5EPPA

Structural insights into the interaction of p97 n-terminus domain and vbm motif in rhomboid protease, rhbdl4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the interaction of p97 N-terminus domain and VBM in rhomboid protease, RHBDL4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 46
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5eppA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5eppA02
1VC3B 3HU1A 1K83A 3ML1A 3IR6A 1TWHA 1SIWA 3QQ8A 5FTLA 2JIQA 1KQGA 1Y5IA 5EPPA 2JIMA 3PLXB 3GTGA 2VPZA 3GTMA 1DMRA 1QDNA 1TWAA 5FTKA 2JIRA 2R93A 3HU3A 1PYQA 2NYAA 3TIWA 1TWGA 1CR5A 4KDIA 4AOKB 1E18A 3QWZA 1E61A 1CZ5A 1CZ4A 1UHDA 4GA6A 1FDIA 2IV2X 1S3SA 1TWCA 2DMRA 4AZDA 2V3VA 2EEOB 5B6CA 5T5ID 5GLFA 1DMSA 1YLEA 2E7ZA 1R9TA 1Y1WA 2PMZA 2V45A 5T5MD 1I3QA 2PJHB 3GTJA 2NVXA 3GTKA 4KODA 1Q16A 2KI8A 1QCSA 2JA5A 3HKZA 1PT0A 4RV0A 1KQFA 3QC8A 1H5NA 1G8JA 5FTMA 2NVYA 4AAYA 3GTPA 1EU1A 5FTJA 1SFOA 5FTNA 1PYUB 4KLNA 2YU9A 1H0HA 2R92A 5DYIA 2E2IA 5C18A 2NAPA 1PQFA 1WLFA 3H0GA 4KDLA 4CS0A 4CRYG 2VUMA 4AONB 2E2HA 1R27A 2JIPA 2C45A 1WCMA 1PQHA 2Y0SA 1I50A 2JA6A 2VPYA 3IR7A 4GA5A 3OUGA 2YUJA 1AW8B 3GTOA 1E32A 3FKIA 3CQZA 3TM7B 3HU2A 3IR5A 4D7ZB 3GTLA 3GTQA 1TWFA 1R7RA 1Y1VA 1Y4ZA 5C1BA 2JIOA 1FDOA 2JV2A 2R7ZA 4QIWA 1E60A 1G8KA 1PPYA 4KO8A 2JA7A 1TMOA 1ZC1A 3CF2A 4CRZA 2VPXA 2B63A 4DMRA 4AYBA 1E5VA 1IW7D 1PT1A 2WAQA 2VPWA 4C2MA 1UHEA 5DYGA 3O5AA 1OGYA 1PQEA 2WB1A 1AA6A 3DMRA 3QQ7A
chains in the Genus database with same CATH superfamily
1VC3B 3HU1A 4AVRA 1K83A 3ML1A 3X2KA 2BE5D 2PICA 3IR6A 1OA7A 2A6ED 1TWHA 1SIWA 3CZBA 3QQ8A 1HD5A 5FTLA 2JIQA 2KY9A 1KQGA 1Y5IA 2KQAA 1O54A 3ZJUA 5EPPA 2JIMA 3X2JA 3PLXB 4FG2A 2VPZA 3GTGA 4CQNA 3GTMA 3FPTA 1DMRA 1QDNA 1TWAA 4JJOA 4JS7A 5FTKA 3X2NA 3BQBA 3X2OA 5CCBA 2PNWA 2GAEA 2Q18X 3LGAA 2G5DA 2JIRA 4FIBA 5D6YA 3ENGA 3X2HA 2R93A 4UC4A 3HU3A 1PYQA 2NYAA 3TIWA 1TWGA 1CR5A 4FG4A 4KDIA 4AOKB 1E18A 3QWZA 1E61A 1CZ5A 3FPRA 1CZ4A 1UHDA 4GA6A 1FDIA 2QQRA 2YVLA 2IV2X 1S3SA 3SULA 1TWCA 2DMRA 4AZDA 2A68D 2EEOB 2CW0D 2V3VA 5T5ID 5B6CA 2MM2A 5GLFA 1DMSA 1YLEA 2E7ZA 3D30A 1R9TA 2PI8A 2PMZA 2V45A 5T5MD 1I3QA 2PJHB 1Y1WA 3GTJA 2NVXA 3GTKA 4KODA 1Q16A 5GM9A 4ENGA 2KI8A 1YNJD 1QCSA 2A6HD 2JA5A 3ZJVA 3SUJA 