2QQSA

Jmjd2a tandem tudor domains in complex with a trimethylated histone h4-k20 peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Distinct binding modes specify the recognition of methylated histones H3K4 and H4K20 by JMJD2A-tudor.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqsA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2qqsA02
3E9FA 3S6WA 3L2VA 2R5AA 3PNWC 3OYKA 2RJCA 1OYXA 3ZEHA 3QBYA 3E9GA 3MEWA 4C5GA 3OYAA 2HQXA 2L89A 4BDYA 3ASKA 3H6ZA 3OY9A 2RI2A 2BKDN 3OYNA 2RHZA 2VYTA 4OVAA 4QQ6A 4PLIA 1OZ2A 4QQDA 3OS2A 2L3RA 3P8DA 3META 4Z02A 4C5IA 3OS1A 3LGFA 4QQGA 4E7LA 5FRNA 2DAQA 2LCCA 1WJSA 1XNIA 2LDMA 2M16A 3ME9A 3DLMA 4PL6A 4QW2A 3UWNA 2X4WA 2EQMA 4A4FA 2G3RA 5M9OA 4FL6A 3L2WA 2YRVA 5IN1A 2JZ2A 5J39A 3OYMA 2MWOA 3L42A 5KH6A 2M1HA 3EAEA 5IAYA 3LH0A 4C5HA 5KE2A 2PQWA 4BD3A 3LGLA 3PMTA 5C6SA 3CEYA 3L2RA 3L2UA 2R5MA 5D6XA 2NLUA 4IUTA 1WJQA 3PMIA 3LLRA 3OYIA 3NTIA 5J26A 3DB3A 2BIVA 2FHDA 2K3XA 5KCOA 2DIQA 4IKFA 3FLGA 4B9XA 2K3YA 2LVMA 2MWPA 3MP1A 4E7IA 5KE3A 2RHUA 4B9WA 5C0MA 2M0OA 4GY5A 2D9TA 2HQEA 2O4XB 2QQSA 3MP6A 2RI5A 3MP8A 4FU6A 4N4IA 2CKKA 3OYFA 3NTHA 2RI3A 2EFIA 2WACA 3C4SA 4N4HA 3S3OA 4A4GA 4CRIA 4E7HA 2EKOA 1OI1A 1SSFA 3NTKA 2B8AA 4RG2A 5CIUA 2XDPA 3O8VA 3QIIA 4A4EA 3OYHA 1G5VA 5FRMA 2GFUA 3FC3A 4II1A 3M9QA 2RHXA 3DB4A 4ZTJA 3MO8A 4ZTFA 2E5QA 3OQ5A 3OA6A 3LX7A 3MEVA 4NS5A 4BE1A 2RJFA 3OS0A 2EQUA 1RI0A 2EQKA 2X4YA 2RJEA 1H3ZA 4N4GA 3OMCA 5D6YA 2LRQA 4IUVA 3OYDA 3GOXA 3H8ZA 2RHYA 3QKJA 5D6WA 1KHCA 2XK0A 4IUUA 4Q5WA 5KCHA 4IUPA 4IUQA 3OYCA 4LD6A 2BUDA 2O4XA 2RHIA 3FEOA 1N27A 2DIGA 4E7JA 2R57A 4X34A 3SD4A 3OYBA 3OYJA 4BE2A 2X4XA 3QJ6A 4UC4A 2F5KA 4IURA 3S3NA 3KUFA 2JTFA 4BE0A 3MEUA 3UT1A 3L2QA 4PLLA 3OYLA 3OYGA 3LYIA 3MEAA 1WJRA 5FROA 3OB9A 3OYEA 2L8DA 2LTOA 4BACA 4A4HA 2E6NA 2QQRA 2X35A 1WGSA 4E7KA 3Q1JA 1MHNA 3F70A 3FDRA 4BDZA 2GF7A 4HCZA 3PFSA 4L59A 2P0KA 3OMGA 4C5EA 4EDUA 2IG0A 2GFAA 2RO0A 2RJDA 3S3MA 3P8HA 4QVZA 1OZ3A 3BDLA 2EQJA 2R58A
chains in the Genus database with same CATH superfamily
2C06A 1SPKA 1WXBA 2AIRB 1BYMA 3X24B 1QWEA 4AFQC 5I21A 5GAOl 4PJJA 1YITT 1D0ZA 5KYYA 1QW1A 2C0OA 1I81A 4PLIA 3WVDB 1OZ2A 1B34A 1VQLT 1VQ9A 1RAAB 2SRCA 3PGGA 1VQOA 5LL6S 5M9OA 5LJ3d 3L2WA 1QKWA 2E5KA 1PC0A 3M58A 3VV0A 3N5BB 4GLKA 5AYFA 2EGCA 1B7TA 2GQVA 2QTVA 2CP0A 4KO8A 4LDVA 1E32A 5GJWB 2J6KA 2ZZDA 4KLNA 2K3XA 3HU3A 1UTIA 3FPTA 2K4YA 3ZJTA 2D9TA 2DJQA 4NL3A 2DF6A 3MP8A 3SB2A 2JT4A 1K9MU 3NTHA 4C92C 4WCIA 1JEGA 1VYTA 1N8RR 2EKOA 2YHTA 3GF5A 3CCSA 3EGXA 3O8VA 1BKBA 2ED1A 1KG1A 4R0KA 1RAIB 4JRKA 3RKYA 3ZJUA 5IHIA 2HMAA 2XHCA 1G3YA 1T3LA 1YWOA 5LJ5j 4M7AC 1W6XA 3QZ9B 5IXBA 3CC4A 3QKJA 3JRZA 3X26B 3RNJA 3FB9A 1JXOA 1EX4A 2DIGA 4L5GA 1NM7A 1XQHA 3EG9B 1VQ5T 2HSPA 4HT9A 2JM8A 1K0SA 2JTFA 2KR3A 1VQ6Q 3VYGA 3QDRB 5C1BA 2ESWA 1QVGP 1VQKT 4A4HA 2E6NA 2K7AA 2K5FA 2MI6A 3I56Q 2VUBA 1YJWT 2CP2A 2E10A 4BI8B 5LJ5d 2IG0A 1VQPA 1VQNQ 1M4ZA 2RO0A 5FU7B 2IVWA 4LUDA 3V8JA 2V8KA 2X3XD 3E9FA 3LWHA 3FJPA 4E2FB 4RTTA 3VUZA 1P92A 3QBYA 1VOMA 4Z89A 5FU6C 1SRLA 2OJ2A 2V1RA 4OVAA 4F7UG 4BUGA 2XI9A 