5EPPA

Structural insights into the interaction of p97 n-terminus domain and vbm motif in rhomboid protease, rhbdl4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
NRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural insights into the interaction of p97 N-terminus domain and VBM in rhomboid protease, RHBDL4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5eppA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5eppA02
4AONB 1PQHA 3IR7A 1I50A 1E61A 4GA5A 1ZC1A 1CZ4A 1TMOA 2NVXA 2JIRA 3QQ8A 1PYUB 1PQEA 1G8JA 3QWZA 1YLEA 5T5MD 3O5AA 1PQFA 2JA7A 2EEOB 1FDOA 3GTMA 1UHDA 2VPZA 1I3QA 3IR5A 4C2MA 2JV2A 3PLXB 1TWAA 5C1BA 2V3VA 5FTLA 1K83A 1DMRA 1R7RA 1UHEA 3CQZA 5FTMA 3H0GA 1CZ5A 4GA6A 1Y4ZA 3GTJA 2JIMA 4QIWA 3GTKA 2YUJA 1VC3B 3GTGA 4AZDA 4KDIA 2PJHB 2NAPA 3GTQA 3QC8A 1KQFA 4KO8A 4D7ZB 4RV0A 5B6CA 1FDIA 5FTKA 2VPWA 3TM7B 5FTJA 3CF2A 2WB1A 1H0HA 1DMSA 1H5NA 1OGYA 1SFOA 3GTPA 1E60A 1TWHA 1E32A 1EU1A 2R7ZA 1AW8B 1CR5A 2JA6A 2E7ZA 1G8KA 1AA6A 1Y5IA 1R9TA 1E18A 1WCMA 2NVYA 5GLFA 2R92A 1PT0A 1E5VA 1PPYA 1IW7D 2JA5A 2VPXA 3GTOA 5C18A 2R93A 3TIWA 1Y1VA 3HU3A 2DMRA 4AOKB 1QCSA 2WAQA 4KDLA 5DYIA 1Y1WA 1PYQA 3HKZA 2VPYA 1TWFA 2JIQA 4AAYA 2E2HA 3ML1A 3GTLA 1SIWA 3HU1A 2NYAA 2C45A 2PMZA 4CRZA 5DYGA 4DMRA 2JIPA 1S3SA 4KODA 3HU2A 2IV2X 4AYBA 3FKIA 1Q16A 2B63A 1PT1A 2V45A 3QQ7A 4CRYG 1KQGA 2YU9A 2E2IA 3DMRA 5T5ID 4CS0A 5EPPA 5FTNA 1TWGA 2JIOA 2VUMA 1R27A 1WLFA 2KI8A 3OUGA 4KLNA 1QDNA 3IR6A 2Y0SA 1TWCA
chains in the Genus database with same CATH superfamily
4AONB 1PQHA 3IR7A 4AS1A 1I50A 1E61A 4GA5A 1ZC1A 1CZ4A 1TMOA 2NVXA 1OA7A 2JIRA 3QQ8A 3M3GA 1PYUB 1PQEA 2A69D 1G8JA 3ZJVA 3QWZA 1YLEA 5T5MD 2O5JD 3O5AA 3MB5A 1PQFA 2JA7A 2EEOB 2HCZX 4CQNA 2MM0A 4FERA 1FDOA 3GTMA 1O54A 1UHDA 2VPZA 2GF7A 5GLYA 1I3QA 1YNND 3IR5A 3SUKA 4C2MA 2JV2A 3PLXB 1TWAA 5C1BA 2CW0D 2V3VA 5FTLA 3X2GA 1K83A 1DMRA 2Q1AX 4UC4A 4ARCA 2PJJA 1WC2A 1R7RA 5D6WA 3X2OA 4ARIA 1UHEA 3CQZA 5FTMA 2Q1CX 3H0GA 1CZ5A 4GA6A 3SUMA 2PWYA 5CD1A 1Y4ZA 2PNWA 3X2MA 3GTJA 4JP6A 3FPUA 4FG2A 5D6YA 2JIMA 2BH0A 4QIWA 3GTKA 2YUJA 1VC3B 3X2NA 3GTGA 4AZDA 4FIBA 4KDIA 2PJHB 1I9GA 2QQRA 2A6HD 3GTQA 3QC8A 4AVRA 1KQFA 3ZGZA 2PI8A 4KO8A 4FG4A 4D7ZB 2KY9A 4RV0A 3SUJA 2Q19X 2QQSA 5B6CA 3LGAA 