3HKZA 1PT0A 4RV0A 1KQFA 4L48A 3QC8A 1H5NA 1G8JA 2MM0A 2PJJA 2NVYA 5FTMA 4AAYA 3GTPA 1BW3A 1EU1A 5FTJA 1SFOA 5FTNA 1N10A 1PYUB 4JCWA 4KLNA 2YU9A 1H0HA 1BW4A 2Q1CX 1I9GA 3ZGZA 3SUMA 5D6WA 2R92A 5DYIA 2E2IA 5C18A 2NAPA 2GF7A 1PQFA 1WLFA 5ERGB 3H0GA 4KDLA 4NOHA 4CS0A 3X2MA 4CRYG 2VUMA 2XDPA 4AONB 4FERA 2E2HA 1R27A 2GFAA 2JIPA 1WC2A 2C45A 5EQJB 1WCMA 2HCZX 1PQHA 4FFTA 2PWYA 5CCXA 2Y0SA 1I50A 2JA6A 3FPUA 2VPYA 3IR7A 4GA5A 1YNND 3M3GA 2YUJA 3OUGA 1AW8B 3GTOA 1E32A 3FKIA 3CQZA 4ARCA 3TM7B 3HU2A 3IR5A 2AE0X 1L8FA 5GLXA 4D7ZB 3GTLA 3GTQA 1TWFA 2Q19X 1R7RA 1Y1VA 1Y4ZA 5C1BA 2JIOA 1FDOA 2JV2A 2R7ZA 5GLYA 4QIWA 1SMYD 1ZYRD 1E60A 4JP7A 3X2PA 2B25A 3X2LA 1G8KA 5CD1A 4JP6A 1PPYA 4KO8A 2JA7A 1TMOA 3X2GA 2Q1AX 1ZC1A 2BH0A 3CF2A 2A69D 1OA9A 4CRZA 3MB5A 3ZJTA 2VPXA 3SUKA 2B63A 4DMRA 4AYBA 4ZM7A 5H4UA 2Q1DX 1E5VA 1IW7D 1PT1A 2WAQA 2QQSA 5D6XA 2VPWA 3X2IA 4C2MA 1UHEA 2G6GA 5DYGA 3O5AA 2O5JD 1OGYA 2ENGA 1PQEA 2LW6A 2WB1A 3LHDA 4AS1A 4ARIA 1AA6A 4AQ7A 3DMRA 3QQ7A
chains in the Genus database with same CATH topology
1VC3B 3HU1A 1K83A 3ML1A 2BE5D 2PICA 3IR6A 2A6ED 1TWHA 1SIWA 3CZBA 3QQ8A 5FTLA 2JIQA 2KY9A 1KQGA 1Y5IA 1O54A 3ZJUA 5EPPA 2JIMA 3PLXB 3GTGA 2VPZA 4CQNA 3GTMA 3FPTA 1DMRA 1QDNA 1TWAA 5FTKA 3BQBA 5CCBA 2PNWA 2GAEA 2Q18X 3LGAA 2G5DA 2JIRA 4FIBA 5D6YA 2R93A 4UC4A 3HU3A 1PYQA 2NYAA 3TIWA 1TWGA 1CR5A 4KDIA 4AOKB 1E18A 3QWZA 1E61A 1CZ5A 3FPRA 1CZ4A 1UHDA 4GA6A 1FDIA 2QQRA 2YVLA 2IV2X 1S3SA 1TWCA 2DMRA 4AZDA 2A68D 2EEOB 2CW0D 2V3VA 5T5ID 5B6CA 2MM2A 5GLFA 1DMSA 1YLEA 2E7ZA 1R9TA 1Y1WA 2PI8A 2PMZA 2V45A 5T5MD 1I3QA 2PJHB 3GTJA 2NVXA 3GTKA 4KODA 1Q16A 2KI8A 1YNJD 1QCSA 2A6HD 2JA5A 3ZJVA 3HKZA 1PT0A 4RV0A 1KQFA 3QC8A 1H5NA 1G8JA 2MM0A 2PJJA 2NVYA 5FTMA 4AAYA 3GTPA 1EU1A 5FTJA 1SFOA 5FTNA 1PYUB 4KLNA 2YU9A 1H0HA 2Q1CX 1I9GA 3ZGZA 5D6WA 2R92A 5DYIA 2E2IA 5C18A 2NAPA 2GF7A 1PQFA 1WLFA 5ERGB 3H0GA 4KDLA 4NOHA 4CS0A 4CRYG 2VUMA 2XDPA 4AONB 2E2HA 2GFAA 1R27A 2JIPA 2C45A 5EQJB 1WCMA 1PQHA 2PWYA 5CCXA 2Y0SA 1I50A 2JA6A 3FPUA 2VPYA 3IR7A 4GA5A 1YNND 2YUJA 3OUGA 1AW8B 3GTOA 1E32A 3FKIA 3CQZA 4ARCA 3TM7B 3HU2A 3IR5A 2AE0X 4D7ZB 3GTLA 2Q19X 3GTQA 1TWFA 1R7RA 1Y1VA 1Y4ZA 5C1BA 2JIOA 1FDOA 2JV2A 2R7ZA 4QIWA 1SMYD 1ZYRD 1E60A 2B25A 1G8KA 5CD1A 1PPYA 