB9A 5CAIA 5GAOp 3FPUA 1M90C 3PTAA 1IRXA 4KUDK 1C1AA 4Z88A 4ZGDB 1WQWA 4J83A 5FTMA 2KROA 2DXUA 3QUIA 2LMJA 3OW2P 1E6HA 4RCBA 1PKTA 4J9BA 4M77E 4X1VA 1RABB 1JU5C 2CGHA 4II1A 2HCKA 4B6MA 1B34A 4M78B 2H3JA 4XU1A 5GANf 1QVFP 1BCOA 1D1CA 2K2VA 4QVCA 2HBWA 3PFSA 2RQWA 4OB0B 3ZEHA 3PMIA 1M1KU 5GAOr 3MPUB 4XAXB 5HKCA 1IXDA 4IURA 3EG3A 1MHNA 2GGRA 1UGQB 1Q81R 1KQSP 5GAN7 3CF2A 3LWHA 4C8QF 2V8KA 2PWYA 2FL7A 1T3SA 2HBPA 2K2MA 2CUBA 3OA6A 5LJ3g 3J81E 2QTVA 1TUDA 1M3CA 3NMZC 1KHCA 4PJLA 3JB9I 1LJOA 3ZL7C 2MPXC 4PJOD 3GBQA 1TG0A 2HL5C 2RHIA 3A1PA 3JCMP 1D0ZA 1UGVA 1RL2A 2DL3A 1NBEB 2FO0A 1I4K1 3JRZA 3V7RA 1K9MC 2FRYA 1UHFA 4M7DA 3SEMA 3CC4A 1PM3A 3J7AF 1B07A 3OBYA 2DL5A 4E7LA 4NOYA 2BZ8A 1W4SA 1ZUKA 9ATCB 1HD3A 5FROA 1VQPT 2C0TA 2M0YA 2XDPA 1R8OB 2XI9A 4J5YA 4BI8B 1VQOT 1VIEA 2LT1A 4KLNA 1YJWA 3MHXA 2KQWA 2M51A 1BI3A 4C8QA 3M56A 5IHNA 2WSEE 1XQHA 3CC4Q 3QHSA 2LX7A 3EHQA 1W1FA 5M9OA 1MNDA 2JM8A 3BDUA 1TTHB 3VYGA 2IVWA 4RMOA 3HRSA 2ZPFB 3PGGA 1RAEB 2EQMA 4KDIA 2AZVA 4RG8A 3CCVA 3JB9D 5FU7B 1N8RU 4A4HA 2QEXQ 1X6BA 2ZPGB 3RERA 4ARCA 1YIJA 1WLFA 4JJDA 3OYIA 2J6KA 3QDFA 4J9DA 1Y57A 7AT1B 1YJWQ 4M7AB 1K4US 1SRLA 3CCJT 2CREA 4HT8A 1QWFA 2JM9A 5GANj 3OW2A 3MB5A 3KXTA 1BI0A 1QVGP 2EQKA 3CCUA 1GFDA 1Q82U 3HSBA 1CR5A 4LDWA 3CCVQ 1QVFA 1X01A 1LPLA 2FZKB 4J9HA 1WHHA 2JS0A 4ZGJB 1YIJQ 2HAXA 2QA4A 2JMAA 2DIQA 2OTLT 1AWJA 4QQDA 4PLLA 1XJWB 2VGNA 3LLRA 5KH6A 2HQHA 2E6NA 1X75C 2QXFA 2DETA 2RJEA 2EGCA 4XQ3A 3JCMd 4PJOF 3CCUQ 2FYKA 2X4YA 3PE0A 2P0PA 4LDVA 1WJRA 1B34B 2CH4A 5AYFA 5KYWA 1RLPC 1ZX6A 2F5TX 2Q1CX 3RR6A 3CQTA 1NYGA 5IN1A 4ZNXA 3AHUA 4A63B 1N9RA 1UGPB 2RA2A 2F5KA 4C92C 2QA4Q 4KO8A 5GAMg 2DRMA 4GLMA 2BZYA 3QWZA 5GJVB 4BDYA 3HU2A 2RF0A 3OYCA 4M75C 5J3BA 3G1JA 3QPHA 4OMLA 2E70A 1A0NB 2KI7A 3G7ZA 3QJYA 4LD9K 4QQGA 4AG1C 2FG0A 2FRWA 2R5AA 3GLXA 1UJ0A 1I1JA 3G4SA 3OYKA 2D8JA 3BW1A 3M57A 3P8BB 4M78G 4WCIA 2DEUA 2YDLA 3X26B 3JCMQ 4DBFA 4DBHA 1M27C 3QWYA 3CC2A 2DERA 2ESWA 1WXBA 2RNAA 3JB9J 2VUBA 5D6YA 2KE9A 1O9SA 5AT1B 4PJOA 2CP5A 4CC2A 2JMCA 3MP1A 3TVTA 4M7DB 1Y96A 3X24B 2HKQB 1QCSA 1RAGB 4M78F 2BKDN 2CP2A 2MM0A 2KXDA 2E6ZA 2RN8A 4Y28E 1WHGA 1ZSZA 4AFSC 5GAN2 3IQLA 4C0FA 4OB3B 3G4SQ 4HA8A 4K11A 2DX1A 2GTOA 1JJ2S 3SWNA 3M55A 2V8IA 3JCMg 2COYA 4Q5WA 1ZHIA 4RV0A 5GJWB 3CC2Q 1CZ5A 3UWNA 1M1GA 3RKXA 2JOYA 3RIRA 2D0QB 4C8QB 2YRVA 1G3SA 1X6OA 4ARIA 2RI5A 1Q81U 1QVGA 2G3RA 1LCKA 2EBPA 3LW5E 2OJ2A 1UG1A 3RDVA 2AKLA 2HD0A 4BDZA 1QQJA 2LQWA 2MAMA 1H92A 1KK7A 4DEXA 1AZEA 4XU3A 1SKUB 1K0XA 4HKEA 3JCMb 1JJ2A 2E5QA 1XNIA 4IIOA 2CT4A 1ZUUA 2CP0A 1G3TA 1YWOA 2HL3A 3RKWA 4PFOA 3GF5A 2RPNA 4MZMA 2A28A 1KJWA 3M58A 2B25A 3FJ5A 3L2UA 5GANd 3CC4T 5LL6S 2K9GA 2ED1A 4EPCA 3CXCP 4C92D 3R6NA 1AOJA 3ZGZA 5GAN3 3CC7A 2O9SA 4E47A 1Q95G 1RI9A 2BIVA 4P5NA 1VOMA 4QQ6A 4EMKB 2V1RA 1IGUA 2X51A 4M75D 1WJQA 2JTFA 4RTVA 1X6GA 5C0MA 4JRPA 3VKIA 2YXYA 2RO0A 2LZ6B 5GAOn 2Q1AX 4FW1A 1TSFA 4PKCC 3RNJA 1G3WA 1OZ2A 2DTIA 2KNBB 1M2OA 5CKHA 2LCSA 1RI0A 2LW6A 3PNWC 2L2PA 4JRQA 2GFAA 1YJWT 2MWPA 5LJ3e 3PT9A 4FYWB 4HXJA 2QG9B 5DYIA 3CCMA 2KDSA 3CCRA 4CRIA 5LJ3h 3VS2A 2DNUA 4M7AG 1PCXA 4JPBW 3OS2A 3PMTA 4BACA 3HTRA 1O54A 4IUTA 4RUGA 4FYXB 3M0RA 2E5KA 3CCVT 4RTZA 3CCSA 2F2XA 5KYWB 4C5GA 2DD4A 2XG8D 4M7AF 1YIJT 4FT2A 3I5RA 2Y4XA 2CH4W 3OYDA 3V8KA 5A0DA 1FMVA 5L23A 4HCZA 3FB9A 4Y92A 2JV2A 3ZFJA 4IUUA 2MCNA 2RJFA 2FVUA 3CCMQ 2OTJA 3X28B 3CCRQ 2EGAA 3QSUA 1VQ6A 2ED0A 1YBYA 1TH7A 5KE2A 3M0PA 3CCUT 2V26A 1I07A 2VVKA 2VXFA 1UJYA 2WACA 5LJ5j 2MWOA 3LWIA 4XTXA 1Q7YC 1IB8A 2HEQA 4LNPA 1PD0A 5GANg 4A4FA 1WX6A 1KFZA 1YNZA 3PIPA 3CCSQ 2LNVA 1ZSGA 5CO7A 2QA4T 2F69A 3LX7A 4RCCA 1Q7YR 1JRIA 2C0IA 5GAOm 4O6JA 5D6WA 2X35A 3X20B 3UA7A 1UECA 2EAYA 2VB6A 3OYJA 5FU6B 3OYNA 3CXCS 1NJIR 3E9FA 4HCKA 2OTJQ 4PJOB 2K5FA 2Z0WA 2LCCA 1VQ6Q 1OULA 3S3MA 1MMAA 1Y96B 2VASA 2GNCA 3GP8A 3KFVA 2VC8A 2CZ1B 2VWFA 2X4WA 4J7IA 2EKOA
chains in the Genus database with same CATH topology
1D3BA 3LH0A 3OBYA 1KHIA 4BY6C 3EFSA 4E7LA 4NOYA 2K57A 4XU2A 2WSFE 2DKGA 3TIWA 3SB2A 4ELZC 1VQ8T 1VQKT 1W4SA 2HNIA 4BB7A 5GMKi 5A2QE 3OYLA 3MEWA 3SWNB 2Y4YA 2YLCA 2JUFA 2EQJA 1IREB 2CKKA 2LTOA 5FROA 4M78E 4L6V5 1ZBXA 3OY9A 2Q18X 1K9MU 1VQPT 2K4YA 2L3RA 3DB3A 4D6WA 4F7UA 4FIBA 1I81A 5CQYA 2XDPA 2EFIA 2PUKB 3G6ET 1U8RA 3OBWA 3BY7A 3CXCA 1R8OB 1WQ7A 2XI9A 1K8AU 1EIFA 5FLXE 4J5YA 3E1SA 4BI8B 1VQOT 1VIEA 4NL3A 2DK3A 2LT1A 2LX9A 3OYAA 3JB9G 1E32A 1FX7A 2DPPB 3FIFA 1YJWA 4KLNA 4RG2A 1WGSA 3MHXA 2LC4A 1G3YA 2CZ6B 2KMTA 2KQWA 4C5HA 4C8QA 1BI3A 2ZPIB 4IUVA 2XICA 1M9SA 3E9GA 3M9QA 4C0GA 3M56A 1KC8C 4FL6A 3A8MB 1N8RC 1VQ4T 2WSEE 1XQHA 3M59A 3QHSA 4OB1B 5CKDA 5M9OA 3G4ST 4IUPA 3BDUA 3VUBA 1VQMT 2O4XB 3VYGA 2IVWA 5CCXA 2L8DA 3HRSA 4RMOA 5CVIA 3QBYA 3OYMA 3RUXA 2ZPFB 4M77A 3FDRA 1IZ6A 3PGGA 5C1BA 4NS5A 2EQMA 4KDIA 4RG8A 3CCVA 4F7UG 2E1HA 2VYTA 5FU7B 3JB9D 1KC8U 5GAOq 1YJ9A 1N8RU 3CC2T 4M7DF 3J80E 1I9GA 4A4HA 4C5EA 2RJCA 4M7DC 3SFMA 2QTXA 5FRNA 2IG0A 2L89A 3CMEA 1M5Q1 2V8JA 2ZPGB 3QXEB 1K73C 3RERA 1YIJA 4ARCA 1WLFA 4KBMB 3OYIA 3A8HB 2EJGA 3VJPA 4M7AD 3ZJTA 5GMKe 4ZN1A 3NTHA 4PJOE 2YUJA 2ZPBB 3ZJUA 3RMQA 1LOJA 3M54A 2MI6A 2LRQA 4M7AB 5GMKh 1KD1C 3JCMV 1M8VA 1QVGS 3VUZA 2DXCA 4C8QG 3CCJT 2E10A 4HT8A 2RM4A 5GANj 4NL2A 1JB0E 3OW2A 3MB5A 3PIOA 4JLIA 4B9WA 5I2MA 5GAMe 5GAN5 3CCLT 1YCYA 3E19A 3TREA 4C92A 3OSSC 5GAMh 3KXTA 1UB4A 4A53A 1VIFA 1BI0A 3UDCA 2EQKA 5LJ3j 2MF2A 3DLMA 4A4KA 2EJFA 2OAUA 3CCUA 4GLKA 1YHQT 3P8DA 4BD3A 2KSSA 3A8LB 1BIAA 2ZPHB 4M77G 3JCMc 3L2VA 1Q82U 2XDBA 3HSBA 1ZQ1A 1CR5A 1KD1U 2X4XA 4LDWA 4M75A 3VV0A 1NZ9A 