5EPPA

Structural insights into the interaction of p97 n-terminus domain and vbm motif in rhomboid protease, rhbdl4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
b'NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural insights into the interaction of p97 N-terminus domain and VBM in rhomboid protease, RHBDL4.
pubmed doi rcsb
total genus 46
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5eppA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5eppA02
3HU1A 1SIWA 2B63A 1TMOA 1R27A 1KQGA 2DMRA 5FTJA 4C2MA 3GTLA 3OUGA 1EU1A 4KDIA 4KLNA 1G8JA 2R7ZA 2YUJA 3IR7A 3HU2A 1S3SA 2R93A 1TWGA 3IR5A 4KO8A 5FTNA 3HKZA 4KODA 3QQ8A 1PYQA 1TWFA 3TM7B 2VPXA 1QCSA 3IR6A 4GA6A 2WB1A 1E61A 3GTJA 2VPZA 3HU3A 2NAPA 2VPWA 2E2IA 5B6CA 1H0HA 1AA6A 1WCMA 3GTGA 2PMZA 3GTMA 2NYAA 2IV2X 1UHDA 2KI8A 1OGYA 3PLXB 1E32A 1FDOA 4QIWA 1TWAA 5FTMA 3GTQA 4RV0A 4GA5A 1AW8B 5T5ID 1PQFA 3QQ7A 3GTKA 1CR5A 5DYGA 2VPYA 1UHEA 5GLFA 2JIOA 1FDIA 4AYBA 4CRZA 1R9TA 5C1BA 5EPPA 1SFOA 2R92A 3H0GA 1CZ4A 5C18A 2E2HA 1PYUB 3TIWA 1DMRA 1R7RA 1H5NA 2NVXA 1TWCA 2JA7A 4AZDA 4CS0A 1CZ5A 3DMRA 2V3VA 2NVYA 5DYIA 4AOKB 5T5MD 2Y0SA 1TWHA 1DMSA 3GTPA 1Y1VA 3CQZA 1KQFA 2JIQA 1Y1WA 1ZC1A 1Y4ZA 1E5VA 2E7ZA 4DMRA 2JIRA 1E18A 1IW7D 1PQHA 3CF2A 1G8KA 4AAYA 2WAQA 2JIMA 4KDLA 3GTOA 3O5AA 2JV2A 1PQEA 1K83A 1QDNA 3QWZA 2EEOB 5FTLA 1VC3B 5FTKA 2V45A 1PT0A 2C45A 1YLEA 3FKIA 1Q16A 4AONB 2JIPA 1WLFA 2YU9A 2JA6A 1I3QA 2PJHB 1PT1A 4CRYG 2VUMA 1Y5IA 3QC8A 1I50A 1PPYA 3ML1A 1E60A 2JA5A 4D7ZB
chains in the Genus database with same CATH superfamily
5GM9A 3HU1A 2A68D 1SIWA 2B63A 1TMOA 1R27A 1KQGA 2DMRA 5FTJA 4C2MA 3GTLA 3ZJUA 3OUGA 2KQAA 1EU1A 4KDIA 4KLNA 1G8JA 3ZJTA 2YUJA 2R7ZA 3IR7A 3HU2A 3X2NA 1KQFA 1S3SA 2R93A 1TWGA 2MM2A 2G5DA 3IR5A 4KO8A 3X2OA 3LGAA 2HCZX 5FTNA 3HKZA 2GFAA 4KODA 5D6WA 4AS1A 4ARIA 3X2LA 3QQ8A 1PYQA 3ZGZA 2GF7A 4L48A 1TWFA 3TM7B 2PNWA 2VPXA 1QCSA 4FG2A 2B25A 4UC4A 4CQNA 3IR6A 4GA6A 2Q1AX 2WB1A 1E61A 5D6YA 4AQ7A 3GTJA 2Q1DX 2VPZA 2VPWA 2NAPA 3HU3A 3X2KA 2MM0A 1OA9A 4NOHA 2E2IA 5B6CA 1O54A 2PICA 1H0HA 1AA6A 1WCMA 3GTGA 2PMZA 3GTMA 2NYAA 2IV2X 1UHDA 2A6HD 2KI8A 1OGYA 4AVRA 5GLXA 3X2HA 3PLXB 1E32A 1FDOA 4QIWA 1TWAA 1YNND 4JS7A 5FTMA 3GTQA 4RV0A 4GA5A 3SUMA 1AW8B 5T5ID 2PWYA 