5EPPA

Structural insights into the interaction of p97 n-terminus domain and vbm motif in rhomboid protease, rhbdl4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural insights into the interaction of p97 N-terminus domain and VBM in rhomboid protease, RHBDL4.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5eppA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5eppA02
2VPYA 1TWCA 3GTJA 2JV2A 4KDLA 3GTQA 1R7RA 1E5VA 1G8KA 1TWHA 2E2HA 3IR5A 1ZC1A 1FDOA 5T5ID 2YU9A 1Y1WA 1UHEA 5FTJA 4AYBA 3GTKA 3TM7B 1Q16A 1H0HA 4KDIA 1CZ5A 2IV2X 2E2IA 1PYQA 4AONB 1YLEA 3DMRA 3GTLA 2Y0SA 3CF2A 3O5AA 5FTLA 1PQFA 3IR6A 1K83A 1PQEA 3GTGA 1KQFA 3GTOA 2VPWA 3QWZA 5FTMA 4QIWA 2V45A 5FTNA 3ML1A 2VPXA 1R27A 3QC8A 2WAQA 4KODA 4C2MA 4D7ZB 1E60A 1Y4ZA 1TWFA 3HU3A 3FKIA 2VUMA 1TMOA 1UHDA 2NYAA 1TWGA 2C45A 3GTPA 2JA5A 1Y1VA 5T5MD 1E61A 1FDIA 4KO8A 1DMRA 1R9TA 5EPPA 2PJHB 5C1BA 1G8JA 2PMZA 4AOKB 2JIOA 3TIWA 4DMRA 5DYIA 4GA6A 2R7ZA 2JIMA 2NVXA 2V3VA 1I3QA 2YUJA 1QDNA 1E32A 1OGYA 3CQZA 1AA6A 3PLXB 2DMRA 1KQGA 1SIWA 5GLFA 4CRZA 1AW8B 3HU1A 3HU2A 5FTKA 2KI8A 1SFOA 1CR5A 1E18A 1PT1A 1IW7D 1I50A 2R92A 2JIRA 3IR7A 1S3SA 2JIPA 5DYGA 2VPZA 1WLFA 2NVYA 1EU1A 1CZ4A 4CRYG 1PPYA 3H0GA 3HKZA 4KLNA 2R93A 2EEOB 2JA7A 4GA5A 2WB1A 1DMSA 3QQ7A 2JIQA 3GTMA 1QCSA 4AZDA 5C18A 1Y5IA 4AAYA 5B6CA 1PQHA 3OUGA 2B63A 4CS0A 1PT0A 3QQ8A 1WCMA 4RV0A 2JA6A 1H5NA 1PYUB 2NAPA 2E7ZA 1TWAA 1VC3B
chains in the Genus database with same CATH superfamily
2VPYA 3MB5A 1TWCA 5EQJB 3GTJA 2JV2A 4KDLA 3GTQA 1R7RA 1E5VA 1G8KA 1TWHA 2E2HA 3IR5A 1ZC1A 3X2GA 1FDOA 5T5ID 3SUKA 3X2MA 2YU9A 2Q18X 1Y1WA 1OA9A 3X2IA 1UHEA 2LW6A 5FTJA 2QQRA 4AYBA 3GTKA 2O5JD 3TM7B 1Q16A 2Q19X 1H0HA 4AS1A 4KDIA 1CZ5A 4JCWA 4FERA 2IV2X 2E2IA 3FPUA 1PYQA 1SMYD 2KY9A 2PWYA 4AONB 1YLEA 3DMRA 3GTLA 2PJJA 4FIBA 3ZJUA 1YNJD 2Y0SA 2G6GA 3CF2A 3O5AA 5ERGB 3BQBA 2A6HD 5FTLA 1PQFA 3IR6A 1K83A 1PQEA 2PNWA 3GTGA 4NOHA 1KQFA 2VPWA 3QWZA 5FTMA 3GTOA 4QIWA 2V45A 5FTNA 2G5DA 2A68D 2VPXA 3ML1A 1R27A 3QC8A 5GLYA 4ZM7A 4FG2A 2WAQA 4KODA 5D6WA 4C2MA 1BW4A 4D7ZB 1E60A 1Y4ZA 1I9GA 1TWFA 3HU3A 3FKIA 3X2OA 5D6XA 2A69D 2VUMA 5D6YA 1TMOA 3X2JA 1UHDA 2NYAA 1TWGA 2C45A 5GM9A 3GTPA 3FPTA 2JA5A 1Y1VA 5T5MD 1E61A 1FDIA 3ENGA 4KO8A 1DMRA 2QQSA 3ZGZA 1R9TA 5EPPA 2YVLA 2PJHB 5C1BA 1G8JA 4JS7A 4ENGA 2PMZA 4AOKB 2HCZX 2CW0D 2JIOA 3TIWA 2ENGA 4DMRA 5DYIA 4GA6A 2R7ZA 2JIMA 2NVXA 1O54A 2V3VA 4AVRA 1I3QA 2YUJA 1QDNA 3LGAA 1E32A 1OGYA 3CQZA 1AA6A 4FFTA 3PLXB 2DMRA 1KQGA 3FPRA 1SIWA 5GLXA 3X2LA 5GLFA 4CRZA 1AW8B 3HU1A 4JP7A 3HU2A 4ARIA 5FTKA 2KI8A 1SFOA 1BW3A 3ZJTA 1CR5A 1E18A 1YNND 1PT1A 1IW7D 1I50A 2R92A 1ZYRD 2JIRA 3IR7A 4FG4A 1S3SA 2JIPA 4JP6A 5DYGA 2VPZA 1WLFA 3X2HA 5CD1A 2NVYA 1EU1A 3X2PA 2KQAA 1CZ4A 4CRYG 1L8FA 1PPYA 5CCXA 4ARCA 3LHDA 2BH0A 3CZBA 5CCBA 3H0GA 3HKZA 1OA7A 4KLNA 3X2NA 2EEOB 1N10A 2R93A 2JA7A 3SULA 4GA5A 2WB1A 1DMSA 2Q1CX 3X2KA 2Q1AX 4JJOA 2PI8A 3ZJVA 3QQ7A 2JIQA 2GF7A 1HD5A 3GTMA 2AE0X 4CQNA 1QCSA 2A6ED 2GAEA 2PICA 3D30A 3M3GA 4AZDA 1Y5IA 5C18A 2MM2A 2Q1DX 4UC4A 4AQ7A 2MM0A 4L48A 4AAYA 3SUMA 5B6CA 1PQHA 3OUGA 3SUJA 2GFAA 5H4UA 2B63A 1WC2A 4CS0A 1PT0A 3QQ8A 2B25A 1WCMA 4RV0A 2JA6A 1H5NA 1PYUB 2BE5D 2NAPA 2E7ZA 2XDPA 1TWAA 1VC3B
chains in the Genus database with same CATH topology
2VPYA 3MB5A 1TWCA 5EQJB 3GTJA 2JV2A 4KDLA 3GTQA 1R7RA 1E5VA 1G8KA 1TWHA 2E2HA 3IR5A 1ZC1A 1FDOA 5T5ID 2YU9A 2Q18X 1Y1WA 1UHEA 2LW6A 5FTJA 2QQRA 4AYBA 3GTKA 2O5JD 3TM7B 1Q16A 2Q19X 1H0HA 4AS1A 4KDIA 1CZ5A 2IV2X 2E2IA 3FPUA 1PYQA 1SMYD 2KY9A 2PWYA 4AONB 1YLEA 3DMRA 3GTLA 2PJJA 4FIBA 3ZJUA 1YNJD 2Y0SA 2G6GA 3CF2A 3O5AA 5ERGB 3BQBA 2A6HD 5FTLA 1PQFA 3IR6A 1K83A 1PQEA 2PNWA 3GTGA 4NOHA 1KQFA 2VPWA 3QWZA 5FTMA 3GTOA 4QIWA 2V45A 5FTNA 2G5DA 2A68D 2VPXA 3ML1A 1R27A 3QC8A 2WAQA 4KODA 5D6WA 4C2MA 4D7ZB 1E60A 1Y4ZA 1I9GA 1TWFA 3HU3A 3FKIA 5D6XA 2A69D 2VUMA 5D6YA 1TMOA 1UHDA 2NYAA 1TWGA 2C45A 3FPTA 3GTPA 2JA5A 1Y1VA 5T5MD 1E61A 1FDIA 4KO8A 1DMRA 2QQSA 3ZGZA 1R9TA 5EPPA 2YVLA 2PJHB 5C1BA 1G8JA 2PMZA 4AOKB 2CW0D 2JIOA 3TIWA 4DMRA 5DYIA 4GA6A 2R7ZA 2JIMA 2NVXA 1O54A 2V3VA 1I3QA 3LGAA 2YUJA 1QDNA 1E32A 1OGYA 3CQZA 1AA6A 3PLXB 2DMRA 1KQGA 3FPRA 1SIWA 5GLFA 4CRZA 1AW8B 3HU1A 4ARIA 3HU2A 5FTKA 2KI8A 1SFOA 3ZJTA 1CR5A 1E18A 1YNND 1PT1A 1IW7D 1I50A 2R92A 1ZYRD 2JIRA 3IR7A 1S3SA 2JIPA 5DYGA 2VPZA 1WLFA 5CD1A 2NVYA 1EU1A 1CZ4A 4CRYG 1PPYA 5CCXA 4ARCA 3LHDA 3CZBA 5CCBA 3H0GA 3HKZA 4KLNA 2R93A 2EEOB 2JA7A 4GA5A 2WB1A 1DMSA 2Q1CX 2Q1AX 2PI8A 3ZJVA 3QQ7A 2JIQA 2GF7A 3GTMA 