4OGCA 2QQRA 1QVFA 3OYBA 3H8ZA 1DJ7B 4C8QC 1X01A 1WJSA 3QYHB 3OYHA 4DA4A 3TCJA 5J39A 5C18A 2JZ2A 2PVOB 2CZ0B 2VGMA 4KUIA 4PL6A 3L2QA 2C06A 3QO3A 4ZGJB 2HAXA 2QA4A 2DIQA 2OTLT 4QQDA 2JVVA 4PLIA 4PLLA 5FTKA 4AS1A 2VGNA 3LLRA 1YJNT 3CCET 4J6XA 4MMKA 5KH6A 4M77F 4ZTJA 1VQ7A 3H6ZA 5ERGB 3L2WA 1YI2T 2E6NA 1VQ9A 2QQ9A 2CZ7B 1X75C 3ASKA 2QXFA 4M77C 1OI1A 2PJHB 3LGLA 3QJ6A 2XK0A 1I5LA 2RI3A 1AHJB 3EAEA 2RJEA 4C0DC 3QG1A 5CKEA 3QQ7A 1NPPA 5GMKj 5CCBA 4C92G 2LT4A 4XQ3A 5GAMf 1W2BA 4BE1A 3GPLA 1WNLA 1JBMA 4LD6A 4FM4B 5CK9A 3MP6A 3JCMd 2DZ9A 2GCXA 5FU6C 4PJOF 3UT1A 1U1TA 2FYKA 2X4YA 2P0PA 5HY6A 2DTHA 4PJOC 4LDVA 2DVEA 4E7HA 3GNFB 3L2ZA 1WJRA 2K3XA 1B34B 2RHYA 1PSFA 3EFRA 2JNGA 3MCAB 4M75G 3V7CA 1K8AC 5A0LA 3CPWS 5AYFA 2F5TX 4ME7A 3CBMA 3I55A 1UEBA 4QW2A 2QQBA 2Q1CX 2GQVA 4E7JA 3HU3A 5IN1A 3LGAA 1VQ8A 4C92F 3BDLA 3MP8A 1N9RA 1VQKA 3WVDB 1VQ5T 3AHUA 1UGPB 2RA2A 4M78A 1M4ZA 4JJNK 2F5KA 4C92C 3I56T 4N0AC 4KO8A 1BIBA 1XTDA 3CBPA 3FLGA 5GAMg 3CC7T 2DEQA 1ZC1A 4KODA 5CR2A 2LQKA 4CI0C 3V8LA 4EMKC 1VQPA 3L42A 4TVRA 4M7AE 4BE2A 3JCMe 3OQ5A 4M75F 3QWZA 4FT4A 3OS0A 3OYFA 2KK4A 3G6EA 3CMAT 4AQ7A 4BDYA 3HU2A 4E7IA 5KCHA 3OYCA 4M75C 5J3BA 1KQ1A 3JCMh 3QPHA 3C4SA 3JSCA 1Y7XA 3M4YA 2Q1DX 3MEAA 4J6YA 1VQOA 1YITA 2K5IA 4DOVA 3GNGA 2E70A 2EWNA 5FTNA 3FPTA 3G7ZA 3LGFA 5HK0A 3OB9A 3QJYA 2QEXT 2R5MA 4F7UE 5DLOA 4HCCA 2RD1A 4QQGA 2FHDA 1VQ4A 3FJPA 4LD9K 2RHUA 3GLXA 2R5AA 5KCOA 4LDXA 3WVEB 1M1FA 3G4SA 4V2SA 3OYKA 3BQBA 3JCMX 1NPRA 2LVMA 3BW1A 3M57A 4JRIA 4ZN3A 5GAMd 1VQMA 4OB2B 4N4IA 5DLQE 3P8BB 4M78G 1GXIE 2DXBA 3CCMT 3JB9H 3CCRT 3X26B 3JCMQ 4J7FA 2AHJB 2M0OA 1QW1A 2KY9A 4ATOA 5LJ5h 2BUDA 4WF2A 3CC2A 1WPYA 3HRTA 3HKSA 3OSVA 4JLGA 3CCQA 2DIGA 4XTUA 3JB9J 4M7DD 1R7RA 2VUBA 5D6YA 1CZ4A 2NLUA 3WXMB 3LYIA 1O9SA 4PNOA 1VQNT 3JAME 3CD6T 4PJOA 2YVLA 3JCMf 4GY5A 1N6AA 3GOXA 3MP1A 2B8AA 3M4GA 3NTKA 4KT0E 4C0ZA 3V7SA 1Q82C 4M7DB 5FTLA 3VU3C 4Y91A 5A0GA 1BI1A 2L5QA 1NE8A 1Y96A 3X24B 4BI3A 1D3BB 3CCST 4M78F 2KVQG 1QCSA 4XTWA 3QDRB 3L2RA 2BKDN 2QI2A 4A4EA 4M78C 3CCJA 2MM0A 3QZ5B 3FRNA 2DTOA 3HFOA 2WSCE 2E6ZA 2RK2A 4E7KA 4Y28E 4RKUE 4EMGA 3FC3A 4N0AA 3HRUA 3CBOA 3OMCA 3G71T 3CCLA 2P4TA 3QQ8A 5GAN2 4BE0A 1SSFA 2P0KA 4OB3B 4C0FA 3DLLA 4EMKA 4HA8A 2FB7A 4YTLA 2K5LA 4F7UB 5CCAA 2LCLA 4O5VA 1JJ2S 3SWNA 3V8JA 1YHQA 1Q81C 2PQWA 2V8IA 3M55A 3JCMg 3FEOA 1Y71A 2OTJT 5DY9A 2CYZB 2I2LA 2X4JA 3CPFA 5FRMA 1VQ6T 4Q5WA 3M5AA 3JCMW 1ZHIA 4RV0A 1H641 4OMFB 2CS7A 3DB4A 1V29B 2XIDA 4C8QD 3OS1A 5GLFA 3UWNA 1CZ5A 1M1GA 1Q86C 3GIBA 3QZ9B 5DM7R 3Q1JA 2JOYA 3RKXA 3VYHB 1OYXA 3MEVA 3RIRA 2D0QB 4MZPA 5CKFA 4PJOG 2YRVA 1G3SA 4C8QB 4XTVA 3OYGA 2ZCFB 1X6OA 4B9XA 4ARIA 5CIUA 5GAN8 2DXTA 4MMLA 2OTLA 3QKJA 2RHXA 4EMHA 2E12A 5I2SA 3INZA 1FXXA 2RI5A 5GAOl 2VXEA 1Q81U 3CCEA 1YJNA 1QVGA 2G3RA 2RH2A 1VQLA 1UGSB 4M77D 1NJIC 3LW5E 4QVDA 4CQNA 3T9NA 4A54A 3HFNA 4M77B 2JN0A 2HD0A 2RB6A 4BDZA 5LJ5g 1Q86U 4J6WA 4IKFA 5EPPA 2M9UA 4JDSA 2MAMA 3QC8A 2O4XA 3S6WA 3CF2A 3OYYA 4ELYC 4XU3A 3A8GB 1KQ2A 4HKEA 1Q7YU 4X9CA 3F70A 3QYGB 3JCMb 5GAMj 1QDNA 1JJ2A 2E5QA 1XNIA 1BI2A 2A3LA 2M1HA 1G3TA 3RKWA 1VQ7T 4JS5A 2RJDA 3RKYA 3C94A 4R55A 2XDDA 1NJIU 3GF5A 1Y07A 4J8OA 4MDXA 1P92A 3NFCA 4JRKA 4MZMA 4BY6B 3OYEA 5L8RE 3C12A 3M58A 2B25A 5IAYA 3L2UA 4VUBA 4HCBA 3O8VA 5GANd 1G5VA 1HXDA 4LDUA 3CC4T 4XTYA 5LL6S 1S72T 4M7DG 4EPCA 1BKBA 3HHTB 1N9SA 4XU0A 5EG2A 4XK8E 4C92D 2EQUA 4EDUA 3I56A 4M7DE 3ZGZA 5GAN3 4A4GA 5GMKl 3CC7A 4M7AA 4C92B 4BI4A 2P0QA 4E47A 3SWNC 3ME9A 2BIVA 3I55T 4P5NA 4OF1A 5LJ3d 5LJ5d 1QVPA 2O01E 4QQ6A 1QP2A 4DQ2A 5FTJA 4EMKB 2ZGWA 1KG1A 3CMAA 1I8FA 3MO8A 4M75D 2PU9B 3RESA 3X25B 1WJQA 3A5ZB 2JTFA 5C0MA 4JRPA 2R58A 3VKIA 3SD4A 5IT9E 3DKMA 4IUQA 2DZCA 4M75B 5GMKm 2RO0A 2Q1AX 5GAOn 3UPUA 4PKCC 2XHCA 1G3WA 4L59A 2Q19X 5GAN6 1OZ2A 1MGQA 3HL8A 5GANe 2DTIA 2QEXA 1HK9A 2PUOB 5CKHA 2M16A 3URGA 1RI0A 3CPWA 2K3YA 4C5IA 2LW6A 3PNWC 5GANh 4MDWA 2GFAA 4JRQA 1YJWT 4FSXA 2DAQA 1YITT 4MZTA 2MWPA 4KDLA 2LDMA 3RMSA 2YLBA 2EYQA 5LJ3e 4UC4A 5LJ5e 3PT9A 2PVDB 3META 2E64A 3OMGA 4XTZA 4C8QE 5GAN4 3CCMA 3OW2S 2KDSA 3CCRA 4CRIA 5LJ3h 5CAIA 5GAOp 3FPUA 4M7AG 1M90C 3ZJVA 3OS5A 2EJ9A 3PTAA 4KUDK 2ZZDA 4N4HA 1FWZA 4ZGDB 3OS2A 1WQWA 4X34A 1N27A 3PMTA 4BACA 4J83A 3TU4K 5HK3A 5CQXA 5FTMA 3QUIA 2DXUA 1O54A 5CKBA 3S3NA 3S3OA 4LDYA 4BUGA 3CD6A 1VQNA 5FU7C 4IUTA 4R56A 4RCBA 3JB9F 2A7YA 3CCVT 5DYGA 4M77E 3KUFA 5I21A 1YJ9T 3CCSA 4C5GA 1QVFS 2XD0A 5EQJB 1M1KC 3CCQT 2QQAA 2CGHA 2DD4A 2R57A 4II1A 2XG8D 2JTMA 4M78D 3CMET 1YIJT 1M90U 4M7AF 3FPRA 3LHDA 1B34A 3P8HA 4FU6A 4FT2A 1LNXA 2Y4XA 3MEUA 2H3JA 4M78B 2VV5A 4XU1A 3OYDA 4M7AC 5GANf 2MM2A 3V8KA 3G71A 5A0DA 3JCMJ 4HCZA 3FB9A 4ZTFA 2K2VA 2JV2A 4QVCA 3ZFJA 4JUVA 4IUUA 2PVGB 2RJFA 2DD5A 3PFSA 4OGEA 2FVUA 2ZPEB 4OB0B 3QIIA 5LJ3f 3X28B 3ZEHA 5LJ5f 1KQSS 4F7UF 2OTJA 3PMIA 4DOWA 1M1KU 3QSUA 2E41A 1VQ6A 3CEYA 3C95A 1YBYA 5GAOr 1TH7A 4XAXB 2LQ8A 5KE2A 1W2BS 2XKOC 5HKCA 5CD1A 3L1AA 4C92E 2Y90A 3CCUT 1K73U 2VXFA 4IURA 4JS4A 2RK1A 2WACA 2MWOA 3ZBDA 5LJ5j 3LWIA 4XTXA 3HPWA 1Q7YC 1MHNA 2RHZA 2RI2A 3SDZA 1UGQB 2QQSA 3A8OB 3HU1A 1U1SA 2QDYB 3HP9A 5GANg 2GF7A 2YHTA 1OZ3A 2DJZA 4A4FA 5GAN7 4QVZA 1BYMA 4X9DA 5C6SA 2HQXA 4C8QF 2V8KA 3PIPA 2HQEA 5KE3A 3LWHA 1YI2A 4M75E 2FL7A 3BFMA 1S3SA 2PWYA 3KBGA 1PSEA 4OP0A 2LNVA 3ER0A 2HBPA 2DO3A 4KULA 4OVAA 4HT9A 2E65A 5CO7A 1QP3A 3OA6A 2QA4T 2F69A 3LX7A 5LJ3g 3J81E 4C0DB 1KHCA 4RCCA 1JRIA 5GAOm 3JB9I 5DYIA 2MMPA 3NTIA 4O6JA 5D6WA 1LJOA 1XOVA 2GFUA 2X35A 3R6OA 3X20B 2EAYA 2D6FA 1VUBA 1VQ9T 5D6XA 4PJOD 1VQLT 3OYJA 5FU6B 1UGRB 2D9TA 3OYNA 