1PQFA 3X2PA 3QQ7A 5CCBA 3GTKA 1CR5A 5DYGA 2Q1CX 2O5JD 2Q18X 2G6GA 2PJJA 1OA7A 1HD5A 2VPYA 1UHEA 5GLFA 2JIOA 4ARCA 1FDIA 4AYBA 3FPUA 4CRZA 1R9TA 2Q19X 5C1BA 5EPPA 1SFOA 1BW4A 1L8FA 2R92A 3H0GA 1CZ4A 5EQJB 4JCWA 5C18A 2E2HA 1PYUB 3ENGA 3TIWA 5CCXA 1N10A 1DMRA 2QQSA 1I9GA 1YNJD 1R7RA 1H5NA 2NVXA 1TWCA 2LW6A 2JA7A 3FPTA 2A69D 4AZDA 3BQBA 4CS0A 4FERA 4JJOA 3DMRA 2V3VA 2NVYA 3SULA 1CZ5A 3FPRA 3LHDA 3M3GA 5DYIA 4FG4A 4AOKB 5T5MD 5ERGB 2ENGA 2Y0SA 1BW3A 2XDPA 1TWHA 1DMSA 3GTPA 1Y1VA 2CW0D 3CQZA 1WC2A 2JIQA 1ZC1A 4JP6A 4ZM7A 5GLYA 1Y4ZA 1E5VA 3SUJA 2E7ZA 3X2JA 4DMRA 2JIRA 2PI8A 3X2GA 1E18A 1IW7D 1PQHA 2BH0A 3CF2A 1SMYD 1G8KA 2GAEA 3MB5A 4AAYA 4FIBA 2WAQA 2JIMA 4KDLA 2KY9A 3GTOA 2QQRA 3O5AA 5H4UA 2JV2A 5CD1A 3ZJVA 1PQEA 1K83A 1QDNA 3QWZA 2EEOB 5FTLA 1VC3B 3D30A 5FTKA 2V45A 3SUKA 2YVLA 5D6XA 2AE0X 2BE5D 4FFTA 1PT0A 2C45A 1YLEA 3FKIA 1Q16A 3X2MA 2JIPA 1WLFA 4AONB 4ENGA 2YU9A 1I3QA 2JA6A 2PJHB 1PT1A 2A6ED 4CRYG 2VUMA 1Y5IA 3QC8A 1I50A 1ZYRD 1PPYA 3X2IA 3ML1A 4JP7A 3CZBA 1E60A 1Y1WA 2JA5A 4D7ZB
chains in the Genus database with same CATH topology
3HU1A 2A68D 1SIWA 2B63A 1TMOA 1R27A 1KQGA 2DMRA 5FTJA 4C2MA 3GTLA 3ZJUA 3OUGA 1EU1A 4KDIA 4KLNA 1G8JA 3ZJTA 2YUJA 2R7ZA 3IR7A 3HU2A 1S3SA 2R93A 1TWGA 2MM2A 2G5DA 3IR5A 4KO8A 3LGAA 5FTNA 3HKZA 2GFAA 4KODA 5D6WA 4AS1A 4ARIA 3QQ8A 1PYQA 3ZGZA 1TWFA 3TM7B 2PNWA 2VPXA 1QCSA 2B25A 4UC4A 4CQNA 3IR6A 4GA6A 2Q1AX 2WB1A 1E61A 5D6YA 4AQ7A 3GTJA 2Q1DX 2VPZA 2VPWA 2NAPA 3HU3A 2MM0A 2E2IA 4NOHA 5B6CA 1O54A 2PICA 1H0HA 1AA6A 1WCMA 3GTGA 2PMZA 3GTMA 2NYAA 2IV2X 1UHDA 2A6HD 2KI8A 1OGYA 3PLXB 1E32A 1FDOA 4QIWA 1TWAA 1YNND 5FTMA 3GTQA 4RV0A 4GA5A 2PWYA 1AW8B 5T5ID 1PQFA 3QQ7A 5CCBA 3GTKA 1CR5A 5DYGA 2O5JD 2Q18X 2G6GA 2PJJA 2VPYA 1UHEA 5GLFA 2JIOA 4ARCA 1FDIA 4AYBA 3FPUA 4CRZA 1R9TA 2Q19X 5C1BA 5EPPA 1SFOA 2R92A 3H0GA 1CZ4A 5EQJB 5C18A 2E2HA 1PYUB 5CCXA 3TIWA 1DMRA 2QQSA 1YNJD 1R7RA 1H5NA 2NVXA 1TWCA 2LW6A 2JA7A 3FPTA 2A69D 4AZDA 3BQBA 4CS0A 1CZ5A 3DMRA 2V3VA 2NVYA 3LHDA 3FPRA 5DYIA 4AOKB 5T5MD 5ERGB 2Y0SA 2XDPA 1TWHA 1DMSA 3GTPA 1Y1VA 2CW0D 3CQZA 1ZC1A 2JIQA 1KQFA 1Y1WA 2GF7A 5CD1A 1Y4ZA 1E5VA 2E7ZA 4DMRA 2JIRA 2PI8A 1E18A 1IW7D 1PQHA 3CF2A 1SMYD 1G8KA 2GAEA 3MB5A 4AAYA 4FIBA 2WAQA 2JIMA 4KDLA 2KY9A 3GTOA 2QQRA 