3CZBA 1FDIA 2KQAA 4JCWA 5FTKA 2VPWA 2AE0X 3X2HA 1OA9A 3D30A 3TM7B 3X2PA 5FTJA 2XDPA 3CF2A 2WB1A 1H0HA 1DMSA 1H5NA 1OGYA 2GAEA 1SFOA 1E60A 3GTPA 1TWHA 2GFAA 1E32A 1EU1A 3X2JA 2Q18X 2YVLA 5CCBA 2MM2A 2R7ZA 1AW8B 1CR5A 3X2IA 2JA6A 2E7ZA 1BW3A 2Q1DX 1G8KA 4NOHA 1AA6A 1Y5IA 4JS7A 2LW6A 3LHDA 5H4UA 1R9TA 1E18A 1WCMA 2PICA 2NVYA 2G6GA 5GLFA 3X2LA 2G5DA 1PT0A 2R92A 1E5VA 1PPYA 1IW7D 2JA5A 2VPXA 3BQBA 3GTOA 4JP7A 5C18A 1L8FA 2R93A 3ZJUA 4FFTA 3TIWA 1Y1VA 3HU3A 2DMRA 1BW4A 4AOKB 1QCSA 5ERGB 5EQJB 2WAQA 4KDLA 5DYIA 1Y1WA 1PYQA 3SULA 1TWFA 2VPYA 3HKZA 2JIQA 4L48A 4AAYA 3ML1A 4ZM7A 1SIWA 3HU1A 2NYAA 3GTLA 3FPTA 2C45A 1YNJD 2PMZA 4CRZA 5DYGA 4DMRA 2JIPA 1S3SA 4ENGA 4KODA 2BE5D 3HU2A 2Y0SA 2IV2X 4AYBA 1N10A 3FKIA 3X2KA 1Q16A 2ENGA 2B63A 5D6XA 1PT1A 4AQ7A 2V45A 3QQ7A 4CRYG 3ENGA 2A68D 1KQGA 2YU9A 2B25A 5GLXA 2E2IA 5CCXA 1SMYD 3DMRA 5T5ID 4CS0A 1HD5A 1ZYRD 5EPPA 1TWGA 5FTNA 2A6ED 5GM9A 3ZJTA 2JIOA 2VUMA 1R27A 1WLFA 2KI8A 3OUGA 4KLNA 2E2HA 4JJOA 3FPRA 1QDNA 3IR6A 2NAPA 1TWCA
chains in the Genus database with same CATH topology
4AONB 1PQHA 3IR7A 4AS1A 1I50A 1E61A 4GA5A 1ZC1A 1CZ4A 1TMOA 2NVXA 2JIRA 3QQ8A 1PYUB 1PQEA 2A69D 1G8JA 3ZJVA 3QWZA 1YLEA 5T5MD 2O5JD 3O5AA 3MB5A 1PQFA 2JA7A 2EEOB 4CQNA 2MM0A 1FDOA 3GTMA 1O54A 1UHDA 2VPZA 2GF7A 1I3QA 1YNND 3IR5A 4C2MA 2JV2A 3PLXB 1TWAA 5C1BA 2CW0D 2V3VA 5FTLA 1K83A 2Q1AX 1DMRA 4UC4A 4ARCA 2PJJA 1R7RA 5D6WA 4ARIA 1UHEA 3CQZA 5FTMA 2Q1CX 3H0GA 1CZ5A 4GA6A 2PWYA 5CD1A 1Y4ZA 2PNWA 3GTJA 3FPUA 5D6YA 2JIMA 4QIWA 3GTKA 2YUJA 1VC3B 3GTGA 4AZDA 4FIBA 4KDIA 2PJHB 1I9GA 2QQRA 2A6HD 3GTQA 3QC8A 1KQFA 3ZGZA 2PI8A 4KO8A 2KY9A 4D7ZB 4RV0A 2Q19X 2QQSA 5B6CA 3LGAA 3CZBA 1FDIA 5FTKA 2VPWA 2AE0X 2XDPA 3TM7B 5FTJA 3CF2A 2WB1A 1H0HA 1DMSA 1H5NA 1OGYA 2GAEA 1SFOA 1E60A 3GTPA 1TWHA 2GFAA 1E32A 1EU1A 2Q18X 5CCBA 2YVLA 2MM2A 2R7ZA 1AW8B 1CR5A 2JA6A 2E7ZA 2Q1DX 1G8KA 4NOHA 1AA6A 1Y5IA 2LW6A 3LHDA 1R9TA 1E18A 1WCMA 2PICA 2NVYA 2G6GA 5GLFA 2G5DA 1PT0A 2R92A 1E5VA 1PPYA 1IW7D 2JA5A 2VPXA 3BQBA 3GTOA 5C18A 2R93A 3ZJUA 3TIWA 1Y1VA 3HU3A 2DMRA 4AOKB 1QCSA 5ERGB 5EQJB 2WAQA 4KDLA 5DYIA 1Y1WA 1PYQA 1TWFA 2VPYA 3HKZA 2JIQA 4AAYA 2E2HA 3ML1A 3GTLA 1SIWA 3HU1A 2NYAA 3FPTA 2C45A 1YNJD 2PMZA 4CRZA 5DYGA 4DMRA 2JIPA 1S3SA 4KODA 2BE5D 