4ZGEB 3CXCS 3E9FA 2RHIA 3JCMP 4L5GA 4PJOB 2K5FA 1RL2A 1KQSA 3TEEA 2LCCA 2EIFA 2XU8A 3S3MA 1Y96B 2KAFA 3N5BB 5J26A 1H3ZA 1I4K1 3JRZA 3M53A 3GP8A 3V7RA 1K9MC 4N4GA 1VQ5A 4M7DA 5B6CA 4Z02A 1S72A 1O75A 2CZ1B 2VC8A 3CC4A 2X4WA 4J7IA 3J7AF 2EKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWP A;  3LH0 A;  2DIQ A;  2LDM A;  4QQD A;  4E7K A;  4E7L A;  4PLI A;  4PLL A;  4UC4 A;  3FC3 A;  3LLR A;  5KH6 A;  3MET A;  3OMG A;  3OMC A;  4ZTJ A;  3H6Z A;  3L2W A;  4CRI A;  1SSF A;  2P0K A;  3OYL A;  4BE0 A;  2E6N A;  3MEW A;  3ASK A;  1OI1 A;  2CKK A;  2EQJ A;  3LGL A;  2XK0 A;  3QJ6 A;  2LTO A;  4N4H A;  2RI3 A;  3EAE A;  5FRO A;  2RJE A;  3OS2 A;  3OY9 A;  4X34 A;  1N27 A;  2PQW A;  3PMT A;  4BAC A;  3DB3 A;  2L3R A;  3FEO A;  3S3N A;  3S3O A;  4BE1 A;  5FRM A;  4LD6 A;  4IUT A;  2XDP A;  2EFI A;  4Q5W A;  3MP6 A;  3DB4 A;  3UT1 A;  3OS1 A;  3UWN A;  3KUF A;  2X4Y A;  3Q1J A;  4E7H A;  4C5G A;  1OYX A;  3MEV A;  3OYA A;  1WJR A;  2K3X A;  2RHY A;  2YRV A;  4RG2 A;  1WGS A;  3OYG A;  2R57 A;  4II1 A;  4B9X A;  5CIU A;  4C5H A;  4IUV A;  3P8H A;  2RHX A;  3QKJ A;  4QW2 A;  3E9G A;  3M9Q A;  4FU6 A;  2RI5 A;  3MEU A;  4FL6 A;  4E7J A;  5IN1 A;  3OYD A;  2G3R A;  3BDL A;  3MP8 A;  5M9O A;  4HCZ A;  2F5K A;  2BKD N;  4ZTF A;  4IUP A;  3FLG A;  4IUU A;  2O4X B;  2RJF A;  3PFS A;  4BDZ A;  2L8D A;  3L42 A;  4IKF A;  3QII A;  3QBY A;  3ZEH A;  4BE2 A;  3OYM A;  2O4X A;  3OQ5 A;  3S6W A;  3FDR A;  3PMI A;  3OS0 A;  3CEY A;  4NS5 A;  3OYF A;  2EQM A;  4BDY A;  5KE2 A;  4E7I A;  3F70 A;  5KCH A;  3OYC A;  3C4S A;  2E5Q A;  1XNI A;  2VYT A;  4IUR A;  3MEA A;  2WAC A;  2M1H A;  2MWO A;  4A4H A;  4C5E A;  2RJC A;  2RJD A;  1MHN A;  2RHZ A;  2RI2 A;  5FRN A;  2IG0 A;  2L89 A;  2QQS A;  3L2R A;  2GF7 A;  3OYE A;  3OYI A;  1OZ3 A;  4A4F A;  3LGF A;  4QVZ A;  3OB9 A;  5C6S A;  2HQX A;  2R5M A;  2HQE A;  3NTH A;  5IAY A;  5KE3 A;  3L2U A;  4QQG A;  2FHD A;  3O8V A;  1G5V A;  2LRQ A;  2RHU A;  4EDU A;  2R5A A;  4OVA A;  5KCO A;  2EQU A;  3OYK A;  3OA6 A;  3LX7 A;  2LVM A;  4A4G A;  4B9W A;  1KHC A;  4N4I A;  3ME9 A;  2BIV A;  5D6W A;  3NTI A;  2GFU A;  2X35 A;  4QQ6 A;  5D6X A;  2M0O A;  3MO8 A;  2EQK A;  1WJQ A;  3OYJ A;  2BUD A;  2D9T A;  2JTF A;  3OYN A;  3DLM A;  3E9F A;  2R58 A;  2RHI A;  5C0M A;  3P8D A;  3SD4 A;  4BD3 A;  3L2V A;  4IUQ A;  2DIG A;  2LCC A;  2RO0 A;  5D6Y A;  2NLU A;  3LYI A;  2X4X A;  3S3M A;  4GY5 A;  4L59 A;  3GOX A;  3MP1 A;  2B8A A;  3NTK A;  2QQR A;  5J26 A;  1OZ2 A;  1H3Z A;  3OYB A;  3H8Z A;  3OYH A;  1WJS A;  4N4G A;  2M16 A;  1RI0 A;  4Z02 A;  5J39 A;  2K3Y A;  2JZ2 A;  4C5I A;  3L2Q A;  3PNW C;  4PL6 A;  2GFA A;  2X4W A;  2EKO A;  2DAQ A;  4A4E A; 
#chains in the Genus database with same CATH topology
 1ZSZ B;  1D3B A;  3I9Q A;  3LH0 A;  4BY6 C;  3EFS A;  4XU2 A;  4PK4 A;  2DKG A;  3TIW A;  4ELZ C;  2HNI A;  4BB7 A;  5A2Q E;  1M2V A;  3SWN B;  2YLC A;  2JUF A;  1IRE B;  2CKK A;  1GCQ C;  4M78 E;  1OQK A;  3DB3 A;  1G8X A;  1SEM A;  4FIB A;  1I81 A;  5KYU A;  3CXC A;  2HMA A;  2LX9 A;  3H0F A;  4HVU A;  1WGS A;  4F04 B;  4IUV A;  4M7D G;  1KC8 C;  2J05 A;  1NLO C;  2KT1 A;  1TS9 A;  3G4S T;  1OPK A;  1PG5 B;  3E2U A;  2GTJ A;  3SHW A;  2CP6 A;  3EG2 A;  3RUX A;  1IZ6 A;  4NS5 A;  1E7O A;  3CC2 T;  4M7D F;  1YJ9 A;  1M90 R;  1F1B B;  3J80 E;  2SRC A;  2YRC A;  2QTX A;  2DBM A;  3NGP A;  3CME A;  1M5Q 1;  2GQI A;  5GMK e;  2YUJ A;  2DF6 A;  3M54 A;  1WHJ A;  2MI6 A;  5GMK h;  1KD1 C;  1M8V A;  4C8Q G;  4RTX A;  2E10 A;  5ECA A;  3PIO A;  5GAM e;  4B9W A;  1YCY A;  3TRE A;  4C92 A;  2E4H A;  3OSS C;  5GAM h;  4A53 A;  2F2W A;  2GBQ A;  1KIK A;  2MF2 A;  2EJF A;  4ESR A;  3A8L B;  1MMN A;  2NUP A;  1HSQ A;  2ZPH B;  3H0H A;  1RAI B;  4M75 A;  4OGC A;  2QQR A;  3OYH A;  1WJS A;  3LH5 A;  3QYH B;  1RAD B;  5J39 A;  5C18 A;  2PVO B;  3CME Q;  1M8M A;  2ZAE A;  1WFW A;  2NYS A;  3L2W A;  1YI2 T;  1C0M A;  2KGT A;  2QQ9 A;  2JXB A;  4M77 C;  2MYS A;  3ASK A;  5KYX A;  2PJH B;  2SEM A;  2XK0 A;  1I5L A;  1SHF A;  1AHJ B;  3QQ7 A;  1K9A A;  2A0F B;  5CCB A;  3UF4 A;  1IO6 A;  2O2O A;  2J7I A;  1YWP A;  1TWB A;  3MJX A;  2P4R A;  4FM4 B;  4J9G A;  2GCX A;  1X69 A;  3UT1 A;  1U1T A;  8ATC B;  2ROT A;  2DTH A;  2DVE A;  1GBQ A;  2YVL A;  3L2Z A;  1M3B A;  2K3X A;  3MCA B;  2JNG A;  1K8A C;  1UEB A;  3EHR A;  2GQV A;  2EW3 A;  4E7J A;  1ZLM A;  2ENM A;  1VQK A;  3BDL A;  3MP8 A;  1VQ5 T;  1AWW A;  1K9M R;  1M4Z A;  1BIB A;  3FLG A;  1Y0M A;  2DEQ A;  3CC7 T;  3VRY A;  3BE3 A;  3V8L A;  4M7A E;  3JCM e;  1K8A R;  4FT4 A;  2KK4 A;  3G6E A;  3JCM h;  3JSC A;  1Y7X A;  3M4Y A;  1SF9 A;  2NUT A;  4DOV A;  3GNG A;  1U06 A;  1E6G A;  2EPD A;  1G83 A;  3FPT A;  2R5M A;  1VQ4 A;  2FHD A;  4LDX A;  3WVE B;  1TU0 B;  2EYX A;  1NPR A;  3MKD A;  5GAM d;  1VQM A;  4OB2 B;  1VQK Q;  3CCM T;  2ECZ A;  3CCR T;  1QLY A;  2AHJ B;  1VYV A;  2KY9 A;  2BUD A;  1PHT A;  2I0N A;  3HRT A;  3HKS A;  3OSV A;  2QGG A;  4DBR A;  1K1Z A;  3LYI A;  3G6E Q;  1UUE A;  3THK A;  2K3B A;  3GOX A;  5FTL A;  3VS5 A;  2L5Q A;  3EG9 B;  3CCS T;  1D3B B;  2KVQ G;  4J9E A;  4A4E A;  5I11 A;  2AKK A;  2DTO A;  2DMO A;  1M2V B;  4EMG A;  1VQ4 Q;  4N0A A;  1MMG A;  1WYX A;  4JZ3 A;  3OMC A;  3CCL A;  2P4T A;  1TXQ A;  4EMK A;  2MOX A;  2FB7 A;  2LCL A;  1VQM Q;  3V8J A;  4AFU C;  2PQW A;  5KYU B;  2KRN A;  2OTJ T;  5DY9 A;  5FRM A;  1VQ6 T;  1WZO A;  4ANJ A;  5IXB A;  4OMF B;  5GLF A;  1Q86 C;  1JJ2 P;  2L0A