3O5AA 2JV2A 3ZJVA 1PQEA 1K83A 1QDNA 3QWZA 2EEOB 5FTLA 1VC3B 2YVLA 5FTKA 2V45A 5D6XA 2AE0X 2BE5D 1PT0A 2C45A 1YLEA 3FKIA 1Q16A 4AONB 2JIPA 1WLFA 2YU9A 2JA6A 1I9GA 1I3QA 2Q1CX 2PJHB 1PT1A 2A6ED 4CRYG 2VUMA 1Y5IA 3QC8A 1I50A 1ZYRD 1PPYA 3ML1A 3CZBA 1E60A 2JA5A 4D7ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HU1 A;  1SIW A;  2B63 A;  1TMO A;  1R27 A;  1KQG A;  2DMR A;  5FTJ A;  4C2M A;  3GTL A;  3OUG A;  1EU1 A;  4KDI A;  4KLN A;  1G8J A;  2R7Z A;  2YUJ A;  3IR7 A;  3HU2 A;  1S3S A;  2R93 A;  1TWG A;  3IR5 A;  4KO8 A;  5FTN A;  3HKZ A;  4KOD A;  3QQ8 A;  1PYQ A;  1TWF A;  3TM7 B;  2VPX A;  1QCS A;  3IR6 A;  4GA6 A;  2WB1 A;  1E61 A;  3GTJ A;  2VPZ A;  3HU3 A;  2NAP A;  2VPW A;  2E2I A;  5B6C A;  1H0H A;  1AA6 A;  1WCM A;  3GTG A;  2PMZ A;  3GTM A;  2NYA A;  2IV2 X;  1UHD A;  2KI8 A;  1OGY A;  3PLX B;  1E32 A;  1FDO A;  4QIW A;  1TWA A;  5FTM A;  3GTQ A;  4RV0 A;  4GA5 A;  1AW8 B;  5T5I D;  1PQF A;  3QQ7 A;  3GTK A;  1CR5 A;  5DYG A;  2VPY A;  1UHE A;  5GLF A;  2JIO A;  1FDI A;  4AYB A;  4CRZ A;  1R9T A;  5C1B A;  5EPP A;  1SFO A;  2R92 A;  3H0G A;  1CZ4 A;  5C18 A;  2E2H A;  1PYU B;  3TIW A;  1DMR A;  1R7R A;  1H5N A;  2NVX A;  1TWC A;  2JA7 A;  4AZD A;  4CS0 A;  1CZ5 A;  3DMR A;  2V3V A;  2NVY A;  5DYI A;  4AOK B;  5T5M D;  2Y0S A;  1TWH A;  1DMS A;  3GTP A;  1Y1V A;  3CQZ A;  1KQF A;  2JIQ A;  1Y1W A;  1ZC1 A;  1Y4Z A;  1E5V A;  2E7Z A;  4DMR A;  2JIR A;  1E18 A;  1IW7 D;  1PQH A;  3CF2 A;  1G8K A;  4AAY A;  2WAQ A;  2JIM A;  4KDL A;  3GTO A;  3O5A A;  2JV2 A;  1PQE A;  1K83 A;  1QDN A;  3QWZ A;  2EEO B;  5FTL A;  1VC3 B;  5FTK A;  2V45 A;  1PT0 A;  2C45 A;  1YLE A;  3FKI A;  1Q16 A;  4AON B;  2JIP A;  1WLF A;  2YU9 A;  2JA6 A;  1I3Q A;  2PJH B;  1PT1 A;  4CRY G;  2VUM A;  1Y5I A;  3QC8 A;  1I50 A;  1PPY A;  3ML1 A;  1E60 A;  2JA5 A;  4D7Z B; 
#chains in the Genus database with same CATH topology