4KO8A 2JA7A 1TMOA 2Q1AX 1ZC1A 3CF2A 2A69D 4CRZA 3MB5A 3ZJTA 2VPXA 2B63A 4DMRA 4AYBA 2Q1DX 1E5VA 1IW7D 1PT1A 2WAQA 2QQSA 5D6XA 2VPWA 4C2MA 1UHEA 2G6GA 5DYGA 3O5AA 2O5JD 1OGYA 4AS1A 1PQEA 2LW6A 2WB1A 3LHDA 4ARIA 1AA6A 4AQ7A 3DMRA 3QQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VC3 B;  3HU1 A;  1K83 A;  3ML1 A;  3IR6 A;  1TWH A;  1SIW A;  3QQ8 A;  5FTL A;  2JIQ A;  1KQG A;  1Y5I A;  5EPP A;  2JIM A;  3PLX B;  3GTG A;  2VPZ A;  3GTM A;  1DMR A;  1QDN A;  1TWA A;  5FTK A;  2JIR A;  2R93 A;  3HU3 A;  1PYQ A;  2NYA A;  3TIW A;  1TWG A;  1CR5 A;  4KDI A;  4AOK B;  1E18 A;  3QWZ A;  1E61 A;  1CZ5 A;  1CZ4 A;  1UHD A;  4GA6 A;  1FDI A;  2IV2 X;  1S3S A;  1TWC A;  2DMR A;  4AZD A;  2V3V A;  2EEO B;  5B6C A;  5T5I D;  5GLF A;  1DMS A;  1YLE A;  2E7Z A;  1R9T A;  1Y1W A;  2PMZ A;  2V45 A;  5T5M D;  1I3Q A;  2PJH B;  3GTJ A;  2NVX A;  3GTK A;  4KOD A;  1Q16 A;  2KI8 A;  1QCS A;  2JA5 A;  3HKZ A;  1PT0 A;  4RV0 A;  1KQF A;  3QC8 A;  1H5N A;  1G8J A;  5FTM A;  2NVY A;  4AAY A;  3GTP A;  1EU1 A;  5FTJ A;  1SFO A;  5FTN A;  1PYU B;  4KLN A;  2YU9 A;  1H0H A;  2R92 A;  5DYI A;  2E2I A;  5C18 A;  2NAP A;  1PQF A;  1WLF A;  3H0G A;  4KDL A;  4CS0 A;  4CRY G;  2VUM A;  4AON B;  2E2H A;  1R27 A;  2JIP A;  2C45 A;  1WCM A;  1PQH A;  2Y0S A;  1I50 A;  2JA6 A;  2VPY A;  3IR7 A;  4GA5 A;  3OUG A;  2YUJ A;  1AW8 B;  3GTO A;  1E32 A;  3FKI A;  3CQZ A;  3TM7 B;  3HU2 A;  3IR5 A;  4D7Z B;  3GTL A;  3GTQ A;  1TWF A;  1R7R A;  1Y1V A;  1Y4Z A;  5C1B A;  2JIO A;  1FDO A;  2JV2 A;  2R7Z A;  4QIW A;  1E60 A;  1G8K A;  1PPY A;  4KO8 A;  2JA7 A;  1TMO A;  1ZC1 A;  3CF2 A;  4CRZ A;  2VPX A;  2B63 A;  4DMR A;  4AYB A;  1E5V A;  1IW7 D;  1PT1 A;  2WAQ A;  2VPW A;  4C2M A;  1UHE A;  5DYG A;  3O5A A;  1OGY A;  1PQE A;  2WB1 A;  1AA6 A;  3DMR A;  3QQ7 A; 
#chains in the Genus database with same CATH topology
 1VC3 B;  3HU1 A;  4AVR A;  1K83 A;  3ML1 A;  3X2K A;  2BE5 D;  2PIC A;  3IR6 A;  1OA7 A;  2A6E D;  1TWH A;  1SIW A;  3CZB A;  3QQ8 A;  1HD5 A;  5FTL A;  2JIQ A;  2KY9 A;  1KQG A;  1Y5I A;  2KQA A;  1O54 A;  3ZJU A;  5EPP A;  2JIM A;  3X2J A;  3PLX B;  4FG2 A;  2VPZ A;  3GTG A;  4CQN A;  3GTM A;  3FPT A;  1DMR A;  1QDN A;  1TWA A;  4JJO A;  