3HU2A 2Y0SA 2IV2X 4AYBA 3FKIA 1Q16A 2B63A 5D6XA 1PT1A 4AQ7A 2V45A 3QQ7A 4CRYG 2B25A 2A68D 1KQGA 2YU9A 5CCXA 2E2IA 1SMYD 3DMRA 5T5ID 4CS0A 1ZYRD 5EPPA 1TWGA 5FTNA 2A6ED 3ZJTA 2JIOA 2VUMA 1R27A 1WLFA 2KI8A 3OUGA 4KLNA 3FPRA 1QDNA 3IR6A 2NAPA 1TWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AON B;  1PQH A;  3IR7 A;  1I50 A;  1E61 A;  4GA5 A;  1ZC1 A;  1CZ4 A;  1TMO A;  2NVX A;  2JIR A;  3QQ8 A;  1PYU B;  1PQE A;  1G8J A;  3QWZ A;  1YLE A;  5T5M D;  3O5A A;  1PQF A;  2JA7 A;  2EEO B;  1FDO A;  3GTM A;  1UHD A;  2VPZ A;  1I3Q A;  3IR5 A;  4C2M A;  2JV2 A;  3PLX B;  1TWA A;  5C1B A;  2V3V A;  5FTL A;  1K83 A;  1DMR A;  1R7R A;  1UHE A;  3CQZ A;  5FTM A;  3H0G A;  1CZ5 A;  4GA6 A;  1Y4Z A;  3GTJ A;  2JIM A;  4QIW A;  3GTK A;  2YUJ A;  1VC3 B;  3GTG A;  4AZD A;  4KDI A;  2PJH B;  2NAP A;  3GTQ A;  3QC8 A;  1KQF A;  4KO8 A;  4D7Z B;  4RV0 A;  5B6C A;  1FDI A;  5FTK A;  2VPW A;  3TM7 B;  5FTJ A;  3CF2 A;  2WB1 A;  1H0H A;  1DMS A;  1H5N A;  1OGY A;  1SFO A;  3GTP A;  1E60 A;  1TWH A;  1E32 A;  1EU1 A;  2R7Z A;  1AW8 B;  1CR5 A;  2JA6 A;  2E7Z A;  1G8K A;  1AA6 A;  1Y5I A;  1R9T A;  1E18 A;  1WCM A;  2NVY A;  5GLF A;  2R92 A;  1PT0 A;  1E5V A;  1PPY A;  1IW7 D;  2JA5 A;  2VPX A;  3GTO A;  5C18 A;  2R93 A;  3TIW A;  1Y1V A;  3HU3 A;  2DMR A;  4AOK B;  1QCS A;  2WAQ A;  4KDL A;  5DYI A;  1Y1W A;  1PYQ A;  3HKZ A;  2VPY A;  1TWF A;  2JIQ A;  4AAY A;  2E2H A;  3ML1 A;  3GTL A;  1SIW A;  3HU1 A;  2NYA A;  2C45 A;  2PMZ A;  4CRZ A;  5DYG A;  4DMR A;  2JIP A;  1S3S A;  4KOD A;  3HU2 A;  2IV2 X;  4AYB A;  3FKI A;  1Q16 A;  2B63 A;  1PT1 A;  2V45 A;  3QQ7 A;  4CRY G;  1KQG A;  2YU9 A;  2E2I A;  3DMR A;  5T5I D;  4CS0 A;  5EPP A;  5FTN A;  1TWG A;  2JIO A;  2VUM A;  1R27 A;  1WLF A;  2KI8 A;  3OUG A;  4KLN A;  1QDN A;  3IR6 A;  2Y0S A;  1TWC A; 
#chains in the Genus database with same CATH topology
 4AON B;  1PQH A;  3IR7 A;  4AS1 A;  1I50 A;  1E61 A;  4GA5 A;  1ZC1 A;  1CZ4 A;  1TMO A;  2NVX A;  1OA7 A;  2JIR A;  3QQ8 A;  3M3G A;  1PYU B;  1PQE A;  2A69 D;  1G8J A;  3ZJV A;  3QWZ A;  1YLE A;  5T5M D;  2O5J D;  3O5A A;  3MB5 A;  1PQF A;  2JA7 A;  2EEO B;  2HCZ X;  4CQN A;  2MM0 A;  4FER A;  1FDO A;  3GTM A;  1O54 A;  1UHD A;  2VPZ A;  2GF7 A;  5GLY A;  1I3Q A;  1YNN D;  3IR5 A;  3SUK A;  4C2M A;  2JV2 A;  3PLX B;  1TWA A;  5C1B A;  2CW0 D;  2V3V A;  5FTL A;  3X2G A;  1K83 A;  1DMR A;  2Q1A X;  4UC4 A;  4ARC A;  2PJJ A;  1WC2 A;  1R7R A;  5D6W A;  3X2O A;  4ARI A;  1UHE A;  3CQZ A;  5FTM A;  2Q1C X;  3H0G A;  1CZ5 A;  4GA6 A;  3SUM A;  2PWY A;  5CD1 A;  1Y4Z A;  2PNW A;  3X2M A;  3GTJ A;  4JP6 A;  3FPU A;  4FG2 A;  5D6Y A;  2JIM A;  2BH0 A;  4QIW A;  3GTK A;  2YUJ A;  1VC3 B;  3X2N A;  3GTG A;  4AZD A;  4FIB A;  4KDI A;  2PJH B;  1I9G A;  2QQR A;  2A6H D;  3GTQ A;  3QC8 A;  4AVR A;  1KQF A;  3ZGZ A;  2PI8 A;  4KO8 A;  4FG4 A;  4D7Z B;  2KY9 A;  4RV0 A;  3SUJ A;  2Q19 X;  2QQS A;  5B6C A;  3LGA A;  3CZB A;  1FDI A;  2KQA A;  4JCW A;  5FTK A;  2VPW A;  2AE0 X;  3X2H A;  1OA9 A;  3D30 A;  3TM7 B;  3X2P A;  5FTJ A;  2XDP A;  3CF2 A;  2WB1 A;  1H0H A;  1DMS A;  1H5N A;  1OGY A;  2GAE A;  1SFO A;  1E60 A;  3GTP A;  1TWH A;  2GFA A;  1E32 A;  1EU1 A;  3X2J A;  2Q18 X;  2YVL A;  5CCB A;  2MM2 A;  2R7Z A;  1AW8 B;  1CR5 A;  3X2I A;  2JA6 A;  2E7Z A;  1BW3 A;  2Q1D X;  1G8K A;  4NOH A;  1AA6 A;  1Y5I A;  4JS7 A;  2LW6 A;  3LHD A;  5H4U A;  1R9T A;  1E18 A;  1WCM A;  2PIC A;  2NVY A;  2G6G A;  5GLF A;  3X2L A;  2G5D A;  1PT0 A;  2R92 A;  1E5V A;  1PPY A;  1IW7 D;  2JA5 A;  2VPX A;  3BQB A;  3GTO A;  4JP7 A;  5C18 A;  1L8F A;  2R93 A;  3ZJU A;  4FFT A;  3TIW A;  1Y1V A;  3HU3 A;  2DMR A;  1BW4 A;  4AOK B;  1QCS A;  5ERG B;  5EQJ B;  2WAQ A;  4KDL A;  5DYI A;  1Y1W A;  1PYQ A;  3SUL A;  1TWF A;  2VPY A;  3HKZ A;  2JIQ A;  4L48 A;  4AAY A;  3ML1 A;  4ZM7 A;  1SIW A;  3HU1 A;  2NYA A;  3GTL A;  3FPT A;  2C45 A;  1YNJ D;  2PMZ A;  4CRZ A;  5DYG A;  4DMR A;  2JIP A;  1S3S A;  4ENG A;  4KOD A;  2BE5 D;  3HU2 A;  2Y0S A;  2IV2 X;  4AYB A;  1N10 A;  3FKI A;  3X2K A;  1Q16 A;  2ENG A;  2B63 A;  5D6X A;  1PT1 A;  4AQ7 A;  2V45 A;  3QQ7 A;  4CRY G;  3ENG A;  2A68 D;  1KQG A;  2YU9 A;  2B25 A;  5GLX A;  2E2I A;  5CCX A;  1SMY D;  3DMR A;  5T5I D;  4CS0 A;  1HD5 A;  1ZYR D;  5EPP A;  1TWG A;  5FTN A;  2A6E D;  5GM9 A;  3ZJT A;  2JIO A;  2VUM A;  1R27 A;  1WLF A;  2KI8 A;  3OUG A;  4KLN A;  2E2H A;  4JJO A;  3FPR A;  1QDN A;  3IR6 A;  2NAP A;  1TWC A; 