A;  3Q1J A;  3VYH B;  1SG5 A;  1OYX A;  4PJO G;  4XTV A;  4J9F A;  1OU8 A;  2RHX A;  5I2S A;  4LUE A;  1FXX A;  1YJN A;  5FWC A;  4M77 D;  3HFN A;  2XMF A;  1WXT A;  2RB6 A;  5LJ5 g;  4IKF A;  2M9U A;  4JDS A;  3QC8 A;  3S6W A;  4ELY C;  3A98 A;  3A8G B;  1Q7Y U;  3F70 A;  2BTT A;  1QDN A;  1D0X A;  3H0I A;  1BI2 A;  2A3L A;  1AZG B;  2RJD A;  3RKY A;  4R55 A;  1NJI U;  2YUP A;  4MDX A;  1QKX A;  3NFC A;  1YN8 A;  3VS0 A;  4HCB A;  1EX4 A;  1U5S A;  4XTY A;  1BKB A;  3HHT B;  1N9S A;  4XU0 A;  4EDU A;  4XK8 E;  3I56 A;  3EGX A;  4M7D E;  3VS1 A;  5GMK l;  4LXC A;  4C92 B;  4BI4 A;  1YJN Q;  2PTK A;  3I55 T;  1NYF A;  1I0C A;  1BK2 A;  2ZGW A;  1I8F A;  2PU9 B;  3X25 B;  3EGU A;  2NUP B;  3A5Z B;  5D7U A;  2R58 A;  2KR3 A;  3EGD A;  3DKM A;  4M75 B;  1Z9Z A;  5GAN 6;  5GAN e;  2L3P A;  2RQU A;  3NHN A;  5GAN h;  5I22 A;  2DAQ A;  1YIT T;  3RMS A;  2DVJ A;  2EYZ A;  4AG2 C;  4UC4 A;  4R0K A;  3MET A;  5KYX B;  2J06 A;  4C8Q E;  5GAN 4;  2HZY A;  4QKU A;  3I56 Q;  3ZJV A;  3OS5 A;  2ZZD A;  4X34 A;  8AT1 B;  2IIM A;  5CKB A;  3S3N A;  3CD6 A;  1VQN A;  4R56 A;  3JB9 F;  4F17 A;  2DJQ A;  3KUF A;  2HKN A;  5I21 A;  1YJ9 T;  4LUD A;  2XD0 A;  1M1K C;  2RQT A;  3CME T;  3FPR A;  2JTM A;  1M90 U;  3TSZ A;  3LHD A;  3P8H A;  1T3L A;  4FU6 A;  1LNX A;  2VV5 A;  2MM2 A;  2QAS A;  3G71 A;  4OMN A;  3I5S A;  1S1N A;  1OX8 A;  2PVG B;  4OGE A;  2ZPE B;  1TOV A;  5LJ5 f;  4F7U F;  4DOW A;  3H41 A;  1GCQ A;  3C95 A;  1W2B S;  5CD1 A;  2NUT B;  1SPK A;  2AK5 A;  2Y90 A;  2DIL A;  5IH2 A;  1B3Q A;  3HPW A;  2RHZ A;  2RI2 A;  3SDZ A;  1VQN Q;  3CD6 Q;  3NPF A;  3HU1 A;  2QDY B;  3HP9 A;  2GF7 A;  2DJZ A;  1WDX A;  5KYN A;  1GXI E;  4X9D A;  2HQX A;  2HQE A;  4IIM A;  5KE3 A;  4KRT A;  1YI2 A;  1QCF A;  1PRM C;  6AT1 B;  3KBG A;  4OP0 A;  4JJB A;  4OVA A;  4KUL A;  2E65 A;  1GL5 A;  2KRS A;  4JJC A;  4C0D B;  3G71 Q;  2MMP A;  4CI0 C;  2LJ0 A;  2D6F A;  1XOV A;  2GFU A;  1NLP C;  1VUB A;  5D6X A;  3EG1 A;  1VQL T;  2QDL A;  1UGR B;  4L5G A;  3TEE A;  1RUW A;  4FW2 A;  2EIF A;  3N5B B;  2L3Q A;  5J26 A;  1UE9 A;  3M53 A;  1M30 A;  2DL4 A;  2FZG B;  4N4G A;  1VQ5 A;  5B6C A;  1S72 A;  1KHI A;  2RQR A;  2K57 A;  1YI2 Q;  2WSF E;  1V1C A;  1VQK T;  4J9C A;  3MEW A;  2NWM A;  4AMC A;  4L6V 5;  1ZBX A;  3OY9 A;  3ULR B;  2Q18 X;  1K9M U;  4F7U A;  4D6W A;  3G6E T;  2K7A A;  3BY7 A;  1K8A U;  3E1S A;  2DK3 A;  1FX7 A;  2JTE A;  3FIF A;  3TSW A;  1PWT A;  2NUZ A;  2LC4 A;  2CZ6 B;  2XIC A;  3E9G A;  3M9Q A;  1VQ5 Q;  1N8R C;  1K0S A;  1VQ4 T;  2KYB A;  1ABO A;  4OMQ A;  5CKD A;  3CC7 Q;  4IUP A;  3TQ7 P;  4EIK A;  1VQM T;  2L8D A;  4DEY A;  4F16 A;  3QBY A;  3OYM A;  1VYT A;  4M77 A;  3FDR A;  2CP7 A;  3O5Z A;  1K76 A;  4F14 A;  2VYT A;  5KYY A;  5HCK A;  5GAO q;  4OMO A;  1I9G A;  4HVW A;  4C5E A;  2C0O A;  1C6V X;  3SFM A;  2IG0 A;  2V8J A;  1K73 C;  1X2K A;  4KBM B;  3VJP A;  4ZN1 A;  1D1A A;  4PJO E;  4GBQ A;  3ZJU A;  3RMQ A;  3EGX B;  4JZ4 A;  1RAF B;  5IXF A;  2OI3 A;  4JLI A;  5I2M A;  2J6O A;  3CCL T;  2KXC A;  3E19 A;  1K73 R;  1UB4 A;  3EGD B;  2E3I A;  3DLM A;  2OAU A;  3P8D A;  2KSS A;  3L2V A;  2XDB A;  1IGQ A;  1ZQ1 A;  2K6D A;  4AFQ C;  2X4X A;  3M0U A;  3VV0 A;  1ABQ A;  1NZ9 A;  3OYB A;  1DJ7 B;  2EYY A;  1TUC A;  4KGV B;  2CZ0 B;  2ROL A;  4KUI A;  2C06 A;  3QO3 A;  2JVV A;  3VS7 A;  1YJN T;  1EFN A;  4ZTJ A;  1VQ7 A;  3H6Z A;  5ERG B;  1VQ9 A;  2CZ7 B;  3LGL A;  2COZ A;  2HSP A;  2RI3 A;  3EAE A;  1PD1 A;  3QG1 A;  1NPP A;  5GMK j;  4C92 G;  2LT4 A;  3GPL A;  1WNL A;  1JBM A;  2DL8 A;  4LD6 A;  1G2B A;  3MP6 A;  4RTW A;  5FU6 C;  4PJO C;  3EG9 A;  3V7C A;  4M75 G;  3CPW S;  2O88 A;  3I55 A;  1VQ8 A;  1FMK A;  4C92 F;  3WVD B;  1ZSZ C;  3I56 T;  1U3O A;  1XTD A;  3CBP A;  1ZC1 A;  2LQK A;  1D09 B;  4HVV A;  4E6R A;  1AT1 B;  1FYN A;  3L42 A;  1VQ7 Q;  3OQ5 A;  1VQ9 Q;  4M75 F;  3OS0 A;  2CUD A;  2KYM A;  5KCH A;  3MEA A;  4J6Y A;  1YIT A;  2MK5 A;  3LGF A;  5HK0 A;  3EH2 A;  2G6F X;  4F7U E;  2CSI A;  2RHU A;  5KCO A;  3M0S A;  1M1F A;  3I55 Q;  3JCM X;  4JRI A;  4ZN3 A;  2X3X D;  4N4I A;  1VQ8 Q;  3VS3 A;  3PVL A;  2EGE A;  1KC8 R;  4J7F A;  1QW1 A;  4ATO A;  5LJ5 h;  4WF2 A;  2VKN A;  4JLG A;  2DIG A;  4XTU A;  4LN2 A;  2NLU A;  3CD6 T;  1VQN T;  4GY5 A;  1N6A A;  1H8K A;  4KT0 E;  2K79 A;  3V7S A;  3VU3 C;  5EC7 A;  4RTY A;  1OU9 A;  1NE8 A;  1YIT Q;  3QDR B;  3L2R A;  4M78 C;  3QZ5 B;  3FRN A;  2FEI A;  2RK2 A;  4E7K A;  1NM7 A;  4RKU E;  3FC3 A;  2DE0 X;  2FPD A;  3CBO A;  1OOT A;  3G71 T;  3QQ8 A;  1SSF A;  2K5L A;  4F7U B;  2W10 A;  5CCA A;  1KD1 R;  1YHQ A;  1Q81 C;  3FEO A;  4AT1 B;  4M4Z A;  2CYZ B;  2X4J A;  2LQN A;  3CPF A;  3M5A A;  2HSE B;  1YJ9 Q;  1ZUY A;  1H64 1;  3DB4 A;  4PJN A;  4ORZ A;  3GIB A;  3VRZ A;  3MEV A;  4DBQ A;  5CKF A;  4PFZ A;  1NG2 A;  2ZCF B;  1BCM A;  5CIU A;  2DXT A;  4MML A;  3QKJ A;  4EMH A;  2E12 A;  3INZ A;  5GAO l;  1NEG A;  3CCE A;  2RH2 A;  1BBZ A;  5FW9 A;  1VQL A;  4CQN A;  2ATC B;  3T9N A;  2OAW A;  4M77 B;  1I5O B;  2JN0 A;  1PC0 A;  2O4X A;  3OYY A;  5KYY B;  4Z8A A;  1KQ2 A;  2KRM A;  2HDA A;  1YHQ Q;  4JS5 A;  1QMC A;  3C94 A;  1Y07 A;  3RBB B;  4JRK A;  1WIE A;  3VS4 A;  4VUB A;  1OV3 A;  1S72 T;  4LDU A;  4FSS A;  2JW4 A;  1RAC B;  4E7Z A;  3CCE Q;  5LJ5 d;  1QVP A;  1VQL Q;  3QWX X;  1QP2 A;  2D1X A;  2JJ9 A;  3CMA A;  4CC3 A;  3RES A;  1SHG A;  2H3E B;  5IT9 E;  4IUQ A;  1WHL A;  1ZBJ A;  2EKH A;  2EYW A;  5GMK