4CQNA 2AE0X 1QCSA 2A6ED 2GAEA 2PICA 4AZDA 5C18A 2MM2A 1Y5IA 4UC4A 2Q1DX 4AQ7A 2MM0A 4AAYA 5B6CA 1PQHA 3OUGA 2GFAA 2B63A 4CS0A 1PT0A 3QQ8A 2B25A 1WCMA 4RV0A 2JA6A 1H5NA 1PYUB 2BE5D 2NAPA 2E7ZA 2XDPA 1TWAA 1VC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPY A;  1TWC A;  3GTJ A;  2JV2 A;  4KDL A;  3GTQ A;  1R7R A;  1E5V A;  1G8K A;  1TWH A;  2E2H A;  3IR5 A;  1ZC1 A;  1FDO A;  5T5I D;  2YU9 A;  1Y1W A;  1UHE A;  5FTJ A;  4AYB A;  3GTK A;  3TM7 B;  1Q16 A;  1H0H A;  4KDI A;  1CZ5 A;  2IV2 X;  2E2I A;  1PYQ A;  4AON B;  1YLE A;  3DMR A;  3GTL A;  2Y0S A;  3CF2 A;  3O5A A;  5FTL A;  1PQF A;  3IR6 A;  1K83 A;  1PQE A;  3GTG A;  1KQF A;  3GTO A;  2VPW A;  3QWZ A;  5FTM A;  4QIW A;  2V45 A;  5FTN A;  3ML1 A;  2VPX A;  1R27 A;  3QC8 A;  2WAQ A;  4KOD A;  4C2M A;  4D7Z B;  1E60 A;  1Y4Z A;  1TWF A;  3HU3 A;  3FKI A;  2VUM A;  1TMO A;  1UHD A;  2NYA A;  1TWG A;  2C45 A;  3GTP A;  2JA5 A;  1Y1V A;  5T5M D;  1E61 A;  1FDI A;  4KO8 A;  1DMR A;  1R9T A;  5EPP A;  2PJH B;  5C1B A;  1G8J A;  2PMZ A;  4AOK B;  2JIO A;  3TIW A;  4DMR A;  5DYI A;  4GA6 A;  2R7Z A;  2JIM A;  2NVX A;  2V3V A;  1I3Q A;  2YUJ A;  1QDN A;  1E32 A;  1OGY A;  3CQZ A;  1AA6 A;  3PLX B;  2DMR A;  1KQG A;  1SIW A;  5GLF A;  4CRZ A;  1AW8 B;  3HU1 A;  3HU2 A;  5FTK A;  2KI8 A;  1SFO A;  1CR5 A;  1E18 A;  1PT1 A;  1IW7 D;  1I50 A;  2R92 A;  2JIR A;  3IR7 A;  1S3S A;  2JIP A;  5DYG A;  2VPZ A;  1WLF A;  2NVY A;  1EU1 A;  1CZ4 A;  4CRY G;  1PPY A;  3H0G A;  3HKZ A;  4KLN A;  2R93 A;  2EEO B;  2JA7 A;  4GA5 A;  2WB1 A;  1DMS A;  3QQ7 A;  2JIQ A;  3GTM A;  1QCS A;  4AZD A;  5C18 A;  1Y5I A;  4AAY A;  5B6C A;  1PQH A;  3OUG A;  2B63 A;  4CS0 A;  1PT0 A;  3QQ8 A;  1WCM A;  4RV0 A;  2JA6 A;  1H5N A;  1PYU B;  2NAP A;  2E7Z A;  1TWA A;  1VC3 B; 
#chains in the Genus database with same CATH topology
 2VPY A;  3MB5 A;  1TWC A;  5EQJ B;  3GTJ A;  2JV2 A;  4KDL A;  3GTQ A;  1R7R A;  1E5V A;  1G8K A;  1TWH A;  2E2H A;  3IR5 A;  1ZC1 A;  3X2G A;  1FDO A;  5T5I D;  3SUK A;  3X2M A;  2YU9 A;  2Q18 X;  1Y1W A;  1OA9 A;  3X2I A;  1UHE A;  2LW6 A;  5FTJ A;  2QQR A;  4AYB A;  3GTK A;  2O5J D;  3TM7 B;  1Q16 A;  2Q19 X;  1H0H A;  4AS1 A;  4KDI A;  1CZ5 A;  4JCW A;  