#chains in the Genus database with same CATH homology
 4AON B;  1PQH A;  3IR7 A;  4AS1 A;  1I50 A;  1E61 A;  4GA5 A;  1ZC1 A;  1CZ4 A;  1TMO A;  2NVX A;  2JIR A;  3QQ8 A;  1PYU B;  1PQE A;  2A69 D;  1G8J A;  3ZJV A;  3QWZ A;  1YLE A;  5T5M D;  2O5J D;  3O5A A;  3MB5 A;  1PQF A;  2JA7 A;  2EEO B;  4CQN A;  2MM0 A;  1FDO A;  3GTM A;  1O54 A;  1UHD A;  2VPZ A;  2GF7 A;  1I3Q A;  1YNN D;  3IR5 A;  4C2M A;  2JV2 A;  3PLX B;  1TWA A;  5C1B A;  2CW0 D;  2V3V A;  5FTL A;  1K83 A;  2Q1A X;  1DMR A;  4UC4 A;  4ARC A;  2PJJ A;  1R7R A;  5D6W A;  4ARI A;  1UHE A;  3CQZ A;  5FTM A;  2Q1C X;  3H0G A;  1CZ5 A;  4GA6 A;  2PWY A;  5CD1 A;  1Y4Z A;  2PNW A;  3GTJ A;  3FPU A;  5D6Y A;  2JIM A;  4QIW A;  3GTK A;  2YUJ A;  1VC3 B;  3GTG A;  4AZD A;  4FIB A;  4KDI A;  2PJH B;  1I9G A;  2QQR A;  2A6H D;  3GTQ A;  3QC8 A;  1KQF A;  3ZGZ A;  2PI8 A;  4KO8 A;  2KY9 A;  4D7Z B;  4RV0 A;  2Q19 X;  2QQS A;  5B6C A;  3LGA A;  3CZB A;  1FDI A;  5FTK A;  2VPW A;  2AE0 X;  2XDP A;  3TM7 B;  5FTJ A;  3CF2 A;  2WB1 A;  1H0H A;  1DMS A;  1H5N A;  1OGY A;  2GAE A;  1SFO A;  1E60 A;  3GTP A;  1TWH A;  2GFA A;  1E32 A;  1EU1 A;  2Q18 X;  5CCB A;  2YVL A;  2MM2 A;  2R7Z A;  1AW8 B;  1CR5 A;  2JA6 A;  2E7Z A;  2Q1D X;  1G8K A;  4NOH A;  1AA6 A;  1Y5I A;  2LW6 A;  3LHD A;  1R9T A;  1E18 A;  1WCM A;  2PIC A;  2NVY A;  2G6G A;  5GLF A;  2G5D A;  1PT0 A;  2R92 A;  1E5V A;  1PPY A;  1IW7 D;  2JA5 A;  2VPX A;  3BQB A;  3GTO A;  5C18 A;  2R93 A;  3ZJU A;  3TIW A;  1Y1V A;  3HU3 A;  2DMR A;  4AOK B;  1QCS A;  5ERG B;  5EQJ B;  2WAQ A;  4KDL A;  5DYI A;  1Y1W A;  1PYQ A;  1TWF A;  2VPY A;  3HKZ A;  2JIQ A;  4AAY A;  2E2H A;  3ML1 A;  3GTL A;  1SIW A;  3HU1 A;  2NYA A;  3FPT A;  2C45 A;  1YNJ D;  2PMZ A;  4CRZ A;  5DYG A;  4DMR A;  2JIP A;  1S3S A;  4KOD A;  2BE5 D;  3HU2 A;  2Y0S A;  2IV2 X;  4AYB A;  3FKI A;  1Q16 A;  2B63 A;  5D6X A;  1PT1 A;  4AQ7 A;  2V45 A;  3QQ7 A;  4CRY G;  2B25 A;  2A68 D;  1KQG A;  2YU9 A;  5CCX A;  2E2I A;  1SMY D;  3DMR A;  5T5I D;  4CS0 A;  1ZYR D;  5EPP A;  1TWG A;  5FTN A;  2A6E D;  3ZJT A;  2JIO A;  2VUM A;  1R27 A;  1WLF A;  2KI8 A;  3OUG A;  4KLN A;  3FPR A;  1QDN A;  3IR6 A;  2NAP A;  1TWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...