m;  1ACM B;  2CSQ A;  4L59 A;  2QEX A;  1HK9 A;  2PUO B;  1KSW A;  2M16 A;  2PZ1 A;  2K3Y A;  4C5I A;  2PNI A;  5IHK A;  3H9N A;  4KDL A;  2LDM A;  4QT7 A;  2YLB A;  2RQV A;  2PVD B;  2E64 A;  3OMG A;  3OW2 S;  2EJ9 A;  4N4H A;  1FWZ A;  1GRI A;  1N27 A;  3TU4 K;  5HK3 A;  5CQX A;  3EG0 A;  4LE9 A;  2KEA A;  3S3O A;  4LDY A;  3PVQ A;  4BUG A;  3CMA Q;  5FU7 C;  1ZA2 B;  2A7Y A;  5DYG A;  4FCY A;  1AVZ C;  1QVF S;  5EQJ B;  3CCQ T;  4M78 D;  2QQA A;  2FPE A;  2R57 A;  3VS6 A;  4M7A C;  3MEU A;  2KBT A;  3JCM J;  2J6F A;  2AZS A;  4ZTF A;  1OX9 A;  1VYU A;  4JUV A;  2DD5 A;  2AIR B;  3M0Q A;  3QII A;  5LJ3 f;  1KQS S;  2DRK A;  1J3T A;  1MUZ A;  2E41 A;  3CEY A;  1SSH A;  1QCN A;  1Z9Q A;  2LQ8 A;  1W70 A;  2JS2 A;  2XKO C;  2B86 A;  3L1A A;  4C92 E;  1K73 U;  4JS4 A;  2RK1 A;  3ZBD A;  2QQS A;  3A8O B;  1U1S A;  1RAH B;  2YHT A;  1OZ3 A;  1BYM A;  4QVZ A;  5C6S A;  1W2B P;  1QCO A;  4M75 E;  3BFM A;  1S3S A;  3EFO A;  1PSE A;  1QWE A;  1WHM A;  3ER0 A;  2DO3 A;  4HT9 A;  2E3H A;  1Q86 R;  1QP3 A;  1EZZ B;  3CCL Q;  2CDT A;  1CKA A;  2O9V A;  3NTI A;  2RMO A;  1VQ7 T;  1OPL A;  1CKB A;  3R6O A;  1JXO A;  1PRL C;  1VQ9 T;  1PKS A;  2D9T A;  4ZGE B;  4RTT A;  3I35 A;  2A36 A;  1KQS A;  1IHW A;  1UDL A;  2QK0 A;  2XU8 A;  2V1Q A;  1WLP B;  1M3A A;  2KAF A;  1H3Z A;  4Z02 A;  2M02 A;  1O75 A;  1JQQ A;  1FMW A;  1RLQ C;  2KT8 A;  3SB2 A;  1VQ8 T;  5GMK i;  3OYL A;  2Y4Y A;  2YUN A;  2EQJ A;  2LTO A;  4PFP A;  2K4Y A;  2L3R A;  3D7S B;  5CQY A;  1IHV A;  2EFI A;  2PUK B;  1U8R A;  3OBW A;  2JT4 A;  1WQ7 A;  1EIF A;  5FLX E;  4PJJ A;  4NL3 A;  3JB9 G;  1E32 A;  3OYA A;  2DPP B;  4RG2 A;  1G3Y A;  3M0T A;  2KMT A;  2YWW A;  4C5H A;  2ZPI B;  1AWO A;  4FYV B;  1M9S A;  4C0G A;  4FL6 A;  3A8M B;  3M59 A;  4OB1 B;  3VUB A;  2O4X B;  5CCX A;  5CVI A;  4KGX B;  2DYB A;  5C1B A;  3AT1 B;  4PJM A;  4F7U G;  2E1H A;  1KC8 U;  2RJC A;  4M7D C;  1YP5 A;  5FRN A;  1R77 A;  2L89 A;  3QXE B;  4KH0 B;  3A8H B;  2EJG A;  4M7A D;  3JV3 A;  3ZJT A;  1WA7 A;  4CC7 A;  3NTH A;  2ZPB B;  1MV0 B;  1LOJ A;  2LRQ A;  3JCM V;  1QVG S;  3VUZ A;  2DXC A;  2RM4 A;  4NL2 A;  1JB0 E;  1M1K R;  5GAN 5;  2QGF B;  1UFF A;  2LNH B;  1VIF A;  3UDC A;  2QYZ A;  5LJ3 j;  1MMD A;  4A4K A;  1D0Y A;  1HJD A;  4GLK A;  1HYO A;  1YHQ T;  4BD3 A;  1BIA A;  4M77 G;  3JCM c;  2YUO A;  1KD1 U;  2L3S A;  3C0C A;  1W6X A;  2BE7 D;  4WTO B;  1GFC A;  3H8Z A;  4C8Q C;  4DA4 A;  1WHK A;  3TCJ A;  1X27 A;  2JZ2 A;  3L2Q A;  2VGM A;  2CP3 A;  4PL6 A;  1GCP A;  1WI7 A;  1OEB A;  1SRM A;  1TUG B;  1T0H A;  4PLI A;  1T0J A;  2D8H A;  5FTK A;  4J9I A;  4AS1 A;  2EQI A;  3CCE T;  1CSK A;  4J6X A;  4MMK A;  4M77 F;  1VA7 A;  1OI1 A;  3QJ6 A;  2DL7 A;  4KH1 B;  4C0D C;  3REA B;  5CKE A;  4E7S A;  5GAM f;  1W2B A;  5FWB A;  4BE1 A;  1AWX A;  5CK9 A;  2DZ9 A;  2A08 A;  2ABL A;  5HY6 A;  4E7H A;  3GNF B;  1PSF A;  2RHY A;  3EFR A;  1JO8 A;  3U23 A;  5A0L A;  4ME7 A;  2BZX A;  3CBM A;  2DA9 A;  2QQB A;  4QW2 A;  3HU3 A;  3REB B;  3LGA A;  2LJ3 A;  2YSQ A;  1UTI A;  4M78 A;  4JJN K;  1NEB A;  4N0A C;  3CPW P;  4KOD A;  5CR2 A;  1BU1 A;  4Z89 A;  4EMK C;  1VQP A;  4TVR A;  4BE2 A;  3CMA T;  4AQ7 A;  3OYF A;  1R0C B;  4E7I A;  2QAZ A;  2FZC B;  1KQ1 A;  1V76 A;  3C4S A;  2Q1D X;  1VQO A;  2FPF A;  2K5I A;  2LJ1 A;  1WXU A;  1H3H A;  2EWN A;  5FTN A;  1S72 Q;  3EFO B;  3OB9 A;  2QEX T;  5DLO A;  4HCC A;  2RD1 A;  3FJP A;  2O31 A;  2LP5 A;  2F2V A;  4D8K A;  4V2S A;  3BQB A;  2LVM A;  2YUQ A;  5DLQ E;  2DXB A;  3JB9 H;  1N8R R;  2M0O A;  2OX7 A;  1WPY A;  1VQP Q;  3CCQ A;  4KGZ B;  4M7D D;  1R7R A;  1YFN A;  1CZ4 A;  3WXM B;  3UAT A;  4PNO A;  3JAM E;  3JCM f;  2BE9 B;  2B8A A;  3M4G A;  3NTK A;  2EVR A;  4C0Z A;  1Q82 C;  2F1L A;  4Y91 A;  5A0G A;  1BI1 A;  1VQO Q;  4OMP A;  4BI3 A;  1QKW A;  1X2Q A;  4XTW A;  2QI2 A;  1MV3 A;  3UA6 A;  3CCJ A;  3HFO A;  2WSC E;  2H8H A;  3HRU A;  1B7T A;  1ARK A;  2DYI A;  1ZA1 B;  2P0K A;  4BE0 A;  3DLL A;  2AT1 B;  4YTL A;  1AEY A;  1Q82 R;  4O5V A;  3EH1 A;  1AD5 A;  1JXM A;  1Y71 A;  2X9H A;  2I2L A;  3JCM W;  2CS7 A;  1V29 B;  2XID A;  4C8Q D;  3OS1 A;  3CCQ Q;  4E2F B;  3QZ9 B;  5DM7 R;  4MZP A;  3OYG A;  4B9X A;  5GAN 8;  2OTL A;  2YT6 A;  1RAA B;  2DFU A;  2VXE A;  1UGS B;  1NJI C;  4D8D A;  4QVD A;  2CT3 A;  3CCJ Q;  4A54 A;  2DLP A;  4CC4 B;  1Q86 U;  2P84 A;  4J6W A;  5EPP A;  2X3W D;  2MIO A;  4X9C A;  3QYG B;  5GAM j;  2M1H A;  5IHI A;  2XDD A;  1UHC A;  4J8O A;  1P92 A;  2COW A;  3OYE A;  4OMM A;  4BY6 B;  1GBR A;  5L8R E;  3C12 A;  2IPO B;  5IAY A;  3O8V A;  1JEG A;  1G5V A;  1HXD A;  1X43 A;  5EG2 A;  2EQU A;  2D0N A;  2OTL Q;  2YRD A;  4M7A A;  4A4G A;  4FYY B;  2P0Q A;  1YCS B;  3ME9 A;  3SWN C;  4OF1 A;  5LJ3 d;  2O01 E;  1R0B G;  4DQ2 A;  5FTJ A;  1KG1 A;  3MO8 A;  4RTU A;  3SD4 A;  2DZC A;  2A37 A;  2W0Z A;  2DBK A;  2DM1 A;  3UPU A;  2XHC A;  2Q19 X;  3HL8 A;  1MGQ A;  3URG A;  3CPW A;  1LVK A;  1D1B A;  4MDW A;  1MNE A;  4FSX A;  4AFZ C;  4MZT A;  1N5Z A;  2EYQ A;  5LJ5 e;  4XTZ A;  1PNJ A;  1BB9 A;  5CAI A;  5GAO p;  3FPU A;  1M90 C;  3PTA A;  1IRX A;  4KUD K;  1C1A A;  4Z88 A;  4ZGD B;  1WQW A;  4J83 A;  5FTM A;  2KRO A;  2DXU A;  3QUI A;  2LMJ A;  3OW2 P;  1E6H A;  4RCB A;  1PKT A;  4J9B A;  4M77 E;  4X1V A;  1RAB B;  1JU5 C;  2CGH A;  4II1 A;  2HCK A;  4B6M A;  1B34 A;  4M78 B;  2H3J A;  4XU1 A;  5GAN f;  1QVF P;  1BCO A;  1D1C A;  2K2V A;  4QVC A;  2HBW A;  3PFS A;  2RQW