5EPPA

Structural insights into the interaction of p97 n-terminus domain and vbm motif in rhomboid protease, rhbdl4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural insights into the interaction of p97 N-terminus domain and VBM in rhomboid protease, RHBDL4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5eppA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5eppA02
1KQFA 3CF2A 2R93A 4CS0A 4CRZA 1FDOA 2KI8A 1TMOA 1SIWA 1UHEA 2V3VA 4GA6A 1KQGA 2YU9A 4QIWA 1UHDA 1WCMA 5FTNA 1K83A 2JIMA 3GTQA 2B63A 1E32A 1QDNA 4AZDA 2E2IA 3IR5A 1R7RA 3QQ7A 3HU3A 1G8JA 5FTKA 1E61A 1R27A 2WB1A 2WAQA 1Y1VA 2PJHB 2JIQA 4KLNA 1WLFA 3O5AA 4AYBA 1DMRA 4GA5A 1Y4ZA 2NYAA 3QC8A 2E7ZA 1VC3B 2JIRA 5FTMA 5C1BA 3TIWA 1CZ5A 1PT0A 1PYUB 3GTMA 1YLEA 1TWHA 2VPWA 5B6CA 1PT1A 2YUJA 1OGYA 1PPYA 2IV2X 4KDIA 1SFOA 2E2HA 1R9TA 3HKZA 1I50A 1Y1WA 2V45A 2DMRA 3TM7B 3GTOA 1E5VA 5T5MD 1PQEA 2R7ZA 4KO8A 5FTJA 3PLXB 1ZC1A 3GTGA 5DYIA 2VUMA 1PQFA 2NVYA 1TWAA 1E60A 2NVXA 2JIPA 4D7ZB 1Y5IA 1H0HA 1Q16A 4DMRA 1E18A 2VPZA 4AOKB 4KODA 1H5NA 3OUGA 2R92A 2Y0SA 3QWZA 1CR5A 2PMZA 1I3QA 3H0GA 1AA6A 2VPXA 3HU2A 4C2MA 1EU1A 2JA5A 1CZ4A 2JA6A 1DMSA 2JA7A 4CRYG 4AAYA 3DMRA 3CQZA 2C45A 2JV2A 3ML1A 4RV0A 1FDIA 3GTLA 1IW7D 5FTLA 2VPYA 1G8KA 5GLFA 1QCSA 3GTPA 4KDLA 1PQHA 1TWCA 5EPPA 3GTJA 3QQ8A 3IR7A 3FKIA 2NAPA 4AONB 5C18A 1PYQA 3HU1A 2JIOA 2EEOB 5T5ID 1S3SA 1TWGA 1TWFA 3IR6A 5DYGA 3GTKA 1AW8B
chains in the Genus database with same CATH superfamily
1KQFA 3CF2A 5GM9A 2R93A 4CS0A 4CRZA 5H4UA 1FDOA 2KI8A 1TMOA 1SIWA 3CZBA 1UHEA 2V3VA 4GA6A 1KQGA 2YU9A 4QIWA 1UHDA 1WCMA 5FTNA 1K83A 2JIMA 3GTQA 3X2JA 2B63A 3BQBA 1BW3A 1E32A 1QDNA 4JP7A 4JJOA 2KY9A 3FPTA 4AZDA 2E2IA 1O54A 2QQSA 3IR5A 1R7RA 3QQ7A 3HU3A 1G8JA 3X2MA 5FTKA 3GTKA 2LW6A 3MB5A 5CCBA 3ZJTA 1E61A 1R27A 5ERGB 2WB1A 2WAQA 1Y1VA 5D6WA 3SUKA 2PJHB 2JIQA 3SULA 2Q1CX 4KLNA 3X2HA 2Q18X 2Q1AX 3SUJA 1WLFA 3O5AA 2PJJA 4AYBA 1DMRA 5GLXA 5CCXA 4GA5A 1Y4ZA 3X2GA 2NYAA 3QC8A 2O5JD 2E7ZA 1VC3B 2JIRA 4FG4A 5FTMA 3X2IA 3TIWA 5C1BA 4FERA 1PT0A 1PYUB 4JP6A 3GTMA 1CZ5A 2XDPA 1YLEA 1WC2A 2CW0D 4L48A 4UC4A 4ARIA 1TWHA 2VPWA 5B6CA 2YVLA 1PT1A 2YUJA 1OGYA 2AE0X 1PPYA 2A69D 2IV2X 3FPUA 4KDIA 1SFOA 2E2HA 1R9TA 3X2NA 3ZGZA 3HKZA 1I50A 