4C5IA 4J9DA 5IT9E 1UGVA 4J7FA 1UJ0A 4A4FA 1ZHIA 2PZ1A 4F7UA 1KFZA 3CCVT 3X20B 5KH6A 2DLPA 1WHMA 3QYGB 4J8OA 5KYUA 3LGLA 2R5MA 3QC8A 1O54A 1EFNA 1D3BA 2CP3A 2FB7A 1WQWA 2J05A 2KI7A 4NL2A 4OGCA 4JLGA 4C92G 2L3SA 1GBRA 4IKFA 2KT8A 1M1KU 3V8LA 5KE3A 4C0FA 2ZGWA 3CCMT 1O75A 1UJYA 3RKWA 2RH2A 3JCMW 5GAN5 2NUTA 3NHNA 1BI2A 2V1QA 2GFUA 3OW2S 4M7AG 1UECA 1YHQQ 2HL5C 4CC2A 3OS5A 2DE0X 4IIOA 2WSEE 1TOVA 4BE1A 2VC8A 2EQUA 3M0UA 1VQ4A 1XTDA 2X4YA 5D6YA 3QXEB 1Y7XA 4M75C 3CMAQ 3PIPA 1WLPB 1YCSB 1RL2A 4XU0A 2EYZA 2FL7A 3VUBA 4LXCA 1ZUUA 2CYZB 2RMOA 2OX7A 4PJMA 2KYBA 5FROA 1M3CA 4PJOF 1YJ9A 4JS4A 1ZBJA 4BY6C 3QHSA 4E7KA 3SHWA 5LJ3e 1T3SA 1VQ8Q 1E6GA 4HCZA 3G1JA 2P0KA 4HT8A 4EDUA 4PFOA 5LJ3f 4KH0B 2VGNA 1GCPA 1ZUYA 1KC8R 2DFUA 3GP8A 2F1LA 2DZ9A 2EYXA 3S6WA 2JN0A 2JV2A 2PVDB 2PVOB 3H6ZA 1VQ6T 2RHZA 1UGQB 5CKHA 5I11A 1TWBA 1MMGA 3OS1A 2QQBA 4QQGA 4A63B 5FTJA 3I56T 3ME9A 2KBTA 4EMKB 2DTOA 4AFUC 3IQLA 1LJOA 4KGXB 2COYA 1JO8A 4KODA 3OYIA 1ZSGA 4E7ZA 3M56A 3VKIA 2RA2A 1VYVA 1T0JA 3CCQQ 3QQ7A 2QQSA 3QO3A 2CKKA 3RERA 2OI3A 3KFVA 1RADB 3C4SA 2AKLA 4FSSA 2HEQA 3I35A 1JJ2S 4FYXB 2GBQA 3CCJA 2XDBA 5GAOn 4II1A 2JTMA 2QA4T 4M77C 4AT1B 5GAMd 3JCMQ 2AK5A 2XICA 1Z9QA 4M75G 3JB9H 5CQXA 4F16A 2PU9B 1UDLA 2F69A 3HRUA 2OAWA 4OF1A 4OB0B 1IHVA 3TSWA 3TU4K 4AG1C 5GJVB 2LJ1A 1GCQA 2JTEA 4BE2A 1RLPC 1B34B 1WHGA 1YHQT 2P0QA 3CBOA 3OYGA 3MEAA 3HSBA 2YRDA 3UF4A 2ZPHB 4MDXA 2ED0A 5IXFA 1KD1R 4OMNA 5HY6A 2E12A 3I55Q 1MMAA 2CZ6B 1QVPA 3D7SB 2QEXA 2E6ZA 3CMAT 3TVTA 4C92D 3VS3A 3S3MA 4OMPA 1WI7A 2I0NA 5CVIA 2E4HA 1I8FA 2CSQA 3G71Q 1AWWA 2L89A 4OMFB 1G83A 2DA9A 5ECAA 3M0PA 1YIJQ 3CC2A 2D1XA 3I9QA 4M7AD 3EGXB 5CAIA 1C0MA 1U5SA 2MPXC 2ZPBB 1M90C 2E64A 4FL6A 5IN1A 4RMOA 1KC8C 5DYGA 2MM2A 3EAEA 4MMKA 1MMDA 4KGVB 4XTWA 5D6XA 4ANJA 3M53A 2NLUA 5GMKm 4R55A 2H3EB 4JJNK 1GRIA 2L2PA 5ERGB 2QXFA 2LVMA 2CT3A 2M02A 1IRXA 1LPLA 1BBZA 2LCSA 3JSCA 1ZQ1A 2WACA 3CCLQ 2DX1A 3FRNA 3BDUA 4M77G 5EG2A 4LD9K 4JPBW 4DQ2A 3OYHA 1FWZA 2Q1AX 3FC3A 3V7RA 1X43A 1M9SA 2JMAA 1W1FA 1ZBXA 1NLPC 1S72Q 1OQKA 1Q81R 2MM0A 2MYSA 4HVWA 2LW6A 3C12A 3CCQT 3OSVA 3HRTA 3EFOB 2QGFB 1V29B 4D8DA 3QDFA 4E7JA 4C8QG 4J6WA 1R7RA 2FZGB 2QK0A 3UT1A 2V8JA 1VA7A 4C8QA 4F7UB 4JRIA 1K73C 1R0BG 2ZPEB 1HK9A 2LT1A 2CH4W 1YITA 5KYUB 1IZ6A 1BB9A 3MB5A 3QUIA 1D3BB 3REBB 2RJDA 1VQLA 4ZN1A 4FM4B 3T9NA 1VYUA 1ZA1B 2IIMA 2L5QA 2YXYA 4PNOA 4EMKC 1Q82U 2R5AA 1VIFA 2PUKB 3SFMA 1G8XA 1EZZB 1YI2Q 3CCUT 2BKDN 1KD1C 1Q86U 4HCKA 2CSIA 2HBPA 2NUTB 2LX7A 3PTAA 5CD1A 3P8DA 3META 3QWXX 1XNIA 2YLBA 1KQSS 5GAN7 5GAN8 4M75D 3I55T 2A3LA 5C6SA 5GAMe 1TUGB 1X01A 5GAMf 1FMKA 3G71T 1QLYA 2FZKB 3MP6A 3OYFA 2RM4A 1YIJT 1OEBA 1IGQA 5GAOm 4OB2B 2DEQA 1ABQA 4MDWA 4JS5A 1UGSB 2DBMA 1Y57A 2YRCA 3JV3A 4EMGA 1W2BS 2JMCA 2RQUA 4M7DG 3PIOA 2O9VA 2DTHA 3OYYA 4M7DA 1VQKA 2K9GA 2BUDA 3CMET 3CCLT 2DZCA 4J9HA 1M8MA 4C0DB 1Q7YC 3G4SA 2D6FA 1QMCA 2JS2A 3L2QA 2HDAA 1TUCA 2L8DA 1JU5C 3G6EA 1S72T 2DBKA 5CQYA 3JCMb 2EYWA 2DKGA 2RN8A 2KROA 5KYXA 4GBQA 2LMJA 2LQWA 1K8AC 4L6V5 5FTLA 3MKDA 2PTKA 3I5RA 4DBFA 4DBRA 2R58A 4RTUA 2FRWA 3L2VA 1G3TA 