A;  4OB0 B;  3ZEH A;  3PMI A;  1M1K U;  5GAO r;  3MPU B;  4XAX B;  5HKC A;  1IXD A;  4IUR A;  3EG3 A;  1MHN A;  2GGR A;  1UGQ B;  1Q81 R;  1KQS P;  5GAN 7;  3CF2 A;  3LWH A;  4C8Q F;  2V8K A;  2PWY A;  2FL7 A;  1T3S A;  2HBP A;  2K2M A;  2CUB A;  3OA6 A;  5LJ3 g;  3J81 E;  2QTV A;  1TUD A;  1M3C A;  3NMZ C;  1KHC A;  4PJL A;  3JB9 I;  1LJO A;  3ZL7 C;  2MPX C;  4PJO D;  3GBQ A;  1TG0 A;  2HL5 C;  2RHI A;  3A1P A;  3JCM P;  1D0Z A;  1UGV A;  1RL2 A;  2DL3 A;  1NBE B;  2FO0 A;  1I4K 1;  3JRZ A;  3V7R A;  1K9M C;  2FRY A;  1UHF A;  4M7D A;  3SEM A;  3CC4 A;  1PM3 A;  3J7A F;  1B07 A;  3OBY A;  2DL5 A;  4E7L A;  4NOY A;  2BZ8 A;  1W4S A;  1ZUK A;  9ATC B;  1HD3 A;  5FRO A;  1VQP T;  2C0T A;  2M0Y A;  2XDP A;  1R8O B;  2XI9 A;  4J5Y A;  4BI8 B;  1VQO T;  1VIE A;  2LT1 A;  4KLN A;  1YJW A;  3MHX A;  2KQW A;  2M51 A;  1BI3 A;  4C8Q A;  3M56 A;  5IHN A;  2WSE E;  1XQH A;  3CC4 Q;  3QHS A;  2LX7 A;  3EHQ A;  1W1F A;  5M9O A;  1MND A;  2JM8 A;  3BDU A;  1TTH B;  3VYG A;  2IVW A;  4RMO A;  3HRS A;  2ZPF B;  3PGG A;  1RAE B;  2EQM A;  4KDI A;  2AZV A;  4RG8 A;  3CCV A;  3JB9 D;  5FU7 B;  1N8R U;  4A4H A;  2QEX Q;  1X6B A;  2ZPG B;  3RER A;  4ARC A;  1YIJ A;  1WLF A;  4JJD A;  3OYI A;  2J6K A;  3QDF A;  4J9D A;  1Y57 A;  7AT1 B;  1YJW Q;  4M7A B;  1K4U S;  1SRL A;  3CCJ T;  2CRE A;  4HT8 A;  1QWF A;  2JM9 A;  5GAN j;  3OW2 A;  3MB5 A;  3KXT A;  1BI0 A;  1QVG P;  2EQK A;  3CCU A;  1GFD A;  1Q82 U;  3HSB A;  1CR5 A;  4LDW A;  3CCV Q;  1QVF A;  1X01 A;  1LPL A;  2FZK B;  4J9H A;  1WHH A;  2JS0 A;  4ZGJ B;  1YIJ Q;  2HAX A;  2QA4 A;  2JMA A;  2DIQ A;  2OTL T;  1AWJ A;  4QQD A;  4PLL A;  1XJW B;  2VGN A;  3LLR A;  5KH6 A;  2HQH A;  2E6N A;  1X75 C;  2QXF A;  2DET A;  2RJE A;  2EGC A;  4XQ3 A;  3JCM d;  4PJO F;  3CCU Q;  2FYK A;  2X4Y A;  3PE0 A;  2P0P A;  4LDV A;  1WJR A;  1B34 B;  2CH4 A;  5AYF A;  5KYW A;  1RLP C;  1ZX6 A;  2F5T X;  2Q1C X;  3RR6 A;  3CQT A;  1NYG A;  5IN1 A;  4ZNX A;  3AHU A;  4A63 B;  1N9R A;  1UGP B;  2RA2 A;  2F5K A;  4C92 C;  2QA4 Q;  4KO8 A;  5GAM g;  2DRM A;  4GLM A;  2BZY A;  3QWZ A;  5GJV B;  4BDY A;  3HU2 A;  2RF0 A;  3OYC A;  4M75 C;  5J3B A;  3G1J A;  3QPH A;  4OML A;  2E70 A;  1A0N B;  2KI7 A;  3G7Z A;  3QJY A;  4LD9 K;  4QQG A;  4AG1 C;  2FG0 A;  2FRW A;  2R5A A;  3GLX A;  1UJ0 A;  1I1J A;  3G4S A;  3OYK A;  2D8J A;  3BW1 A;  3M57 A;  3P8B B;  4M78 G;  4WCI A;  2DEU A;  2YDL A;  3X26 B;  3JCM Q;  4DBF A;  4DBH A;  1M27 C;  3QWY A;  3CC2 A;  2DER A;  2ESW A;  1WXB A;  2RNA A;  3JB9 J;  2VUB A;  5D6Y A;  2KE9 A;  1O9S A;  5AT1 B;  4PJO A;  2CP5 A;  4CC2 A;  2JMC A;  3MP1 A;  3TVT A;  4M7D B;  1Y96 A;  3X24 B;  2HKQ B;  1QCS A;  1RAG B;  4M78 F;  2BKD N;  2CP2 A;  2MM0 A;  2KXD A;  2E6Z A;  2RN8 A;  4Y28 E;  1WHG A;  1ZSZ A;  4AFS C;  5GAN 2;  3IQL A;  4C0F A;  4OB3 B;  3G4S Q;  4HA8 A;  4K11 A;  2DX1 A;  2GTO A;  1JJ2 S;  3SWN A;  3M55 A;  2V8I A;  3JCM g;  2COY A;  4Q5W A;  1ZHI A;  4RV0 A;  5GJW B;  3CC2 Q;  1CZ5 A;  3UWN A;  1M1G A;  3RKX A;  2JOY A;  3RIR A;  2D0Q B;  4C8Q B;  2YRV A;  1G3S A;  1X6O A;  4ARI A;  2RI5 A;  1Q81 U;  1QVG A;  2G3R A;  1LCK A;  2EBP A;  3LW5 E;  2OJ2 A;  1UG1 A;  3RDV A;  2AKL A;  2HD0 A;  4BDZ A;  1QQJ A;  2LQW A;  2MAM A;  1H92 A;  1KK7 A;  4DEX A;  1AZE A;  4XU3 A;  1SKU B;  1K0X A;  4HKE A;  3JCM b;  1JJ2 A;  2E5Q A;  1XNI A;  4IIO A;  2CT4 A;  1ZUU A;  2CP0 A;  1G3T A;  1YWO A;  2HL3 A;  3RKW A;  4PFO A;  3GF5 A;  2RPN A;  4MZM A;  2A28 A;  1KJW A;  3M58 A;  2B25 A;  3FJ5 A;  3L2U A;  5GAN d;  3CC4 T;  5LL6 S;  2K9G A;  2ED1 A;  4EPC A;  3CXC P;  4C92 D;  3R6N A;  1AOJ A;  3ZGZ A;  5GAN 3;  3CC7 A;  2O9S A;  4E47 A;  1Q95 G;  1RI9 A;  2BIV A;  4P5N A;  1VOM A;  4QQ6 A;  4EMK B;  2V1R A;  1IGU A;  2X51 A;  4M75 D;  1WJQ A;  2JTF A;  4RTV A;  1X6G A;  5C0M A;  4JRP A;  3VKI A;  2YXY A;  2RO0 A;  2LZ6 B;  5GAO n;  2Q1A X;  4FW1 A;  1TSF A;  4PKC C;  3RNJ A;  1G3W A;  1OZ2 A;  2DTI A;  2KNB B;  1M2O A;  5CKH A;  2LCS A;  1RI0 A;  2LW6 A;  3PNW C;  2L2P A;  4JRQ A;  2GFA A;  1YJW T;  2MWP A;  5LJ3 e;  3PT9 A;  4FYW B;  4HXJ A;  2QG9 B;  5DYI A;  3CCM A;  2KDS A;  3CCR A;  4CRI A;  5LJ3 h;  3VS2 A;  2DNU A;  4M7A G;  1PCX A;  4JPB W;  3OS2 A;  3PMT A;  4BAC A;  3HTR A;  1O54 A;  4IUT A;  4RUG A;  4FYX B;  3M0R A;  2E5K A;  3CCV T;  4RTZ A;  3CCS A;  2F2X A;  5KYW B;  4C5G A;  2DD4 A;  2XG8 D;  4M7A F;  1YIJ T;  4FT2 A;  3I5R A;  2Y4X A;  2CH4 W;  3OYD A;  3V8K A;  5A0D A;  1FMV A;  5L23 A;  4HCZ A;  3FB9 A;  4Y92 A;  2JV2 A;  3ZFJ A;  4IUU A;  2MCN A;  2RJF A;  2FVU A;  3CCM Q;  2OTJ A;  3X28 B;  3CCR Q;  2EGA A;  3QSU A;  1VQ6 A;  2ED0 A;  1YBY A;  1TH7 A;  5KE2 A;  3M0P A;  3CCU T;  2V26 A;  1I07 A;  2VVK A;  2VXF A;  1UJY A;  2WAC A;  5LJ5 j;  2MWO A;  3LWI A;  4XTX A;  1Q7Y C;  1IB8 A;  2HEQ A;  4LNP A;  1PD0 A;  5GAN g;  4A4F A;  1WX6 A;  1KFZ A;  1YNZ A;  3PIP A;  3CCS Q;  2LNV A;  1ZSG A;  5CO7 A;  2QA4 T;  2F69 A;  3LX7 A;  4RCC A;  1Q7Y R;  1JRI A;  2C0I A;  5GAO m;  4O6J A;  5D6W A;  2X35 A;  3X20 B;  3UA7 A;  1UEC A;  2EAY A;  2VB6 A;  3OYJ A;  5FU6 B;  3OYN A;  3CXC S;  1NJI R;  3E9F A;  4HCK A;  2OTJ Q;  4PJO B;  2K5F A;  2Z0W A;  2LCC A;  1VQ6 Q;  1OUL A;  3S3M A;  1MMA A;  1Y96 B;  2VAS A;  2GNC A;  3GP8 A;  3KFV A;  2VC8 A;  2CZ1 B;  2VWF A;  2X4W A;  4J7I A;  2EKO A; 
#chains in the Genus database with same CATH homology