1Y1WA 2V45A 2DMRA 3TM7B 2A68D 3LHDA 3GTOA 1E5VA 5T5MD 1PQEA 2R7ZA 4KO8A 5FTJA 3PLXB 4AVRA 4AS1A 1ZC1A 3GTGA 3ENGA 2PI8A 5DYIA 2VUMA 2Q19X 1PQFA 1YNND 2A6ED 2NVYA 4FG2A 1TWAA 4ARCA 1E60A 2NVXA 2JIPA 4D7ZB 1Y5IA 1H0HA 2GFAA 1Q16A 5CD1A 4DMRA 1E18A 2VPZA 4ENGA 4AOKB 5D6XA 4KODA 3M3GA 1H5NA 3OUGA 2R92A 3X2PA 1SMYD 1OA9A 5GLYA 2Y0SA 5D6YA 3QWZA 2BH0A 1CR5A 2GAEA 2PMZA 1I3QA 2GF7A 3H0GA 1AA6A 2VPXA 4FFTA 1N10A 4ZM7A 2MM2A 3HU2A 3X2LA 4C2MA 1EU1A 2A6HD 2PNWA 2JA5A 1OA7A 1CZ4A 1L8FA 2JA6A 2B25A 1DMSA 3X2OA 2JA7A 4AQ7A 3ZJVA 4CRYG 4AAYA 3DMRA 3CQZA 2C45A 1YNJD 2ENGA 3D30A 3ML1A 4RV0A 1I9GA 2JV2A 2G6GA 2BE5D 1FDIA 3GTLA 1HD5A 1IW7D 5FTLA 4JS7A 2VPYA 1G8KA 5GLFA 5EQJB 1QCSA 4FIBA 3GTPA 3FPRA 4KDLA 1PQHA 1TWCA 1ZYRD 5EPPA 2G5DA 3QQ8A 3IR7A 3FKIA 3GTJA 3SUMA 2QQRA 2HCZX 2NAPA 3LGAA 4AONB 2PWYA 4CQNA 4JCWA 1PYQA 3HU1A 2JIOA 4NOHA 5C18A 1BW4A 2MM0A 2EEOB 5T5ID 1S3SA 1TWGA 3X2KA 1TWFA 2Q1DX 3IR6A 5DYGA 2KQAA 2PICA 1AW8B 3ZJUA
chains in the Genus database with same CATH topology
1KQFA 3CF2A 2R93A 4CS0A 4CRZA 1FDOA 2KI8A 1TMOA 1SIWA 3CZBA 1UHEA 2V3VA 4GA6A 1KQGA 2YU9A 4QIWA 1UHDA 1WCMA 5FTNA 1K83A 2JIMA 3GTQA 2B63A 3BQBA 1E32A 1QDNA 2KY9A 3FPTA 4AZDA 2E2IA 1O54A 2QQSA 3IR5A 1R7RA 3QQ7A 3HU3A 1G8JA 3MB5A 5FTKA 5CCBA 3ZJTA 1E61A 1R27A 5ERGB 2WB1A 2WAQA 1Y1VA 5D6WA 2PJHB 2JIQA 2Q1CX 4KLNA 2Q18X 2Q1AX 1WLFA 3O5AA 2PJJA 4AYBA 1DMRA 5CCXA 4GA5A 1Y4ZA 2NYAA 3QC8A 2O5JD 2E7ZA 1VC3B 2JIRA 5FTMA 5C1BA 2LW6A 3TIWA 1CZ5A 1PT0A 1PYUB 3GTMA 2XDPA 1YLEA 2CW0D 4ARIA 4UC4A 1TWHA 2VPWA 5B6CA 2YVLA 1PT1A 2YUJA 1OGYA 2AE0X 1PPYA 2A69D 2IV2X 3FPUA 4KDIA 1SFOA 2E2HA 1R9TA 3ZGZA 3HKZA 1I50A 1Y1WA 2V45A 2DMRA 3TM7B 2A68D 3LHDA 3GTOA 1E5VA 5T5MD 1PQEA 2R7ZA 4KO8A 5FTJA 3PLXB 4AS1A 1ZC1A 3GTGA 5DYIA 2PI8A 2VUMA 2Q19X 1PQFA 1YNND 2A6ED 2NVYA 1TWAA 1E60A 2NVXA 2JIPA 4D7ZB 1Y5IA 1H0HA 2GFAA 1Q16A 5CD1A 4DMRA 1E18A 2VPZA 4AOKB 5D6XA 4KODA 1H5NA 3OUGA 2R92A 1SMYD 2Y0SA 5D6YA 3QWZA 1CR5A 2GAEA 2PMZA 1I3QA 2GF7A 3H0GA 1AA6A 2VPXA 2MM2A 3HU2A 4C2MA 1EU1A 2A6HD 2PNWA 2JA5A 1CZ4A 2JA6A 2B25A 4AQ7A 1DMSA 2JA7A 3ZJVA 4CRYG 4AAYA 3DMRA 3CQZA 2C45A 1YNJD 2JV2A 3ML1A 4RV0A 1I9GA 2G6GA 2BE5D 1FDIA 3GTLA 1IW7D 5FTLA 2VPYA 1G8KA 5GLFA 5EQJB 1QCSA 4FIBA 3GTPA 