1FX7A 2YWWA 2LQ8A 2HQXA 2P84A 4HCCA 2W0ZA 5LJ3j 3MCAB 2RI2A 2E1HA 4M77D 3A8GB 2NWMA 4PJOC 1PRLC 2PWYA 3M0TA 3HPWA 4IIMA 4PL6A 2YVLA 4PJOE 2L0AA 1M8VA 1OU9A 5J39A 4M78G 2M1HA 2EVRA 3CD6T 4DBQA 2RD1A 3VS5A 1NJIU 3CEYA 4M78A 4PFPA 3JB9F 2XKOC 1QVFA 1MV0B 2F2WA 3X28B 2E3HA 4OB1B 2MWPA 3CCMQ 1YI2T 1KJWA 4C8QD 4Y91A 2LQKA 4ARCA 3S3OA 4FIBA 4E7HA 2BTTA 3NTKA 3VS0A 2B8AA 1AEYA 4PJNA 5CIUA 1M30A 1MUZA 4LDXA 3SWNA 2RHXA 1K9MR 1WHKA 1CZ4A 3MO8A 3EGDA 2H8HA 4FYYB 5CKBA 2LNVA 1XOVA 4R56A 2KAFA 3NPFA 3TQ7P 3E2UA 4O5VA 1WA7A 5CR2A 1LOJA 3TCJA 3HP9A 5KYWB 1KQ2A 4EPCA 2MMPA 1D1BA 2Z0WA 3OYJA 2EYYA 5GLFA 2X4XA 1QVGS 2F5KA 3KUFA 2VWFA 2OTJQ 3MEUA 1E7OA 3UATA 1K1ZA 4RTXA 2E70A 2BE7D 2X35A 4DA4A 2ZAEA 2ZPGB 1SRMA 1H92A 3RMQA 1VQ6A 2DO3A 1ZUKA 4XU3A 5HK0A 1NPPA 2ZPFB 4F17A 2XK0A 1M2VB 2A36A 2JNGA 3ZEHA 3E1SA 1VQNA 3EHRA 4OGEA 2DERA 1PWTA 4O6JA 2DAQA 1WJSA 2LDMA 4ZTJA 1Z9ZA 2YRVA 2RQVA 4BI4A 2K5IA 4M7DD 5KE2A 1R77A 3L2UA 2P4RA 1HSQA 1UHFA 3LLRA 4RCCA 1M2OA 1D0YA 2DXUA 5A0LA 1KSWA 2RHUA 2HQEA 5FWBA 2DMOA 4BI3A 1JBMA 2RQTA 2C0TA 4MZTA 4B6MA 1M1KR 2QA4Q 1H641 4XTUA 5DLOA 1N9RA 3REAB 3EH1A 5A2QE 1Y07A 2JVVA 3M54A 1YHQA 4C92A 4PJLA 1VQMT 2Q1CX 4IUPA 4JLIA 1OV3A 2O2OA 2YLCA 4PK4A 1UEBA 1GBQA 3THKA 1YJNT 2KE9A 1ZSZB 2K5LA 4RTZA 4PLLA 4FW2A 1IO6A 1YWPA 3LYIA 4M7AA 4LNPA 4M78D 2Y90A 4KBMB 1I1JA 1WGSA 1RLQC 1JQQA 1N8RC 3WVEB 4J83A 3EG0A 2EGAA 2YUQA 4ESRA 2KYMA 2XIDA 5FLXE 1VQ8A 1VQ9T 3HU2A 4JJDA 3MEWA 2FO0A 2DILA 2OTJT 3VS1A 4QQDA 3RKXA 1B07A 2DL3A 1M1GA 2L3RA 4DOWA 3BY7A 3TIWA 3JB9I 2DXCA 2LC4A 2G3RA 1Y71A 4FSXA 1NYGA 4DOVA 2MWOA 4QVDA 4D8KA 2NUPA 4WF2A 1VIEA 1R0CB 4BD3A 3UA7A 1QVFS 2AKKA 2AT1B 2CZ7B 4CQNA 1PD0A 4M7DB 3FLGA 2KRMA 3CCST 3UDCA 2J6FA 1D1AA 1WPYA 5I2SA 2LCLA 4D6WA 4ATOA 5GAMj 1WQ7A 2BZ8A 4JJCA 5CKFA 3CC7Q 3M55A 3VS7A 4KGZB 3DB4A 3H0HA 3R6OA 3ER0A 4HCBA 1SF9A 1QVFP 5KYXB 1E6HA 2OAUA 2DXTA 3GOXA 5FWCA 4F7UF 2RHYA 2DTIA 4FW1A 5D6WA 2HBWA 2EJGA 2YUOA 4IUQA 2A7YA 5DLQE 1X6GA 5HK3A 3JCMe 2DRMA 3CPWA 3HKSA 2NYSA 1X69A 2SEMA 2P4TA 3VRZA 3QJ6A 2LNHB 1X2KA 1WHLA 2GNCA 2EYQA 3VS2A 3HFNA 4C92F 1VQPT 1IXDA 2QQRA 5A0GA 3JCMg 3Q1JA 3JCMJ 4M75A 2QI2A 1TS9A 1ZX6A 1RAGB 4FYWB 1QP3A 3A8OB 2EIFA 2OTLQ 1WIEA 5KYYB 2J7IA 4M7AF 4J6XA 3NGPA 1OYXA 2FPDA 4FT4A 2GQIA 3I55A 3CCUQ 5FU7C 3OYAA 1TXQA 3JCMh 2HD0A 3CCJQ 3EFSA 3VS4A 2GTOA 4E7LA 3G71A 3SWNB 4HKEA 2O01E 4JZ3A 1S3SA 3EGDB 2LT4A 3L42A 4ELYC 3C95A 4C0GA 3CF2A 1YIJA 3PMTA 5GAN4 1K73U 2ABLA 1BIBA 1S1NA 2CGHA 4IUTA 3PMIA 3CXCA 3CCEQ 3DB3A 2BIVA 2FHDA 1OU8A 1FYNA 5C0MA 2MAMA 3U23A 1M5Q1 1PKTA 1YP5A 4KH1B 1SKUB 1O9SA 2K6DA 4Z88A 5L23A 3HTRA 1CKAA 1GFCA 3MEVA 3CCLA 3JCMV 1MV3A 2FVUA 4FYVB 2EQKA 1ZSZC 4KT0E 1H3ZA 3VRYA 3INZA 1GXIE 1JXMA 1UUEA 5CKDA 2LP5A 4F14A 5KCHA 3CMEQ 4NOYA 1S72A 2O4XA 2X9HA 3OYBA 4M77A 2KK4A 4UC4A 2DEUA 3CC7T 2BZXA 2YUJA 2HZYA 4CC7A 1VQ7A 3QYHB 3OYEA 3BW1A 5FTMA 3QPHA 3FDRA 2YDLA 1K4US 4LDUA 4XQ3A 4L59A 2NUZA 1WX6A 3JCMc 1JB0E 1R8OB 1RABB 2WSFE 1OZ3A 2EWNA 2GCXA 2AZSA 5CCAA 2COZA 4MZMA 2QASA 5FW9A 2HCKA 1NE8A 3ASKA 3M5AA 1PG5B 3OYNA 2ROLA 4M75F 4WTOB 4N0AC 1UFFA 