 1D3B A;  3LH0 A;  3OBY A;  1KHI A;  4BY6 C;  3EFS A;  4E7L A;  4NOY A;  2K57 A;  4XU2 A;  2WSF E;  2DKG A;  3TIW A;  3SB2 A;  4ELZ C;  1VQ8 T;  1VQK T;  1W4S A;  2HNI A;  4BB7 A;  5GMK i;  5A2Q E;  3OYL A;  3MEW A;  3SWN B;  2Y4Y A;  2YLC A;  2JUF A;  2EQJ A;  1IRE B;  2CKK A;  2LTO A;  5FRO A;  4M78 E;  4L6V 5;  1ZBX A;  3OY9 A;  2Q18 X;  1K9M U;  1VQP T;  2K4Y A;  2L3R A;  3DB3 A;  4D6W A;  4F7U A;  4FIB A;  1I81 A;  5CQY A;  2XDP A;  2EFI A;  2PUK B;  3G6E T;  1U8R A;  3OBW A;  3BY7 A;  3CXC A;  1R8O B;  1WQ7 A;  2XI9 A;  1K8A U;  1EIF A;  5FLX E;  4J5Y A;  3E1S A;  4BI8 B;  1VQO T;  1VIE A;  4NL3 A;  2DK3 A;  2LT1 A;  2LX9 A;  3OYA A;  3JB9 G;  1E32 A;  1FX7 A;  2DPP B;  3FIF A;  1YJW A;  4KLN A;  4RG2 A;  1WGS A;  3MHX A;  2LC4 A;  1G3Y A;  2CZ6 B;  2KMT A;  2KQW A;  4C5H A;  4C8Q A;  1BI3 A;  2ZPI B;  4IUV A;  2XIC A;  1M9S A;  3E9G A;  3M9Q A;  4C0G A;  3M56 A;  1KC8 C;  4FL6 A;  3A8M B;  1N8R C;  1VQ4 T;  2WSE E;  1XQH A;  3M59 A;  3QHS A;  4OB1 B;  5CKD A;  5M9O A;  3G4S T;  4IUP A;  3BDU A;  3VUB A;  1VQM T;  2O4X B;  3VYG A;  2IVW A;  5CCX A;  2L8D A;  3HRS A;  4RMO A;  5CVI A;  3QBY A;  3OYM A;  3RUX A;  2ZPF B;  4M77 A;  3FDR A;  1IZ6 A;  3PGG A;  5C1B A;  4NS5 A;  2EQM A;  4KDI A;  4RG8 A;  3CCV A;  4F7U G;  2E1H A;  2VYT A;  5FU7 B;  3JB9 D;  1KC8 U;  5GAO q;  1YJ9 A;  1N8R U;  3CC2 T;  4M7D F;  3J80 E;  1I9G A;  4A4H A;  4C5E A;  2RJC A;  4M7D C;  3SFM A;  2QTX A;  5FRN A;  2IG0 A;  2L89 A;  3CME A;  1M5Q 1;  2V8J A;  2ZPG B;  3QXE B;  1K73 C;  3RER A;  1YIJ A;  4ARC A;  1WLF A;  4KBM B;  3OYI A;  3A8H B;  2EJG A;  3VJP A;  4M7A D;  3ZJT A;  5GMK e;  4ZN1 A;  3NTH A;  4PJO E;  2YUJ A;  2ZPB B;  3ZJU A;  3RMQ A;  1LOJ A;  3M54 A;  2MI6 A;  2LRQ A;  4M7A B;  5GMK h;  1KD1 C;  3JCM V;  1M8V A;  1QVG S;  3VUZ A;  2DXC A;  4C8Q G;  3CCJ T;  2E10 A;  4HT8 A;  2RM4 A;  5GAN j;  4NL2 A;  1JB0 E;  3OW2 A;  3MB5 A;  3PIO A;  4JLI A;  4B9W A;  5I2M A;  5GAM e;  5GAN 5;  3CCL T;  1YCY A;  3E19 A;  3TRE A;  4C92 A;  3OSS C;  5GAM h;  3KXT A;  1UB4 A;  4A53 A;  1VIF A;  1BI0 A;  3UDC A;  2EQK A;  5LJ3 j;  2MF2 A;  3DLM A;  4A4K A;  2EJF A;  2OAU A;  3CCU A;  4GLK A;  1YHQ T;  3P8D A;  4BD3 A;  2KSS A;  3A8L B;  1BIA A;  2ZPH B;  4M77 G;  3JCM c;  3L2V A;  1Q82 U;  2XDB A;  3HSB A;  1ZQ1 A;  1CR5 A;  1KD1 U;  2X4X A;  4LDW A;  4M75 A;  3VV0 A;  1NZ9 A;  4OGC A;  2QQR A;  1QVF A;  3OYB A;  3H8Z A;  1DJ7 B;  4C8Q C;  1X01 A;  1WJS A;  3QYH B;  3OYH A;  4DA4 A;  3TCJ A;  5J39 A;  5C18 A;  2JZ2 A;  2PVO B;  2CZ0 B;  2VGM A;  4KUI A;  4PL6 A;  3L2Q A;  2C06 A;  3QO3 A;  4ZGJ B;  2HAX A;  2QA4 A;  2DIQ A;  2OTL T;  4QQD A;  2JVV A;  4PLI A;  4PLL A;  5FTK A;  4AS1 A;  2VGN A;  3LLR A;  1YJN T;  3CCE T;  4J6X A;  4MMK A;  5KH6 A;  4M77 F;  4ZTJ A;  1VQ7 A;  3H6Z A;  5ERG B;  3L2W A;  1YI2 T;  2E6N A;  1VQ9 A;  2QQ9 A;  2CZ7 B;  1X75 C;  3ASK A;  2QXF A;  4M77 C;  1OI1 A;  2PJH B;  3LGL A;  3QJ6 A;  2XK0 A;  1I5L A;  2RI3 A;  1AHJ B;  3EAE A;  2RJE A;  4C0D C;  3QG1 A;  5CKE A;  3QQ7 A;  1NPP A;  5GMK j;  5CCB A;  4C92 G;  2LT4 A;  4XQ3 A;  5GAM f;  1W2B A;  4BE1 A;  3GPL A;  1WNL A;  1JBM A;  4LD6 A;  4FM4 B;  5CK9 A;  3MP6 A;  3JCM d;  2DZ9 A;  2GCX A;  5FU6 C;  4PJO F;  3UT1 A;  1U1T A;  2FYK A;  2X4Y A;  2P0P A;  5HY6 A;  2DTH A;  4PJO C;  4LDV A;  2DVE A;  4E7H A;  3GNF B;  3L2Z A;  1WJR A;  2K3X A;  1B34 B;  2RHY A;  1PSF A;  3EFR A;  2JNG A;  3MCA B;  4M75 G;  3V7C A;  1K8A C;  5A0L A;  3CPW S;  5AYF A;  2F5T X;  4ME7 A;  3CBM A;  3I55 A;  1UEB A;  4QW2 A;  2QQB A;  2Q1C X;  2GQV A;  4E7J A;  3HU3 A;  5IN1 A;  3LGA A;  1VQ8 A;  4C92 F;  3BDL A;  3MP8 A;  1N9R A;  1VQK A;  3WVD B;  1VQ5 T;  3AHU A;  1UGP B;  2RA2 A;  4M78 A;  1M4Z A;  4JJN K;  2F5K A;  4C92 C;  3I56 T;  4N0A C;  4KO8 A;  1BIB A;  1XTD A;  3CBP A;  3FLG A;  5GAM g;  3CC7 T;  2DEQ A;  1ZC1 A;  4KOD A;  5CR2 A;  2LQK A;  4CI0 C;  3V8L A;  4EMK C;  1VQP A;  3L42 A;  4TVR A;  4M7A E;  4BE2 A;  3JCM e;  3OQ5 A;  4M75 F;  3QWZ A;  4FT4 A;  3OS0 A;  3OYF A;  2KK4 A;  3G6E A;  3CMA T;  4AQ7 A;  4BDY A;  3HU2 A;  4E7I A;  5KCH A;  3OYC A;  4M75 C;  5J3B A;  1KQ1 A;  3JCM h;  3QPH A;  3C4S A;  3JSC A;  1Y7X A;  3M4Y A;  2Q1D X;  3MEA A;  4J6Y A;  1VQO A;  1YIT A;  2K5I A;  4DOV A;  3GNG A;  2E70 A;  2EWN A;  5FTN A;  3FPT A;  3G7Z A;  3LGF A;  5HK0 A;  3OB9 A;  3QJY A;  2QEX T;  2R5M A;  4F7U E;  5DLO A;  4HCC A;  2RD1 A;  4QQG A;  2FHD A;  1VQ4 A;  3FJP A;  4LD9 K;  2RHU A;  3GLX A;  2R5A A;  5KCO A;  4LDX A;  3WVE B;  1M1F A;  3G4S A;  4V2S A;  3OYK A;  3BQB A;  3JCM X;  1NPR A;  2LVM A;  3BW1 A;  3M57 A;  4JRI A;  4ZN3 A;  5GAM d;  1VQM A;  4OB2 B;  4N4I A;  5DLQ E;  3P8B B;  4M78 G;  1GXI E;  2DXB A;  3CCM T;  3JB9 H;  3CCR T;  3X26 B;  3JCM Q;  4J7F A;  2AHJ B;  2M0O A;  1QW1 A;  2KY9 A;  4ATO A;  5LJ5 h;  2BUD A;  4WF2 A;  3CC2 A;  1WPY A;  3HRT A;  3HKS A;  3OSV A;  4JLG A;  3CCQ A;  2DIG A;  4XTU A;  3JB9 J;  4M7D D;  1R7R A;  2VUB A;  5D6Y A;  1CZ4 A;  2NLU A;  3WXM B;  3LYI A;  1O9S A;  4PNO A;  1VQN T;  3JAM E;  3CD6 T;  4PJO A;  2YVL A;  3JCM f;  4GY5 A;  1N6A A;  3GOX A;  3MP1 A;  2B8A A;  3M4G A;  3NTK A;  4KT0 E;  4C0Z A;  3V7S A;  1Q82 C;  4M7D B;  5FTL A;  3VU3 C;  4Y91 A;  5A0G A;  1BI1 A;  2L5Q A;  1NE8 A;  1Y96 A;  3X24 B;  4BI3 A;  1D3B B;  3CCS T;  4M78 F;  2KVQ G;  1QCS A;  4XTW A;  3QDR B;  3L2R A;  2BKD N;  2QI2 A;  4A4E A;  4M78 C;  3CCJ A;  2MM0 A;  3QZ5 B;  3FRN A;  2DTO A;  3HFO A;  2WSC E;  2E6Z A;  2RK2 A;  4E7K A;  4Y28 E;  4RKU E;  4EMG A;  3FC3 