3FPRA 4KDLA 1PQHA 1TWCA 1ZYRD 5EPPA 2G5DA 3QQ8A 3IR7A 3FKIA 3GTJA 2QQRA 3LGAA 4ARCA 2NAPA 4AONB 2PWYA 4CQNA 5C18A 1PYQA 3HU1A 2JIOA 4NOHA 2MM0A 2EEOB 5T5ID 1S3SA 1TWGA 1TWFA 2Q1DX 3IR6A 5DYGA 3GTKA 2PICA 1AW8B 3ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQF A;  3CF2 A;  2R93 A;  4CS0 A;  4CRZ A;  1FDO A;  2KI8 A;  1TMO A;  1SIW A;  1UHE A;  2V3V A;  4GA6 A;  1KQG A;  2YU9 A;  4QIW A;  1UHD A;  1WCM A;  5FTN A;  1K83 A;  2JIM A;  3GTQ A;  2B63 A;  1E32 A;  1QDN A;  4AZD A;  2E2I A;  3IR5 A;  1R7R A;  3QQ7 A;  3HU3 A;  1G8J A;  5FTK A;  1E61 A;  1R27 A;  2WB1 A;  2WAQ A;  1Y1V A;  2PJH B;  2JIQ A;  4KLN A;  1WLF A;  3O5A A;  4AYB A;  1DMR A;  4GA5 A;  1Y4Z A;  2NYA A;  3QC8 A;  2E7Z A;  1VC3 B;  2JIR A;  5FTM A;  5C1B A;  3TIW A;  1CZ5 A;  1PT0 A;  1PYU B;  3GTM A;  1YLE A;  1TWH A;  2VPW A;  5B6C A;  1PT1 A;  2YUJ A;  1OGY A;  1PPY A;  2IV2 X;  4KDI A;  1SFO A;  2E2H A;  1R9T A;  3HKZ A;  1I50 A;  1Y1W A;  2V45 A;  2DMR A;  3TM7 B;  3GTO A;  1E5V A;  5T5M D;  1PQE A;  2R7Z A;  4KO8 A;  5FTJ A;  3PLX B;  1ZC1 A;  3GTG A;  5DYI A;  2VUM A;  1PQF A;  2NVY A;  1TWA A;  1E60 A;  2NVX A;  2JIP A;  4D7Z B;  1Y5I A;  1H0H A;  1Q16 A;  4DMR A;  1E18 A;  2VPZ A;  4AOK B;  4KOD A;  1H5N A;  3OUG A;  2R92 A;  2Y0S A;  3QWZ A;  1CR5 A;  2PMZ A;  1I3Q A;  3H0G A;  1AA6 A;  2VPX A;  3HU2 A;  4C2M A;  1EU1 A;  2JA5 A;  1CZ4 A;  2JA6 A;  1DMS A;  2JA7 A;  4CRY G;  4AAY A;  3DMR A;  3CQZ A;  2C45 A;  2JV2 A;  3ML1 A;  4RV0 A;  1FDI A;  3GTL A;  1IW7 D;  5FTL A;  2VPY A;  1G8K A;  5GLF A;  1QCS A;  3GTP A;  4KDL A;  1PQH A;  1TWC A;  5EPP A;  3GTJ A;  3QQ8 A;  3IR7 A;  3FKI A;  2NAP A;  4AON B;  5C18 A;  1PYQ A;  3HU1 A;  2JIO A;  2EEO B;  5T5I D;  1S3S A;  1TWG A;  1TWF A;  3IR6 A;  5DYG A;  3GTK A;  1AW8 B; 
#chains in the Genus database with same CATH topology
 1KQF A;  3CF2 A;  5GM9 A;  2R93 A;  4CS0 A;  4CRZ A;  5H4U A;  1FDO A;  2KI8 A;  1TMO A;  1SIW A;  3CZB A;  1UHE A;  2V3V A;  4GA6 A;  1KQG A;  2YU9 A;  4QIW A;  1UHD A;  1WCM A;  5FTN A;  1K83 A;  2JIM A;  3GTQ A;  3X2J A;  2B63 A;  3BQB A;  1BW3 A;  1E32 A;  1QDN A;  4JP7 A;  4JJO A;  2KY9 A;  3FPT A;  4AZD A;  2E2I A;  1O54 A;  2QQS A;  3IR5 A;  1R7R A;  