1Q82R 1PNJA 2ZPIB 5FRNA 2VV5A 3J80E 4RCBA 4ELZC 1Q7YU 5CCXA 1CR5A 5DM7R 1YI2A 3CD6Q 1Q86R 1YBYA 4J9GA 1U1SA 2VASA 3L2RA 2OTLT 1NEBA 2WSCE 3EG1A 4C92B 2PJHB 1Y96A 3M57A 4PKCC 3CCRQ 1RI9A 1K8AU 4E7IA 1D09B 3CCJT 4QKUA 2FZCB 2E65A 1BIAA 3OBYA 3LW5E 4A4GA 1TSFA 2DVEA 1WXUA 2IPOB 1SSFA 4CI0C 5DYIA 3QIIA 1VUBA 4M7AB 5FRMA 1Q95G 1RAHB 2XU8A 6AT1B 3JB9G 1UHCA 1X6OA 3J81E 1BCOA 2E5QA 2YT6A 4A4KA 5GAN6 1I5LA 3CCET 3AHUA 2CUBA 3L2ZA 3EHQA 1JRIA 5I2MA 5IH2A 2KDSA 1N27A 4X34A 1KHIA 3WXMB 2O88A 1QP2A 4RG8A 2LJ0A 4HXJA 4KULA 3M4GA 4EIKA 1MGQA 2HSEB 1TG0A 4XTVA 2VVKA 1VQ5A 1NLOC 4AG2C 2NUPB 3PVQA 2HAXA 4BDZA 4E6RA 1U1TA 2KXDA 4YTLA 2GFAA 1SEMA 3JCMP 4KDLA 2FRYA 2E41A 4M77F 5FU6B 1ZLMA 1YJWA 5FTKA 3CPWP 3CQTA 3FPRA 4XU1A 4BDYA 1PCXA 1WZOA 1Q81C 1X27A 3VYHB 3OS2A 5FTNA 1W70A 2CH4A 3LGAA 1CSKA 2X4WA 4ZGDB 3RBBB 4E7SA 3EFRA 3QJYA 4OMLA 1I4K1 1QCFA 2PQWA 5CO7A 1PM3A 4OMMA 4EMKA 2KXCA 3CCVA 1KQ1A 3SDZA 1UE9A 4C8QF 3OW2A 2DYIA 4RKUE 3TEEA 1Q82C 4J5YA 3BFMA 2QDYB 1NJIR 3KBGA 3G4SQ 3TSZA 2EW3A 2W10A 5L8RE 2EGEA 3G6EQ 4ARIA 2K57A 3CCMA 3ZJVA 4P5NA 1HJDA 3QG1A 3CBPA 3M59A 4MMLA 4CC3A 4JZ4A 3MJXA 2RJFA 3CXCP 4M75B 1RI0A 1W4SA 4OMQA 2D8JA 2DRKA 2CREA 1H8KA 1X6BA 1TU0B 3CCRT 1VQMQ 2K79A 1KHCA 3OYCA 1YJNQ 2RB6A 4LD6A 4J9FA 1OPLA 3QQ8A 2V8IA 4BY6B 1MNEA 3PE0A 4IURA 2Q1DX 2YUPA 3OYLA 1OULA 2LTOA 3GBQA 4XTXA 3DKMA 1ZC1A 4J9IA 3GNFB 2H3JA 3ZGZA 2A37A 1MHNA 2DVJA 4BB7A 4ZGJB 1CZ5A 1UGRB 4KUDK 2OTJA 1QCSA 4J7IA 1XJWB 3RMSA 4F7UE 2JJ9A 8AT1B 3C94A 1UG1A 2EJ9A 1M27C 1VQ9Q 3EH2A 1X2QA 3DLLA 2EJFA 1VQOQ 9ATCB 5I22A 4AFSC 3TREA 1HYOA 3OY9A 1UB4A 2PUOB 2ENMA 4K11A 5EQJB 3VU3C 4M7DF 5GAOr 2V26A 1WHHA 3JB9D 2CZ1B 3VJPA 4XU2A 5GANe 2C0IA 5AT1B 5B6CA 4C92E 5KYNA 3OYMA 2RQRA 4HVUA 5GANf 3I56A 1JJ2A 1HD3A 1I9GA 3JCMd 4PJOG 1YN8A 1RUWA 5GANg 1N8RU 3CCSQ 3A1PA 2K3YA 5A0DA 4PJOA 4OP0A 4M7AE 2M0OA 4GY5A 2O4XB 4X1VA 2HKQB 2KQWA 4MZPA 4PFZA 2HL3A 4M77B 2I2LA 2VXFA 4CRIA 1MMNA 2FEIA 1C1AA 1AT1B 3CC4Q 2KRSA 5GANh 1AZGB 1D1CA 2CZ0B 3LX7A 2L3PA 1AVZC 1NJIC 2DL4A 3OMCA 3OYDA 3H0IA 2QA4A 5GMKe 2KVQG 4DEXA 4FCYA 3G4ST 1GFDA 3QSUA 2RHIA 5GMKi 4M78F 4C8QB 1RACB 3G6ET 1BI1A 3EFOA 2CUDA 2EAYA 3QWYA 1OOTA 2CDTA 4DBHA 2CT4A 8ATCB 1VQPQ 3JCMX 4C0DC 1WLFA 2LQNA 1YFNA 3A5ZB 2PNIA 5HCKA 3OBWA 1YNZA 2D0NA 2QAZA 1M3AA 3JAME 2D8HA 5GAOq 1EIFA 2EKHA 5GMKh 2FG0A 2MF2A 1Y96B 3BDLA 1K9MC 1PSFA 2KSSA 3OYKA 2RJCA 1AZEA 4RV0A 2O31A 3E9GA 3PT9A 4C5GA 3CMAA 4VUBA 4RTVA 3AT1B 4HA8A 4QQ6A 3V7SA 4JRPA 2A08A 1I5OB 1OPKA 2PVGB 3M4YA 2LCCA 2M16A 4OB3B 3UWNA 4RUGA 2X4JA 2EQIA 1M3BA 2DL7A 2KNBB 2DL5A 1Y0MA 1ABOA 4XTYA 2CP7A 2VGMA 3G7ZA 2XDDA 2MCNA 2EPDA 3NTIA 1NG2A 1T0HA 1RAEB 4JDSA 3O5ZA 1VQOT 5GAN2 5EC7A 2J06A 3RUXA 4FU6A 4N4IA 3UPUA 2RI5A 1BI0A 3HRSA 4LE9A 2YSQA 5IHNA 1MNDA 4N4HA 1VQ4Q 4M75E 1IGUA 3UA6A 3ZFJA 1LCKA 1GCQC 3ZL7C 2VKNA 1SSHA 2FPFA 4ZTFA 4HVVA 3OW2P 2LJ3A 4AQ7A 2KT1A 3GIBA 2RJEA 2DNUA 3CC7A 2RK2A 3H8ZA 5CK9A 1NBEB 4EMHA 1M90R 4JJBA 1YJ9Q 3FEOA 4KDIA 4C0ZA 4FT2A 3SD4A 3CBMA 5LJ3g 3CCQA 3CC4T 3S3NA 1IREB 1BK2A 1G3WA 2QTXA 3A8HB 4BACA 1M90U 1PSEA 2D0QB 2Q18X 