4JS7 A;  5FTK A;  3X2N A;  3BQB A;  3X2O A;  5CCB A;  2PNW A;  2GAE A;  2Q18 X;  3LGA A;  2G5D A;  2JIR A;  4FIB A;  5D6Y A;  3ENG A;  3X2H A;  2R93 A;  4UC4 A;  3HU3 A;  1PYQ A;  2NYA A;  3TIW A;  1TWG A;  1CR5 A;  4FG4 A;  4KDI A;  4AOK B;  1E18 A;  3QWZ A;  1E61 A;  1CZ5 A;  3FPR A;  1CZ4 A;  1UHD A;  4GA6 A;  1FDI A;  2QQR A;  2YVL A;  2IV2 X;  1S3S A;  3SUL A;  1TWC A;  2DMR A;  4AZD A;  2A68 D;  2EEO B;  2CW0 D;  2V3V A;  5T5I D;  5B6C A;  2MM2 A;  5GLF A;  1DMS A;  1YLE A;  2E7Z A;  3D30 A;  1R9T A;  2PI8 A;  2PMZ A;  2V45 A;  5T5M D;  1I3Q A;  2PJH B;  1Y1W A;  3GTJ A;  2NVX A;  3GTK A;  4KOD A;  1Q16 A;  5GM9 A;  4ENG A;  2KI8 A;  1YNJ D;  1QCS A;  2A6H D;  2JA5 A;  3ZJV A;  3SUJ A;  3HKZ A;  1PT0 A;  4RV0 A;  1KQF A;  4L48 A;  3QC8 A;  1H5N A;  1G8J A;  2MM0 A;  2PJJ A;  2NVY A;  5FTM A;  4AAY A;  3GTP A;  1BW3 A;  1EU1 A;  5FTJ A;  1SFO A;  5FTN A;  1N10 A;  1PYU B;  4JCW A;  4KLN A;  2YU9 A;  1H0H A;  1BW4 A;  2Q1C X;  1I9G A;  3ZGZ A;  3SUM A;  5D6W A;  2R92 A;  5DYI A;  2E2I A;  5C18 A;  2NAP A;  2GF7 A;  1PQF A;  1WLF A;  5ERG B;  3H0G A;  4KDL A;  4NOH A;  4CS0 A;  3X2M A;  4CRY G;  2VUM A;  2XDP A;  4AON B;  4FER A;  2E2H A;  1R27 A;  2GFA A;  2JIP A;  1WC2 A;  2C45 A;  5EQJ B;  1WCM A;  2HCZ X;  1PQH A;  4FFT A;  2PWY A;  5CCX A;  2Y0S A;  1I50 A;  2JA6 A;  3FPU A;  2VPY A;  3IR7 A;  4GA5 A;  1YNN D;  3M3G A;  2YUJ A;  3OUG A;  1AW8 B;  3GTO A;  1E32 A;  3FKI A;  3CQZ A;  4ARC A;  3TM7 B;  3HU2 A;  3IR5 A;  2AE0 X;  1L8F A;  5GLX A;  4D7Z B;  3GTL A;  3GTQ A;  1TWF A;  2Q19 X;  1R7R A;  1Y1V A;  1Y4Z A;  5C1B A;  2JIO A;  1FDO A;  2JV2 A;  2R7Z A;  5GLY A;  4QIW A;  1SMY D;  1ZYR D;  1E60 A;  4JP7 A;  3X2P A;  2B25 A;  3X2L A;  1G8K A;  5CD1 A;  4JP6 A;  1PPY A;  4KO8 A;  2JA7 A;  1TMO A;  3X2G A;  2Q1A X;  1ZC1 A;  2BH0 A;  3CF2 A;  2A69 D;  1OA9 A;  4CRZ A;  3MB5 A;  3ZJT A;  2VPX A;  3SUK A;  2B63 A;  4DMR A;  4AYB A;  4ZM7 A;  5H4U A;  2Q1D X;  1E5V A;  1IW7 D;  1PT1 A;  2WAQ A;  2QQS A;  5D6X A;  2VPW A;  3X2I A;  4C2M A;  1UHE A;  2G6G A;  5DYG A;  3O5A A;  2O5J D;  1OGY A;  2ENG A;  1PQE A;  2LW6 A;  2WB1 A;  3LHD A;  4AS1 A;  4ARI A;  1AA6 A;  4AQ7 A;  3DMR A;  3QQ7 A; 