4FER A;  2IV2 X;  2E2I A;  3FPU A;  1PYQ A;  1SMY D;  2KY9 A;  2PWY A;  4AON B;  1YLE A;  3DMR A;  3GTL A;  2PJJ A;  4FIB A;  3ZJU A;  1YNJ D;  2Y0S A;  2G6G A;  3CF2 A;  3O5A A;  5ERG B;  3BQB A;  2A6H D;  5FTL A;  1PQF A;  3IR6 A;  1K83 A;  1PQE A;  2PNW A;  3GTG A;  4NOH A;  1KQF A;  2VPW A;  3QWZ A;  5FTM A;  3GTO A;  4QIW A;  2V45 A;  5FTN A;  2G5D A;  2A68 D;  2VPX A;  3ML1 A;  1R27 A;  3QC8 A;  5GLY A;  4ZM7 A;  4FG2 A;  2WAQ A;  4KOD A;  5D6W A;  4C2M A;  1BW4 A;  4D7Z B;  1E60 A;  1Y4Z A;  1I9G A;  1TWF A;  3HU3 A;  3FKI A;  3X2O A;  5D6X A;  2A69 D;  2VUM A;  5D6Y A;  1TMO A;  3X2J A;  1UHD A;  2NYA A;  1TWG A;  2C45 A;  5GM9 A;  3GTP A;  3FPT A;  2JA5 A;  1Y1V A;  5T5M D;  1E61 A;  1FDI A;  3ENG A;  4KO8 A;  1DMR A;  2QQS A;  3ZGZ A;  1R9T A;  5EPP A;  2YVL A;  2PJH B;  5C1B A;  1G8J A;  4JS7 A;  4ENG A;  2PMZ A;  4AOK B;  2HCZ X;  2CW0 D;  2JIO A;  3TIW A;  2ENG A;  4DMR A;  5DYI A;  4GA6 A;  2R7Z A;  2JIM A;  2NVX A;  1O54 A;  2V3V A;  4AVR A;  1I3Q A;  2YUJ A;  1QDN A;  3LGA A;  1E32 A;  1OGY A;  3CQZ A;  1AA6 A;  4FFT A;  3PLX B;  2DMR A;  1KQG A;  3FPR A;  1SIW A;  5GLX A;  3X2L A;  5GLF A;  4CRZ A;  1AW8 B;  3HU1 A;  4JP7 A;  3HU2 A;  4ARI A;  5FTK A;  2KI8 A;  1SFO A;  1BW3 A;  3ZJT A;  1CR5 A;  1E18 A;  1YNN D;  1PT1 A;  1IW7 D;  1I50 A;  2R92 A;  1ZYR D;  2JIR A;  3IR7 A;  4FG4 A;  1S3S A;  2JIP A;  4JP6 A;  5DYG A;  2VPZ A;  1WLF A;  3X2H A;  5CD1 A;  2NVY A;  1EU1 A;  3X2P A;  2KQA A;  1CZ4 A;  4CRY G;  1L8F A;  1PPY A;  5CCX A;  4ARC A;  3LHD A;  2BH0 A;  3CZB A;  5CCB A;  3H0G A;  3HKZ A;  1OA7 A;  4KLN A;  3X2N A;  2EEO B;  1N10 A;  2R93 A;  2JA7 A;  3SUL A;  4GA5 A;  2WB1 A;  1DMS A;  2Q1C X;  3X2K A;  2Q1A X;  4JJO A;  2PI8 A;  3ZJV A;  3QQ7 A;  2JIQ A;  2GF7 A;  1HD5 A;  3GTM A;  2AE0 X;  4CQN A;  1QCS A;  2A6E D;  2GAE A;  2PIC A;  3D30 A;  3M3G A;  4AZD A;  1Y5I A;  5C18 A;  2MM2 A;  2Q1D X;  4UC4 A;  4AQ7 A;  2MM0 A;  4L48 A;  4AAY A;  3SUM A;  5B6C A;  1PQH A;  3OUG A;  3SUJ A;  2GFA A;  5H4U A;  2B63 A;  1WC2 A;  4CS0 A;  1PT0 A;  3QQ8 A;  2B25 A;  1WCM A;  4RV0 A;  2JA6 A;  1H5N A;  1PYU B;  2BE5 D;  2NAP A;  2E7Z A;  2XDP A;  1TWA A;  1VC3 B; 