1KC8U 1G3SA 4ZGEB 4F04B 3R6NA 1RAFB 3H9NA 4PJOD 3FPUA 4XTZA 1M1KC 1AWXA 5LJ3h 1VQNT 5DY9A 4QVZA 5KCOA 1KQSA 2EQJA 3H41A 2M9UA 2JUFA 5EPPA 3JCMf 2F5TX 2BE9B 2GTJA 2ZCFB 2OTLA 2CP5A 2DETA 3M0QA 4KUIA 2A0FB 3CCUA 5HKCA 4JUVA 5GAOp 4M78B 4J6YA 5IAYA 1NEGA 2M51A 2K2VA 2YUNA 4M77E 3FIFA 2DIQA 2LZ6B 3QZ5B 4B9XA 3MP1A 3GNGA 1BI3A 2DXBA 4Z8AA 3KXTA 1W2BA 1K73R 1I0CA 1AOJA 5LJ5e 1PKSA 3I5SA 2ECZA 3CCEA 5LJ5f 1WHJA 2QQ9A 2XDPA 1F1BB 2XD0A 3RR6A 1K9AA 5LJ5g 1JJ2P 3OQ5A 4NS5A 1NPRA 3OS0A 1J3TA 4C8QC 4ZNXA 2JM9A 1NYFA 4XK8E 2LRQA 4LDWA 2JXBA 4C8QE 4AFZC 3E19A 3MHXA 2DK3A 2DPPB 3RESA 5IHKA 2BZYA 1NZ9A 2Y4XA 3ULRB 4DEYA 5LJ5h 2R57A 1VQ4T 3A98A 1HXDA 2GGRA 1KD1U 4Y92A 5KYWA 1SHFA 3CMEA 2QEXQ 2ROTA 1N9SA 2DJZA 1FMWA 2MK5A 2JW4A 1A0NB 1D0XA 2DYBA 2GF7A 2O9SA 1VQ8T 1AHJB 3P8HA 2A28A 2RNAA 3CC2Q 1IB8A 1YJ9T 2RQWA 4PJOB 1C6VX 1UGPB 1M2VA 1OX8A 2AZVA 2VYTA 2DD4A 3EG9A 4V2SA 1AWJA 3NFCA 2RK1A 3LGFA 4LUEA 2QYZA 1PRMC 2K2MA 4QW2A 1WYXA 1ZA2B 2Y4YA 1WFWA 2JZ2A 3EGUA 1IHWA 2RF0A 1U8RA 2AHJB 3LH0A 2DD5A 5CKEA 1V76A 1KK7A 3FJ5A 1Q7YR 2JS0A 1FXXA 3P8BB 1N5ZA 3EG2A 5D7UA 5J26A 5GAN3 4X9DA 3CD6A 4E47A 1QDNA 2QDLA 5GANj 1AD5A 2F2VA 2XG8D 1QKXA 4RTYA 4A54A 1QQJA 4M7DC 2MIOA 5CCBA 2RI3A 1OX9A 2EFIA 1VQ7Q 2M0YA 3CCRA 1OI1A 1K8AR 4M7DE 4RG2A 3QWZA 4A4EA 2HQHA 4AMCA 5J3BA 2EBPA 1Q81U 2MOXA 3M9QA 1K0XA 3SEMA 2P0PA 2KY9A 1QVGA 1YCYA 2DM1A 4IUVA 1V1CA 2CS7A 2FPEA 4IUUA 4Q5WA 4KRTA 3NMZC 3M0SA 5GANd 3URGA 4QT7A 2ATCB 1U3OA 2B25A 4CC4B 1YITQ 3J7AF 1BU1A 1ACMB 1TH7A 2F2XA 2QQAA 1B3QA 1LVKA 5GMKj 2G6FX 2JOYA 1ZSZA 3CPFA 1VQLQ 1U06A 4X9CA 3V7CA 2HKNA 3F70A 5GMKl 1N6AA 2KMTA 3PFSA 3RIRA 3CPWS 1QWFA 2Q19X 3OMGA 2K3BA 3HHTB 2RPNA 2QG9B 3H0FA 1DJ7B 3PNWC 1G2BA 4M78C 3JB9J 4XAXB 3LWIA 4J9BA 1SHGA 1TUDA 5C18A 2CP6A 1CKBA 4M78E 3GPLA 2QEXT 3VS6A 4Z02A 5GAMg 4GLMA 3LH5A 2HNIA 3DLMA 2EQMA 2X3WD 1QCNA 2KRNA 4AS1A 4C5HA 4ZN3A 4TVRA 1KQSP 3MPUB 3L1AA 3SWNC 1M1FA 3CC2T 1WJQA 4A53A 3BQBA 2VXEA 2DL8A 1ARKA 5GAMh 1I07A 3X25B 4N0AA 4B9WA 3GLXA 3HL8A 1LNXA 3BE3A 3V8KA 3OSSC 1H3HA 1VQ5Q 2B86A 3C0CA 1G5VA 1WDXA 3CXCS 1K76A 2VB6A 3RDVA 4LDYA 1BCMA 3OA6A 3M0RA 1VQKQ 3LHDA 2XMFA 1PD1A 2COWA 2QGGA 1YJWQ 4N4GA 1W2BP 1GL5A 2L3QA 4OMOA 4LN2A 1Q86C 1X75C 1WXTA 2LX9A 1VQ7T 2J6OA 4ORZA 3EG3A 1KIKA 1PHTA 2X51A 2E3IA 1VQMA 4QVCA 1WNLA 3HU1A 4BE0A 2FYKA 4M4ZA 3A8MB 1WJRA 3OB9A 3ZBDA 1QCOA 1YJNA 2KGTA 7AT1B 4Y28E 1TTHB 4ME7A 3CCVQ 4J9CA 4RTWA 3PVLA 4C5EA 4JRQA 4J9EA 3HFOA 3A8LB 2KEAA 1AWOA 1SG5A 1FMVA
chains in the Genus database with same CATH topology
2C06A 1K9MC 2L5QA 4PNOA 4EMKC 1Q82U 2R5AA 1PSFA 2KSSA 3X24B 4J6XA 3OYKA 2RJCA 4M7AF 1BYMA 1OYXA 1VIFA 4FT4A 3I55A 5I21A 4RV0A 3PT9A 3E9GA 2PUKB 5FU7C 3SFMA 4C5GA 5GAOl 3OYAA 3CMAA 1YITT 4VUBA 3JCMh 3CCUT 2BKDN 2HD0A 1QW1A 1KD1C 1I81A 4HA8A 4QQ6A 1Q86U 4PLIA 3V7SA 2HBPA 1OZ2A 3EFSA 3WVDB 3PTAA 4JRPA 5CD1A 3P8DA 1B34A 3META 2PVGB 4E7LA 1VQ9A 3M4YA 1VQLT 2LCCA 1XNIA 2M16A 3PGGA 4OB3B 5LL6S 3UWNA 3SWNB 2YLBA 2X4JA 4HKEA 5LJ3d 5M9OA 5GAN7 2O01E 3L2WA 3M58A 5GAN8 3VV0A 1KQSS 1S3SA 3N5BB 2LT4A 3L42A 4GLKA 4M75D 5AYFA 2A3LA 