#chains in the Genus database with same CATH homology
 1VC3 B;  3HU1 A;  1K83 A;  3ML1 A;  2BE5 D;  2PIC A;  3IR6 A;  2A6E D;  1TWH A;  1SIW A;  3CZB A;  3QQ8 A;  5FTL A;  2JIQ A;  2KY9 A;  1KQG A;  1Y5I A;  1O54 A;  3ZJU A;  5EPP A;  2JIM A;  3PLX B;  3GTG A;  2VPZ A;  4CQN A;  3GTM A;  3FPT A;  1DMR A;  1QDN A;  1TWA A;  5FTK A;  3BQB A;  5CCB A;  2PNW A;  2GAE A;  2Q18 X;  3LGA A;  2G5D A;  2JIR A;  4FIB A;  5D6Y A;  2R93 A;  4UC4 A;  3HU3 A;  1PYQ A;  2NYA A;  3TIW A;  1TWG A;  1CR5 A;  4KDI A;  4AOK B;  1E18 A;  3QWZ A;  1E61 A;  1CZ5 A;  3FPR A;  1CZ4 A;  1UHD A;  4GA6 A;  1FDI A;  2QQR A;  2YVL A;  2IV2 X;  1S3S A;  1TWC A;  2DMR A;  4AZD A;  2A68 D;  2EEO B;  2CW0 D;  2V3V A;  5T5I D;  5B6C A;  2MM2 A;  5GLF A;  1DMS A;  1YLE A;  2E7Z A;  1R9T A;  1Y1W A;  2PI8 A;  2PMZ A;  2V45 A;  5T5M D;  1I3Q A;  2PJH B;  3GTJ A;  2NVX A;  3GTK A;  4KOD A;  1Q16 A;  2KI8 A;  1YNJ D;  1QCS A;  2A6H D;  2JA5 A;  3ZJV A;  3HKZ A;  1PT0 A;  4RV0 A;  1KQF A;  3QC8 A;  1H5N A;  1G8J A;  2MM0 A;  2PJJ A;  2NVY A;  5FTM A;  4AAY A;  3GTP A;  1EU1 A;  5FTJ A;  1SFO A;  5FTN A;  1PYU B;  4KLN A;  2YU9 A;  1H0H A;  2Q1C X;  1I9G A;  3ZGZ A;  5D6W A;  2R92 A;  5DYI A;  2E2I A;  5C18 A;  2NAP A;  2GF7 A;  1PQF A;  1WLF A;  5ERG B;  3H0G A;  4KDL A;  4NOH A;  4CS0 A;  4CRY G;  2VUM A;  2XDP A;  4AON B;  2E2H A;  2GFA A;  1R27 A;  2JIP A;  2C45 A;  5EQJ B;  1WCM A;  1PQH A;  2PWY A;  5CCX A;  2Y0S A;  1I50 A;  2JA6 A;  3FPU A;  2VPY A;  3IR7 A;  4GA5 A;  1YNN D;  2YUJ A;  3OUG A;  1AW8 B;  3GTO A;  1E32 A;  3FKI A;  3CQZ A;  4ARC A;  3TM7 B;  3HU2 A;  3IR5 A;  2AE0 X;  4D7Z B;  3GTL A;  2Q19 X;  3GTQ A;  1TWF A;  1R7R A;  1Y1V A;  1Y4Z A;  5C1B A;  2JIO A;  1FDO A;  2JV2 A;  2R7Z A;  4QIW A;  1SMY D;  1ZYR D;  1E60 A;  2B25 A;  1G8K A;  5CD1 A;  1PPY A;  4KO8 A;  2JA7 A;  1TMO A;  2Q1A X;  1ZC1 A;  3CF2 A;  2A69 D;  4CRZ A;  3MB5 A;  3ZJT A;  2VPX A;  2B63 A;  4DMR A;  4AYB A;  2Q1D X;  1E5V A;  1IW7 D;  1PT1 A;  2WAQ A;  2QQS A;  5D6X A;  2VPW A;  4C2M A;  1UHE A;  2G6G A;  5DYG A;  3O5A A;  2O5J D;  1OGY A;  4AS1 A;  1PQE A;  2LW6 A;  2WB1 A;  3LHD A;  4ARI A;  1AA6 A;  4AQ7 A;  3DMR A;  3QQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...