A;  4N0A A;  3HRU A;  3CBO A;  3OMC A;  3G71 T;  3CCL A;  2P4T A;  3QQ8 A;  5GAN 2;  4BE0 A;  1SSF A;  2P0K A;  4OB3 B;  4C0F A;  3DLL A;  4EMK A;  4HA8 A;  2FB7 A;  4YTL A;  2K5L A;  4F7U B;  5CCA A;  2LCL A;  4O5V A;  1JJ2 S;  3SWN A;  3V8J A;  1YHQ A;  1Q81 C;  2PQW A;  2V8I A;  3M55 A;  3JCM g;  3FEO A;  1Y71 A;  2OTJ T;  5DY9 A;  2CYZ B;  2I2L A;  2X4J A;  3CPF A;  5FRM A;  1VQ6 T;  4Q5W A;  3M5A A;  3JCM W;  1ZHI A;  4RV0 A;  1H64 1;  4OMF B;  2CS7 A;  3DB4 A;  1V29 B;  2XID A;  4C8Q D;  3OS1 A;  5GLF A;  3UWN A;  1CZ5 A;  1M1G A;  1Q86 C;  3GIB A;  3QZ9 B;  5DM7 R;  3Q1J A;  2JOY A;  3RKX A;  3VYH B;  1OYX A;  3MEV A;  3RIR A;  2D0Q B;  4MZP A;  5CKF A;  4PJO G;  2YRV A;  1G3S A;  4C8Q B;  4XTV A;  3OYG A;  2ZCF B;  1X6O A;  4B9X A;  4ARI A;  5CIU A;  5GAN 8;  2DXT A;  4MML A;  2OTL A;  3QKJ A;  2RHX A;  4EMH A;  2E12 A;  5I2S A;  3INZ A;  1FXX A;  2RI5 A;  5GAO l;  2VXE A;  1Q81 U;  3CCE A;  1YJN A;  1QVG A;  2G3R A;  2RH2 A;  1VQL A;  1UGS B;  4M77 D;  1NJI C;  3LW5 E;  4QVD A;  4CQN A;  3T9N A;  4A54 A;  3HFN A;  4M77 B;  2JN0 A;  2HD0 A;  2RB6 A;  4BDZ A;  5LJ5 g;  1Q86 U;  4J6W A;  4IKF A;  5EPP A;  2M9U A;  4JDS A;  2MAM A;  3QC8 A;  2O4X A;  3S6W A;  3CF2 A;  3OYY A;  4ELY C;  4XU3 A;  3A8G B;  1KQ2 A;  4HKE A;  1Q7Y U;  4X9C A;  3F70 A;  3QYG B;  3JCM b;  5GAM j;  1QDN A;  1JJ2 A;  2E5Q A;  1XNI A;  1BI2 A;  2A3L A;  2M1H A;  1G3T A;  3RKW A;  1VQ7 T;  4JS5 A;  2RJD A;  3RKY A;  3C94 A;  4R55 A;  2XDD A;  1NJI U;  3GF5 A;  1Y07 A;  4J8O A;  4MDX A;  1P92 A;  3NFC A;  4JRK A;  4MZM A;  4BY6 B;  3OYE A;  5L8R E;  3C12 A;  3M58 A;  2B25 A;  5IAY A;  3L2U A;  4VUB A;  4HCB A;  3O8V A;  5GAN d;  1G5V A;  1HXD A;  4LDU A;  3CC4 T;  4XTY A;  5LL6 S;  1S72 T;  4M7D G;  4EPC A;  1BKB A;  3HHT B;  1N9S A;  4XU0 A;  5EG2 A;  4XK8 E;  4C92 D;  2EQU A;  4EDU A;  3I56 A;  4M7D E;  3ZGZ A;  5GAN 3;  4A4G A;  5GMK l;  3CC7 A;  4M7A A;  4C92 B;  4BI4 A;  2P0Q A;  4E47 A;  3SWN C;  3ME9 A;  2BIV A;  3I55 T;  4P5N A;  4OF1 A;  5LJ3 d;  5LJ5 d;  1QVP A;  2O01 E;  4QQ6 A;  1QP2 A;  4DQ2 A;  5FTJ A;  4EMK B;  2ZGW A;  1KG1 A;  3CMA A;  1I8F A;  3MO8 A;  4M75 D;  2PU9 B;  3RES A;  3X25 B;  1WJQ A;  3A5Z B;  2JTF A;  5C0M A;  4JRP A;  2R58 A;  3VKI A;  3SD4 A;  5IT9 E;  3DKM A;  4IUQ A;  2DZC A;  4M75 B;  5GMK m;  2RO0 A;  2Q1A X;  5GAO n;  3UPU A;  4PKC C;  2XHC A;  1G3W A;  4L59 A;  2Q19 X;  5GAN 6;  1OZ2 A;  1MGQ A;  3HL8 A;  5GAN e;  2DTI A;  2QEX A;  1HK9 A;  2PUO B;  5CKH A;  2M16 A;  3URG A;  1RI0 A;  3CPW A;  2K3Y A;  4C5I A;  2LW6 A;  3PNW C;  5GAN h;  4MDW A;  2GFA A;  4JRQ A;  1YJW T;  4FSX A;  2DAQ A;  1YIT T;  4MZT A;  2MWP A;  4KDL A;  2LDM A;  3RMS A;  2YLB A;  2EYQ A;  5LJ3 e;  4UC4 A;  5LJ5 e;  3PT9 A;  2PVD B;  3MET A;  2E64 A;  3OMG A;  4XTZ A;  4C8Q E;  5GAN 4;  3CCM A;  3OW2 S;  2KDS A;  3CCR A;  4CRI A;  5LJ3 h;  5CAI A;  5GAO p;  3FPU A;  4M7A G;  1M90 C;  3ZJV A;  3OS5 A;  2EJ9 A;  3PTA A;  4KUD K;  2ZZD A;  4N4H A;  1FWZ A;  4ZGD B;  3OS2 A;  1WQW A;  4X34 A;  1N27 A;  3PMT A;  4BAC A;  4J83 A;  3TU4 K;  5HK3 A;  5CQX A;  5FTM A;  3QUI A;  2DXU A;  1O54 A;  5CKB A;  3S3N A;  3S3O A;  4LDY A;  4BUG A;  3CD6 A;  1VQN A;  5FU7 C;  4IUT A;  4R56 A;  4RCB A;  3JB9 F;  2A7Y A;  3CCV T;  5DYG A;  4M77 E;  3KUF A;  5I21 A;  1YJ9 T;  3CCS A;  4C5G A;  1QVF S;  2XD0 A;  5EQJ B;  1M1K C;  3CCQ T;  2QQA A;  2CGH A;  2DD4 A;  2R57 A;  4II1 A;  2XG8 D;  2JTM A;  4M78 D;  3CME T;  1YIJ T;  1M90 U;  4M7A F;  3FPR A;  3LHD A;  1B34 A;  3P8H A;  4FU6 A;  4FT2 A;  1LNX A;  2Y4X A;  3MEU A;  2H3J A;  4M78 B;  2VV5 A;  4XU1 A;  3OYD A;  4M7A C;  5GAN f;  2MM2 A;  3V8K A;  3G71 A;  5A0D A;  3JCM J;  4HCZ A;  3FB9 A;  4ZTF A;  2K2V A;  2JV2 A;  4QVC A;  3ZFJ A;  4JUV A;  4IUU A;  2PVG B;  2RJF A;  2DD5 A;  3PFS A;  4OGE A;  2FVU A;  2ZPE B;  4OB0 B;  3QII A;  5LJ3 f;  3X28 B;  3ZEH A;  5LJ5 f;  1KQS S;  4F7U F;  2OTJ A;  3PMI A;  4DOW A;  1M1K U;  3QSU A;  2E41 A;  1VQ6 A;  3CEY A;  3C95 A;  1YBY A;  5GAO r;  1TH7 A;  4XAX B;  2LQ8 A;  5KE2 A;  1W2B S;  2XKO C;  5HKC A;  5CD1 A;  3L1A A;  4C92 E;  2Y90 A;  3CCU T;  1K73 U;  2VXF A;  4IUR A;  4JS4 A;  2RK1 A;  2WAC A;  2MWO A;  3ZBD A;  5LJ5 j;  3LWI A;  4XTX A;  3HPW A;  1Q7Y C;  1MHN A;  2RHZ A;  2RI2 A;  3SDZ A;  1UGQ B;  2QQS A;  3A8O B;  3HU1 A;  1U1S A;  2QDY B;  3HP9 A;  5GAN g;  2GF7 A;  2YHT A;  1OZ3 A;  2DJZ A;  4A4F A;  5GAN 7;  4QVZ A;  1BYM A;  4X9D A;  5C6S A;  2HQX A;  4C8Q F;  2V8K A;  3PIP A;  2HQE A;  5KE3 A;  3LWH A;  1YI2 A;  4M75 E;  2FL7 A;  3BFM A;  1S3S A;  2PWY A;  3KBG A;  1PSE A;  4OP0 A;  2LNV A;  3ER0 A;  2HBP A;  2DO3 A;  4KUL A;  4OVA A;  4HT9 A;  2E65 A;  5CO7 A;  1QP3 A;  3OA6 A;  2QA4 T;  2F69 A;  3LX7 A;  5LJ3 g;  3J81 E;  4C0D B;  1KHC A;  4RCC A;  1JRI A;  5GAO m;  3JB9 I;  5DYI A;  2MMP A;  3NTI A;  4O6J A;  5D6W A;  1LJO A;  1XOV A;  2GFU A;  2X35 A;  3R6O A;  3X20 B;  2EAY A;  2D6F A;  1VUB A;  1VQ9 T;  5D6X A;  4PJO D;  1VQL T;  3OYJ A;  5FU6 B;  1UGR B;  2D9T A;  3OYN A;  4ZGE B;  3CXC S;  3E9F A;  2RHI A;  3JCM P;  4L5G A;  4PJO B;  2K5F A;  1RL2 A;  1KQS A;  3TEE A;  2LCC A;  2EIF A;  2XU8 A;  3S3M A;  1Y96 B;  2KAF A;  3N5B B;  5J26 A;  1H3Z A;  1I4K 1;  3JRZ A;  3M53 A;  3GP8 A;  3V7R A;  1K9M C;  4N4G A;  1VQ5 A;  4M7D A;  5B6C A;  4Z02 A;  1S72 A;  1O75 A;  2CZ1 B;  2VC8 A;  3CC4 A;  2X4W A;  4J7I A;  3J7A F;  2EKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...