4ELYC 3I55T 3C95A 4C0GA 3CF2A 1YIJA 4XTYA 3PMTA 5GAN4 2GQVA 1K73U 5C6SA 5GAMe 2VGMA 1BIBA 3G7ZA 4KO8A 4LDVA 2CGHA 1X01A 2XDDA 1E32A 4IUTA 2ZZDA 3PMIA 3CXCA 3NTIA 3DB3A 2BIVA 5GAMf 2FHDA 2K3XA 4KLNA 4JDSA 3G71T 1VQOT 3HU3A 5GAN2 3FPTA 2K4YA 3RUXA 2MAMA 5C0MA 3ZJTA 2D9TA 4FU6A 3MP6A 4N4IA 4NL3A 2RI5A 3MP8A 3SB2A 3UPUA 1M5Q1 3OYFA 1BI0A 1K9MU 3NTHA 2RM4A 3HRSA 4C92C 1YIJT 4N4HA 5GAOm 4OB2B 2DEQA 2EKOA 2YHTA 3GF5A 4M75E 4MDWA 3CCSA 1O9SA 3O8VA 1BKBA 4JS5A 3ZFJA 1M90C 1KG1A 4JRKA 1UGSB 3RKYA 3ZJUA 4ZTFA 4EMGA 2XHCA 1G3YA 3MEVA 3JCMV 1W2BS 3CCLA 4AQ7A 2FVUA 5LJ5j 4M7AC 2EQKA 4M7DG 3GIBA 3QZ9B 4KT0E 2RJEA 1H3ZA 3PIOA 3CC4A 3CC7A 2RK2A 3INZA 3H8ZA 1GXIE 3QKJA 2DTHA 5CKDA 3OYYA 3JRZA 4M7DA 3X26B 5CK9A 4EMHA 3FB9A 1VQKA 5KCHA 4NOYA 1S72A 2BUDA 2O4XA 3CMET 3CCLT 3FEOA 2DZCA 5CCXA 2DIGA 4L5GA 3OYBA 4C0ZA 4FT2A 3SD4A 3CBMA 4KDIA 4C0DB 5LJ3g 1XQHA 1VQ5T 3CCQA 1Q7YC 4HT9A 4M77A 2KK4A 4UC4A 3G4SA 3CC4T 3S3NA 2JTFA 3CC7T 2D6FA 2YUJA 2MF2A 3L2QA 1IREB 3VYGA 1G3WA 2QTXA 3QDRB 1VQ7A 5C1BA 3QYHB 3OYEA 2L8DA 3A8HB 4BACA 1M90U 3BW1A 1VQKT 4A4HA 1PSEA 2D0QB 2E6NA 2Q18X 3G6EA 1G3SA 2K5FA 2MI6A 3QPHA 1KC8U 5FTMA 1S72T 4ZGEB 2VUBA 3FDRA 5CQYA 3JCMb 1YJWT 4LDUA 4XQ3A 4L59A 2E10A 4BI8B 2DKGA 3JCMc 1JB0E 4PJOD 3FPUA 1R8OB 2IG0A 4XTZA 5LJ5d 1VQPA 1K8AC 1M4ZA 1M1KC 2RO0A 4L6V5 5FTLA 2WSFE 5FU7B 5LJ3h 1VQNT 5DY9A 2IVWA 4QVZA 1OZ3A 5KCOA 2EWNA 2GCXA 2EQJA 2R58A 3V8JA 1KQSA 2V8KA 3E9FA 3L2VA 5CCAA 3LWHA 1G3TA 3FJPA 4MZMA 3VUZA 1FX7A 1P92A 2M9UA 2JUFA 2LQ8A 3QBYA 5EPPA 1NE8A 3JCMf 2HQXA 4HCCA 3ASKA 5LJ3j 2F5TX 3MCAB 2RI2A 2E1HA 5FU6C 3M5AA 4M77D 2ZCFB 4OVAA 3OYNA 3A8GB 4F7UG 4M75F 2OTLA 4PJOC 4N0AC 4BUGA 2XI9A 4C5IA 2PWYA 2ZPIB 3HPWA 5IT9E 5FRNA 2VV5A 4J7FA 4KUIA 4PL6A 3J80E 2YVLA 4A4FA 1ZHIA 4RCBA 4ELZC 4F7UA 4JUVA 5HKCA 3CCUA 5GAOp 3CCVT 1Q7YU 3X20B 5DM7R 1YI2A 4PJOE 1M8VA 1CR5A 5J39A 4M78B 5KH6A 4M78G 4J6YA 1YBYA 2M1HA 3QYGB 4J8OA 5IAYA 3CD6T 2RD1A 1NJIU 1U1SA 3LGLA 3L2RA 3CEYA 2R5MA 2OTLT 3QC8A 4M78A 1O54A 1D3BA 2K2VA 2WSCE 2FB7A 1WQWA 3JB9F 2XKOC 4NL2A 4OGCA 4JLGA 4C92B 2PJHB 1Y96A 3M57A 4PKCC 4C92G 4M77E 1QVFA 3FIFA 2DIQA 3X28B 4IKFA 3QZ5B 1K8AU 4OB1B 4B9XA 1M1KU 3MP1A 2MWPA 3GNGA 4E7IA 1BI3A 2DXBA 3V8LA 5KE3A 4C0FA 3KXTA 1YI2T 1W2BA 2ZGWA 5LJ5e 4C8QD 3CCMT 1O75A 4Y91A 3CCJT 2LQKA 4ARCA 2E65A 3RKWA 1BIAA 3OBYA 3LW5E 4A4GA 2RH2A 2DVEA 4FIBA 5LJ5f 5GAN5 3CCEA 4E7HA 3JCMW 1SSFA 2QQ9A 3NTKA 1BI2A 2B8AA 5CIUA 2XDPA 1VUBA 3QIIA 4CI0C 5DYIA 4M7AB 5FRMA 2GFUA 3OW2S 4M7AG 2XU8A 2XD0A 3JB9G 4LDXA 3SWNA 2RHXA 3OS5A 1X6OA 5LJ5g 3J81E 1CZ4A 3MO8A 2E5QA 3OQ5A 2WSEE 4NS5A 1NPRA 4BE1A 3OS0A 2VC8A 2EQUA 4C8QC 4A4KA 5GAN6 1VQ4A 5CKBA 1I5LA 2LNVA 1XOVA 1XTDA 4R56A 2X4YA 3CCET 5D6YA 4XK8E 2LRQA 3QXEB 2KAFA 4LDWA 3AHUA 4C8QE 3L2ZA 3E19A 3MHXA 4O5VA 1Y7XA 2DK3A 2DPPB 4M75C 3RESA 3PIPA 1JRIA 1RL2A 1NZ9A 5I2MA 5CR2A 1LOJA 4XU0A 3TCJA 2Y4XA 2KDSA 3HP9A 5LJ5h 1N27A 1KQ2A 2R57A 2MMPA 4X34A 4EPCA 1VQ4T 1KHIA 1HXDA 3WXMB 3OYJA 5GLFA 2X4XA 1QP2A 4RG8A 1KD1U 2FL7A 3VUBA 1QVGS 2F5KA 3KUFA 2CYZB 3M4GA 4KULA 3MEUA 1MGQA 3CMEA 5FROA 4PJOF 4XTVA 