 5GM9 A;  3HU1 A;  2A68 D;  1SIW A;  2B63 A;  1TMO A;  1R27 A;  1KQG A;  2DMR A;  5FTJ A;  4C2M A;  3GTL A;  3ZJU A;  3OUG A;  2KQA A;  1EU1 A;  4KDI A;  4KLN A;  1G8J A;  3ZJT A;  2YUJ A;  2R7Z A;  3IR7 A;  3HU2 A;  3X2N A;  1KQF A;  1S3S A;  2R93 A;  1TWG A;  2MM2 A;  2G5D A;  3IR5 A;  4KO8 A;  3X2O A;  3LGA A;  2HCZ X;  5FTN A;  3HKZ A;  2GFA A;  4KOD A;  5D6W A;  4AS1 A;  4ARI A;  3X2L A;  3QQ8 A;  1PYQ A;  3ZGZ A;  2GF7 A;  4L48 A;  1TWF A;  3TM7 B;  2PNW A;  2VPX A;  1QCS A;  4FG2 A;  2B25 A;  4UC4 A;  4CQN A;  3IR6 A;  4GA6 A;  2Q1A X;  2WB1 A;  1E61 A;  5D6Y A;  4AQ7 A;  3GTJ A;  2Q1D X;  2VPZ A;  2VPW A;  2NAP A;  3HU3 A;  3X2K A;  2MM0 A;  1OA9 A;  4NOH A;  2E2I A;  5B6C A;  1O54 A;  2PIC A;  1H0H A;  1AA6 A;  1WCM A;  3GTG A;  2PMZ A;  3GTM A;  2NYA A;  2IV2 X;  1UHD A;  2A6H D;  2KI8 A;  1OGY A;  4AVR A;  5GLX A;  3X2H A;  3PLX B;  1E32 A;  1FDO A;  4QIW A;  1TWA A;  1YNN D;  4JS7 A;  5FTM A;  3GTQ A;  4RV0 A;  4GA5 A;  3SUM A;  1AW8 B;  5T5I D;  2PWY A;  1PQF A;  3X2P A;  3QQ7 A;  5CCB A;  3GTK A;  1CR5 A;  5DYG A;  2Q1C X;  2O5J D;  2Q18 X;  2G6G A;  2PJJ A;  1OA7 A;  1HD5 A;  2VPY A;  1UHE A;  5GLF A;  2JIO A;  4ARC A;  1FDI A;  4AYB A;  3FPU A;  4CRZ A;  1R9T A;  2Q19 X;  5C1B A;  5EPP A;  1SFO A;  1BW4 A;  1L8F A;  2R92 A;  3H0G A;  1CZ4 A;  5EQJ B;  4JCW A;  5C18 A;  2E2H A;  1PYU B;  3ENG A;  3TIW A;  5CCX A;  1N10 A;  1DMR A;  2QQS A;  1I9G A;  1YNJ D;  1R7R A;  1H5N A;  2NVX A;  1TWC A;  2LW6 A;  2JA7 A;  3FPT A;  2A69 D;  4AZD A;  3BQB A;  4CS0 A;  4FER A;  4JJO A;  3DMR A;  2V3V A;  2NVY A;  3SUL A;  1CZ5 A;  3FPR A;  3LHD A;  3M3G A;  5DYI A;  4FG4 A;  4AOK B;  5T5M D;  5ERG B;  2ENG A;  2Y0S A;  1BW3 A;  2XDP A;  1TWH A;  1DMS A;  3GTP A;  1Y1V A;  2CW0 D;  3CQZ A;  1WC2 A;  2JIQ A;  1ZC1 A;  4JP6 A;  4ZM7 A;  5GLY A;  1Y4Z A;  1E5V A;  3SUJ A;  2E7Z A;  3X2J A;  4DMR A;  2JIR A;  2PI8 A;  3X2G A;  1E18 A;  1IW7 D;  1PQH A;  2BH0 A;  3CF2 A;  1SMY D;  1G8K A;  2GAE A;  3MB5 A;  4AAY A;  4FIB A;  2WAQ A;  2JIM A;  4KDL A;  2KY9 A;  3GTO A;  2QQR A;  3O5A A;  5H4U A;  2JV2 A;  5CD1 A;  3ZJV A;  1PQE A;  1K83 A;  1QDN A;  3QWZ A;  2EEO B;  5FTL A;  1VC3 B;  3D30 A;  5FTK A;  2V45 A;  3SUK A;  2YVL A;  5D6X A;  2AE0 X;  2BE5 D;  4FFT A;  1PT0 A;  2C45 A;  1YLE A;  3FKI A;  1Q16 A;  3X2M A;  2JIP A;  1WLF A;  4AON B;  4ENG A;  2YU9 A;  1I3Q A;  2JA6 A;  2PJH B;  1PT1 A;  2A6E D;  4CRY G;  2VUM A;  1Y5I A;  3QC8 A;  1I50 A;  1ZYR D;  1PPY A;  3X2I A;  3ML1 A;  4JP7 A;  3CZB A;  1E60 A;  1Y1W A;  2JA5 A;  4D7Z B; 