3QQ7 A;  3HU3 A;  1G8J A;  3X2M A;  5FTK A;  3GTK A;  2LW6 A;  3MB5 A;  5CCB A;  3ZJT A;  1E61 A;  1R27 A;  5ERG B;  2WB1 A;  2WAQ A;  1Y1V A;  5D6W A;  3SUK A;  2PJH B;  2JIQ A;  3SUL A;  2Q1C X;  4KLN A;  3X2H A;  2Q18 X;  2Q1A X;  3SUJ A;  1WLF A;  3O5A A;  2PJJ A;  4AYB A;  1DMR A;  5GLX A;  5CCX A;  4GA5 A;  1Y4Z A;  3X2G A;  2NYA A;  3QC8 A;  2O5J D;  2E7Z A;  1VC3 B;  2JIR A;  4FG4 A;  5FTM A;  3X2I A;  3TIW A;  5C1B A;  4FER A;  1PT0 A;  1PYU B;  4JP6 A;  3GTM A;  1CZ5 A;  2XDP A;  1YLE A;  1WC2 A;  2CW0 D;  4L48 A;  4UC4 A;  4ARI A;  1TWH A;  2VPW A;  5B6C A;  2YVL A;  1PT1 A;  2YUJ A;  1OGY A;  2AE0 X;  1PPY A;  2A69 D;  2IV2 X;  3FPU A;  4KDI A;  1SFO A;  2E2H A;  1R9T A;  3X2N A;  3ZGZ A;  3HKZ A;  1I50 A;  1Y1W A;  2V45 A;  2DMR A;  3TM7 B;  2A68 D;  3LHD A;  3GTO A;  1E5V A;  5T5M D;  1PQE A;  2R7Z A;  4KO8 A;  5FTJ A;  3PLX B;  4AVR A;  4AS1 A;  1ZC1 A;  3GTG A;  3ENG A;  2PI8 A;  5DYI A;  2VUM A;  2Q19 X;  1PQF A;  1YNN D;  2A6E D;  2NVY A;  4FG2 A;  1TWA A;  4ARC A;  1E60 A;  2NVX A;  2JIP A;  4D7Z B;  1Y5I A;  1H0H A;  2GFA A;  1Q16 A;  5CD1 A;  4DMR A;  1E18 A;  2VPZ A;  4ENG A;  4AOK B;  5D6X A;  4KOD A;  3M3G A;  1H5N A;  3OUG A;  2R92 A;  3X2P A;  1SMY D;  1OA9 A;  5GLY A;  2Y0S A;  5D6Y A;  3QWZ A;  2BH0 A;  1CR5 A;  2GAE A;  2PMZ A;  1I3Q A;  2GF7 A;  3H0G A;  1AA6 A;  2VPX A;  4FFT A;  1N10 A;  4ZM7 A;  2MM2 A;  3HU2 A;  3X2L A;  4C2M A;  1EU1 A;  2A6H D;  2PNW A;  2JA5 A;  1OA7 A;  1CZ4 A;  1L8F A;  2JA6 A;  2B25 A;  1DMS A;  3X2O A;  2JA7 A;  4AQ7 A;  3ZJV A;  4CRY G;  4AAY A;  3DMR A;  3CQZ A;  2C45 A;  1YNJ D;  2ENG A;  3D30 A;  3ML1 A;  4RV0 A;  1I9G A;  2JV2 A;  2G6G A;  2BE5 D;  1FDI A;  3GTL A;  1HD5 A;  1IW7 D;  5FTL A;  4JS7 A;  2VPY A;  1G8K A;  5GLF A;  5EQJ B;  1QCS A;  4FIB A;  3GTP A;  3FPR A;  4KDL A;  1PQH A;  1TWC A;  1ZYR D;  5EPP A;  2G5D A;  3QQ8 A;  3IR7 A;  3FKI A;  3GTJ A;  3SUM A;  2QQR A;  2HCZ X;  2NAP A;  3LGA A;  4AON B;  2PWY A;  4CQN A;  4JCW A;  1PYQ A;  3HU1 A;  2JIO A;  4NOH A;  5C18 A;  1BW4 A;  2MM0 A;  2EEO B;  5T5I D;  1S3S A;  1TWG A;  3X2K A;  1TWF A;  2Q1D X;  3IR6 A;  5DYG A;  2KQA A;  2PIC A;  1AW8 B;  3ZJU A; 