#chains in the Genus database with same CATH homology
 2VPY A;  3MB5 A;  1TWC A;  5EQJ B;  3GTJ A;  2JV2 A;  4KDL A;  3GTQ A;  1R7R A;  1E5V A;  1G8K A;  1TWH A;  2E2H A;  3IR5 A;  1ZC1 A;  1FDO A;  5T5I D;  2YU9 A;  2Q18 X;  1Y1W A;  1UHE A;  2LW6 A;  5FTJ A;  2QQR A;  4AYB A;  3GTK A;  2O5J D;  3TM7 B;  1Q16 A;  2Q19 X;  1H0H A;  4AS1 A;  4KDI A;  1CZ5 A;  2IV2 X;  2E2I A;  3FPU A;  1PYQ A;  1SMY D;  2KY9 A;  2PWY A;  4AON B;  1YLE A;  3DMR A;  3GTL A;  2PJJ A;  4FIB A;  3ZJU A;  1YNJ D;  2Y0S A;  2G6G A;  3CF2 A;  3O5A A;  5ERG B;  3BQB A;  2A6H D;  5FTL A;  1PQF A;  3IR6 A;  1K83 A;  1PQE A;  2PNW A;  3GTG A;  4NOH A;  1KQF A;  2VPW A;  3QWZ A;  5FTM A;  3GTO A;  4QIW A;  2V45 A;  5FTN A;  2G5D A;  2A68 D;  2VPX A;  3ML1 A;  1R27 A;  3QC8 A;  2WAQ A;  4KOD A;  5D6W A;  4C2M A;  4D7Z B;  1E60 A;  1Y4Z A;  1I9G A;  1TWF A;  3HU3 A;  3FKI A;  5D6X A;  2A69 D;  2VUM A;  5D6Y A;  1TMO A;  1UHD A;  2NYA A;  1TWG A;  2C45 A;  3FPT A;  3GTP A;  2JA5 A;  1Y1V A;  5T5M D;  1E61 A;  1FDI A;  4KO8 A;  1DMR A;  2QQS A;  3ZGZ A;  1R9T A;  5EPP A;  2YVL A;  2PJH B;  5C1B A;  1G8J A;  2PMZ A;  4AOK B;  2CW0 D;  2JIO A;  3TIW A;  4DMR A;  5DYI A;  4GA6 A;  2R7Z A;  2JIM A;  2NVX A;  1O54 A;  2V3V A;  1I3Q A;  3LGA A;  2YUJ A;  1QDN A;  1E32 A;  1OGY A;  3CQZ A;  1AA6 A;  3PLX B;  2DMR A;  1KQG A;  3FPR A;  1SIW A;  5GLF A;  4CRZ A;  1AW8 B;  3HU1 A;  4ARI A;  3HU2 A;  5FTK A;  2KI8 A;  1SFO A;  3ZJT A;  1CR5 A;  1E18 A;  1YNN D;  1PT1 A;  1IW7 D;  1I50 A;  2R92 A;  1ZYR D;  2JIR A;  3IR7 A;  1S3S A;  2JIP A;  5DYG A;  2VPZ A;  1WLF A;  5CD1 A;  2NVY A;  1EU1 A;  1CZ4 A;  4CRY G;  1PPY A;  5CCX A;  4ARC A;  3LHD A;  3CZB A;  5CCB A;  3H0G A;  3HKZ A;  4KLN A;  2R93 A;  2EEO B;  2JA7 A;  4GA5 A;  2WB1 A;  1DMS A;  2Q1C X;  2Q1A X;  2PI8 A;  3ZJV A;  3QQ7 A;  2JIQ A;  2GF7 A;  3GTM A;  4CQN A;  2AE0 X;  1QCS A;  2A6E D;  2GAE A;  2PIC A;  4AZD A;  5C18 A;  2MM2 A;  1Y5I A;  4UC4 A;  2Q1D X;  4AQ7 A;  2MM0 A;  4AAY A;  5B6C A;  1PQH A;  3OUG A;  2GFA A;  2B63 A;  4CS0 A;  1PT0 A;  3QQ8 A;  2B25 A;  1WCM A;  4RV0 A;  2JA6 A;  1H5N A;  1PYU B;  2BE5 D;  2NAP A;  2E7Z A;  2XDP A;  1TWA A;  1VC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...