1YJ9A 2E70A 4JS4A 1N9SA 1VQ5A 2DJZA 4BY6C 2X35A 3QHSA 4E7KA 4DA4A 2HAXA 2ZPGB 5LJ3e 4BDZA 2GF7A 4HCZA 3RMQA 1U1TA 2P0KA 4HT8A 4EDUA 1VQ6A 4YTLA 1VQ8T 5LJ3f 1AHJB 2DO3A 2GFAA 4XU3A 3JCMP 5HK0A 4KDLA 2E41A 3P8HA 2VGNA 4M77F 1NPPA 2ZPFB 3GP8A 5FU6B 2XK0A 1YJWA 2DZ9A 5FTKA 3S6WA 1YJ9T 2JN0A 4PJOB 2JNGA 3FPRA 3ZEHA 2JV2A 2PVDB 2PVOB 4XU1A 4BDYA 1UGPB 3E1SA 3H6ZA 1VQNA 1VQ6T 2RHZA 2VYTA 2DD4A 4V2SA 1UGQB 5CKHA 1Q81C 4OGEA 3VYHB 3OS2A 5FTNA 3NFCA 2QQBA 2RK1A 3LGFA 4QQGA 3OS1A 3LGAA 4O6JA 2DAQA 4QW2A 1WJSA 2LDMA 3ME9A 3I56T 4ZTJA 5FTJA 2X4WA 4ZGDB 4EMKB 2YRVA 2DTOA 2Y4YA 2JZ2A 4BI4A 3EFRA 3QJYA 2K5IA 1I4K1 1U8RA 4M7DD 2AHJB 3LH0A 5KE2A 2PQWA 5CO7A 2DD5A 1LJOA 4EMKA 5CKEA 3L2UA 3CCVA 1KQ1A 3SDZA 4C8QF 4KODA 1FXXA 3OW2A 3LLRA 3OYIA 3P8BB 4RCCA 5J26A 5GAN3 3M56A 1QDNA 4X9DA 3CD6A 4E47A 2DXUA 5A0LA 4RKUE 3VKIA 3TEEA 2RA2A 1Q82C 4J5YA 3BFMA 2QDYB 2RHUA 5GANj 3QQ7A 2HQEA 2QQSA 3QO3A 2XG8D 3KBGA 4A54A 2CKKA 4BI3A 3RERA 4M7DC 1JBMA 5CCBA 2RI3A 2EFIA 3C4SA 4MZTA 5L8RE 3CCRA 1OI1A 1JJ2S 4M7DE 4RG2A 4ARIA 3QWZA 4A4EA 2K57A 3CCMA 3ZJVA 5J3BA 3CCJA 4P5NA 1Q81U 5GAOn 1H641 2XDBA 3QG1A 2JTMA 3CBPA 3M9QA 1N9RA 4II1A 4XTUA 5DLOA 2QA4T 4M77C 3M59A 4MMLA 5GAMd 5A2QE 2RJFA 3JCMQ 4M75B 2P0PA 1RI0A 1W4SA 2KY9A 2XICA 4M75G 5CQXA 1QVGA 3JB9H 2PU9B 1YCYA 2F69A 3HRUA 1Y07A 4IUVA 3G71A 3CCRT 4OF1A 2JVVA 3M54A 1YHQA 2CS7A 4C92A 4OB0B 1VQMT 1KHCA 4IUUA 4Q5WA 2Q1CX 4IUPA 3OYCA 3TU4K 4JLIA 2YLCA 1UEBA 2RB6A 4LD6A 5GANd 1YJNT 3URGA 3QQ8A 4BE2A 2B25A 2V8IA 4BY6B 3J7AF 2K5LA 4IURA 1B34B 1TH7A 2QQAA 1YHQT 2Q1DX 2P0QA 4PLLA 3CBOA 3OYLA 3OYGA 3LYIA 3MEAA 5GMKj 3HSBA 4M7AA 2JOYA 2LTOA 3CPFA 4XTXA 2ZPHB 3DKMA 2Y90A 4M78D 4MDXA 4X9CA 1ZC1A 3GNFB 1WGSA 4KBMB 3V7CA 2H3JA 5HY6A 3ZGZA 1MHNA 3F70A 2E12A 4BB7A 4ZGJB 5GMKl 1N6AA 2KMTA 1CZ5A 1N8RC 1UGRB 3PFSA 3WVEB 4J83A 4KUDK 2CZ6B 4J7IA 2OTJA 1QVPA 3RIRA 1QCSA 3CPWS 2QEXA 2E6ZA 3RMSA 3CMAT 4C92D 3S3MA 2Q19X 4F7UE 2XIDA 3OMGA 5CVIA 3C94A 2EJ9A 3HHTB 1DJ7B 3PNWC 5FLXE 3DLLA 1I8FA 2EJFA 4M78C 3JB9J 1VQ9T 1VQ8A 3HU2A 4XAXB 3LWIA 3MEWA 2L89A 4OMFB 5C18A 3TREA 3OY9A 1UB4A 2PUOB 2OTJT 4M78E 5EQJB 3GPLA 2QEXT 4QQDA 3VU3C 3CC2A 3RKXA 5GAOr 2L3RA 1M1GA 4Z02A 5GAMg 4M7DF 4DOWA 5CAIA 4M7AD 3BY7A 3TIWA 3JB9D 2CZ1B 2HNIA 3VJPA 3DLMA 2ZPBB 4XU2A 2DXCA 2EQMA 2E64A 2G3RA 2LC4A 4FL6A 5IN1A 1Y71A 4FSXA 5GANe 4RMOA 1KC8C 5DYGA 4C92E 4DOVA 2MWOA 3OYMA 2MM2A 4QVDA 5B6CA 4AS1A 3EAEA 4MMKA 1VIEA 4WF2A 4C5HA 4TVRA 4ZN3A 5GANf 4BD3A 4XTWA 1QVFS 3I56A 3L1AA 5D6XA 3SWNC 1JJ2A 3M53A 1I9GA 1M1FA 2NLUA 3JCMd 5GMKm 1WJQA 3CC2T 2CZ7B 4PJOG 4R55A 4CQNA 4A53A 5GANg 3BQBA 4M7DB 2VXEA 1N8RU 4JJNK 5GAMh 5ERGB 2QXFA 3FLGA 2K3YA 2LVMA 5A0DA 3UDCA 3CCST 4PJOA 4OP0A 4N0AA 3X25B 4B9WA 2M0OA 4GY5A 4M7AE 1VQOA 2O4XB 2KQWA 1WPYA 5I2SA 3JSCA 4MZPA 1ZQ1A 2LCLA 3GLXA 2WACA 4D6WA 3HL8A 3FRNA 4ATOA 4M77B 1LNXA 2I2LA 2VXFA 3BDUA 4M77G 3OSSC 3V8KA 5EG2A 4CRIA 5GAMj 1WQ7A 4LD9K 4DQ2A 3OYHA 1FWZA 1G5VA 2Q1AX 5CKFA 3FC3A 3CXCS 3M55A 5GANh 3DB4A 3R6OA 3ER0A 4LDYA 3V7RA 2CZ0B 3OA6A 3LX7A 4HCBA 3LHDA 1M9SA 1ZBXA 1NJIC 4N4GA 3OMCA 3OYDA 2OAUA 3JB9I 