#chains in the Genus database with same CATH homology
 1KQF A;  3CF2 A;  2R93 A;  4CS0 A;  4CRZ A;  1FDO A;  2KI8 A;  1TMO A;  1SIW A;  3CZB A;  1UHE A;  2V3V A;  4GA6 A;  1KQG A;  2YU9 A;  4QIW A;  1UHD A;  1WCM A;  5FTN A;  1K83 A;  2JIM A;  3GTQ A;  2B63 A;  3BQB A;  1E32 A;  1QDN A;  2KY9 A;  3FPT A;  4AZD A;  2E2I A;  1O54 A;  2QQS A;  3IR5 A;  1R7R A;  3QQ7 A;  3HU3 A;  1G8J A;  3MB5 A;  5FTK A;  5CCB A;  3ZJT A;  1E61 A;  1R27 A;  5ERG B;  2WB1 A;  2WAQ A;  1Y1V A;  5D6W A;  2PJH B;  2JIQ A;  2Q1C X;  4KLN A;  2Q18 X;  2Q1A X;  1WLF A;  3O5A A;  2PJJ A;  4AYB A;  1DMR A;  5CCX A;  4GA5 A;  1Y4Z A;  2NYA A;  3QC8 A;  2O5J D;  2E7Z A;  1VC3 B;  2JIR A;  5FTM A;  5C1B A;  2LW6 A;  3TIW A;  1CZ5 A;  1PT0 A;  1PYU B;  3GTM A;  2XDP A;  1YLE A;  2CW0 D;  4ARI A;  4UC4 A;  1TWH A;  2VPW A;  5B6C A;  2YVL A;  1PT1 A;  2YUJ A;  1OGY A;  2AE0 X;  1PPY A;  2A69 D;  2IV2 X;  3FPU A;  4KDI A;  1SFO A;  2E2H A;  1R9T A;  3ZGZ A;  3HKZ A;  1I50 A;  1Y1W A;  2V45 A;  2DMR A;  3TM7 B;  2A68 D;  3LHD A;  3GTO A;  1E5V A;  5T5M D;  1PQE A;  2R7Z A;  4KO8 A;  5FTJ A;  3PLX B;  4AS1 A;  1ZC1 A;  3GTG A;  5DYI A;  2PI8 A;  2VUM A;  2Q19 X;  1PQF A;  1YNN D;  2A6E D;  2NVY A;  1TWA A;  1E60 A;  2NVX A;  2JIP A;  4D7Z B;  1Y5I A;  1H0H A;  2GFA A;  1Q16 A;  5CD1 A;  4DMR A;  1E18 A;  2VPZ A;  4AOK B;  5D6X A;  4KOD A;  1H5N A;  3OUG A;  2R92 A;  1SMY D;  2Y0S A;  5D6Y A;  3QWZ A;  1CR5 A;  2GAE A;  2PMZ A;  1I3Q A;  2GF7 A;  3H0G A;  1AA6 A;  2VPX A;  2MM2 A;  3HU2 A;  4C2M A;  1EU1 A;  2A6H D;  2PNW A;  2JA5 A;  1CZ4 A;  2JA6 A;  2B25 A;  4AQ7 A;  1DMS A;  2JA7 A;  3ZJV A;  4CRY G;  4AAY A;  3DMR A;  3CQZ A;  2C45 A;  1YNJ D;  2JV2 A;  3ML1 A;  4RV0 A;  1I9G A;  2G6G A;  2BE5 D;  1FDI A;  3GTL A;  1IW7 D;  5FTL A;  2VPY A;  1G8K A;  5GLF A;  5EQJ B;  1QCS A;  4FIB A;  3GTP A;  3FPR A;  4KDL A;  1PQH A;  1TWC A;  1ZYR D;  5EPP A;  2G5D A;  3QQ8 A;  3IR7 A;  3FKI A;  3GTJ A;  2QQR A;  3LGA A;  4ARC A;  2NAP A;  4AON B;  2PWY A;  4CQN A;  5C18 A;  1PYQ A;  3HU1 A;  2JIO A;  4NOH A;  2MM0 A;  2EEO B;  5T5I D;  1S3S A;  1TWG A;  1TWF A;  2Q1D X;  3IR6 A;  5DYG A;  3GTK A;  2PIC A;  1AW8 B;  3ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...