#chains in the Genus database with same CATH homology
 3HU1 A;  2A68 D;  1SIW A;  2B63 A;  1TMO A;  1R27 A;  1KQG A;  2DMR A;  5FTJ A;  4C2M A;  3GTL A;  3ZJU A;  3OUG A;  1EU1 A;  4KDI A;  4KLN A;  1G8J A;  3ZJT A;  2YUJ A;  2R7Z A;  3IR7 A;  3HU2 A;  1S3S A;  2R93 A;  1TWG A;  2MM2 A;  2G5D A;  3IR5 A;  4KO8 A;  3LGA A;  5FTN A;  3HKZ A;  2GFA A;  4KOD A;  5D6W A;  4AS1 A;  4ARI A;  3QQ8 A;  1PYQ A;  3ZGZ A;  1TWF A;  3TM7 B;  2PNW A;  2VPX A;  1QCS A;  2B25 A;  4UC4 A;  4CQN A;  3IR6 A;  4GA6 A;  2Q1A X;  2WB1 A;  1E61 A;  5D6Y A;  4AQ7 A;  3GTJ A;  2Q1D X;  2VPZ A;  2VPW A;  2NAP A;  3HU3 A;  2MM0 A;  2E2I A;  4NOH A;  5B6C A;  1O54 A;  2PIC A;  1H0H A;  1AA6 A;  1WCM A;  3GTG A;  2PMZ A;  3GTM A;  2NYA A;  2IV2 X;  1UHD A;  2A6H D;  2KI8 A;  1OGY A;  3PLX B;  1E32 A;  1FDO A;  4QIW A;  1TWA A;  1YNN D;  5FTM A;  3GTQ A;  4RV0 A;  4GA5 A;  2PWY A;  1AW8 B;  5T5I D;  1PQF A;  3QQ7 A;  5CCB A;  3GTK A;  1CR5 A;  5DYG A;  2O5J D;  2Q18 X;  2G6G A;  2PJJ A;  2VPY A;  1UHE A;  5GLF A;  2JIO A;  4ARC A;  1FDI A;  4AYB A;  3FPU A;  4CRZ A;  1R9T A;  2Q19 X;  5C1B A;  5EPP A;  1SFO A;  2R92 A;  3H0G A;  1CZ4 A;  5EQJ B;  5C18 A;  2E2H A;  1PYU B;  5CCX A;  3TIW A;  1DMR A;  2QQS A;  1YNJ D;  1R7R A;  1H5N A;  2NVX A;  1TWC A;  2LW6 A;  2JA7 A;  3FPT A;  2A69 D;  4AZD A;  3BQB A;  4CS0 A;  1CZ5 A;  3DMR A;  2V3V A;  2NVY A;  3LHD A;  3FPR A;  5DYI A;  4AOK B;  5T5M D;  5ERG B;  2Y0S A;  2XDP A;  1TWH A;  1DMS A;  3GTP A;  1Y1V A;  2CW0 D;  3CQZ A;  1ZC1 A;  2JIQ A;  1KQF A;  1Y1W A;  2GF7 A;  5CD1 A;  1Y4Z A;  1E5V A;  2E7Z A;  4DMR A;  2JIR A;  2PI8 A;  1E18 A;  1IW7 D;  1PQH A;  3CF2 A;  1SMY D;  1G8K A;  2GAE A;  3MB5 A;  4AAY A;  4FIB A;  2WAQ A;  2JIM A;  4KDL A;  2KY9 A;  3GTO A;  2QQR A;  3O5A A;  2JV2 A;  3ZJV A;  1PQE A;  1K83 A;  1QDN A;  3QWZ A;  2EEO B;  5FTL A;  1VC3 B;  2YVL A;  5FTK A;  2V45 A;  5D6X A;  2AE0 X;  2BE5 D;  1PT0 A;  2C45 A;  1YLE A;  3FKI A;  1Q16 A;  4AON B;  2JIP A;  1WLF A;  2YU9 A;  2JA6 A;  1I9G A;  1I3Q A;  2Q1C X;  2PJH B;  1PT1 A;  2A6E D;  4CRY G;  2VUM A;  1Y5I A;  3QC8 A;  1I50 A;  1ZYR D;  1PPY A;  3ML1 A;  3CZB A;  1E60 A;  2JA5 A;  4D7Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...