2DXTA 3GOXA 2QA4A 2MM0A 4F7UF 5GMKe 2RHYA 2KVQG 2LW6A 2DTIA 5D6WA 3C12A 2EJGA 3OSVA 3CCQT 3HRTA 3G4ST 4IUQA 1Q86C 2A7YA 5DLQE 1X75C 2LX9A 1V29B 5HK3A 1VQ7T 3QSUA 2RHIA 5GMKi 4E7JA 3JCMe 4M78F 4C8QB 3CPWA 3HKSA 4C8QG 4J6WA 1VQMA 3G6ET 1BI1A 4QVCA 2P4TA 2EAYA 1WNLA 1R7RA 3QJ6A 3HU1A 4BE0A 3UT1A 2V8JA 2FYKA 4C8QA 3A8MB 1WJRA 3OB9A 3ZBDA 4F7UB 3JCMX 1YJNA 4C0DC 4JRIA 1WLFA 2EYQA 1VQPT 3HFNA 4C92F 3A5ZB 1K73C 2QQRA 5A0GA 4Y28E 3JCMg 3S3OA 4ME7A 2ZPEB 1HK9A 3Q1JA 3JCMJ 2LT1A 3OBWA 1YITA 4M75A 1IZ6A 3JAME 2QI2A 4C5EA 4JRQA 5GAOq 3MB5A 3QUIA 1D3BB 1EIFA 1QP3A 3HFOA 2RJDA 1VQLA 4ZN1A 3A8OB 3A8LB 4FM4B 3T9NA 5GMKh 2EIFA 1Y96B 3BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9F A;  3S6W A;  3L2V A;  2R5A A;  3PNW C;  3OYK A;  2RJC A;  1OYX A;  3ZEH A;  3QBY A;  3E9G A;  3MEW A;  4C5G A;  3OYA A;  2HQX A;  2L89 A;  4BDY A;  3ASK A;  3H6Z A;  3OY9 A;  2RI2 A;  2BKD N;  3OYN A;  2RHZ A;  2VYT A;  4OVA A;  4QQ6 A;  4PLI A;  1OZ2 A;  4QQD A;  3OS2 A;  2L3R A;  3P8D A;  3MET A;  4Z02 A;  4C5I A;  3OS1 A;  3LGF A;  4QQG A;  4E7L A;  5FRN A;  2DAQ A;  2LCC A;  1WJS A;  1XNI A;  2LDM A;  2M16 A;  3ME9 A;  3DLM A;  4PL6 A;  4QW2 A;  3UWN A;  2X4W A;  2EQM A;  4A4F A;  2G3R A;  5M9O A;  4FL6 A;  3L2W A;  2YRV A;  5IN1 A;  2JZ2 A;  5J39 A;  3OYM A;  2MWO A;  3L42 A;  5KH6 A;  2M1H A;  3EAE A;  5IAY A;  3LH0 A;  4C5H A;  5KE2 A;  2PQW A;  4BD3 A;  3LGL A;  3PMT A;  5C6S A;  3CEY A;  3L2R A;  3L2U A;  2R5M A;  5D6X A;  2NLU A;  4IUT A;  1WJQ A;  3PMI A;  3LLR A;  3OYI A;  3NTI A;  5J26 A;  3DB3 A;  2BIV A;  2FHD A;  2K3X A;  5KCO A;  2DIQ A;  4IKF A;  3FLG A;  4B9X A;  2K3Y A;  2LVM A;  2MWP A;  3MP1 A;  4E7I A;  5KE3 A;  2RHU A;  4B9W A;  5C0M A;  2M0O A;  4GY5 A;  2D9T A;  2HQE A;  2O4X B;  2QQS A;  3MP6 A;  2RI5 A;  3MP8 A;  4FU6 A;  4N4I A;  2CKK A;  3OYF A;  3NTH A;  2RI3 A;  2EFI A;  2WAC A;  3C4S A;  4N4H A;  3S3O A;  4A4G A;  4CRI A;  4E7H A;  2EKO A;  1OI1 A;  1SSF A;  3NTK A;  2B8A A;  4RG2 A;  5CIU A;  2XDP A;  3O8V A;  3QII A;  4A4E A;  3OYH A;  1G5V A;  5FRM A;  2GFU A;  3FC3 A;  4II1 A;  3M9Q A;  2RHX A;  3DB4 A;  4ZTJ A;  3MO8 A;  4ZTF A;  2E5Q A;  3OQ5 A;  3OA6 A;  3LX7 A;  3MEV A;  4NS5 A;  4BE1 A;  2RJF A;  3OS0 A;  2EQU A;  1RI0 A;  2EQK A;  2X4Y A;  2RJE A;  1H3Z A;  4N4G A;  3OMC A;  5D6Y A;  2LRQ A;  4IUV A;  3OYD A;  3GOX A;  3H8Z A;  2RHY A;  3QKJ A;  5D6W A;  1KHC A;  2XK0 A;  4IUU A;  4Q5W A;  5KCH A;  4IUP A;  4IUQ A;  3OYC A;  4LD6 A;  2BUD A;  2O4X A;  2RHI A;  3FEO A;  1N27 A;  2DIG A;  4E7J A;  2R57 A;  4X34 A;  3SD4 A;  3OYB A;  3OYJ A;  4BE2 A;  2X4X A;  3QJ6 A;  4UC4 A;  2F5K A;  4IUR A;  3S3N A;  3KUF A;  2JTF A;  4BE0 A;  3MEU A;  3UT1 A;  3L2Q A;  4PLL A;  3OYL A;  3OYG A;  3LYI A;  3MEA A;  1WJR A;  5FRO A;  3OB9 A;  3OYE A;  2L8D A;  2LTO A;  4BAC A;  4A4H A;  2E6N A;  2QQR A;  2X35 A;  1WGS A;  4E7K A;  3Q1J A;  1MHN A;  3F70 A;  3FDR A;  4BDZ A;  2GF7 A;  4HCZ A;  3PFS A;  4L59 A;  2P0K A;  3OMG A;  4C5E A;  4EDU A;  2IG0 A;  2GFA A;  2RO0 A;  2RJD A;  3S3M A;  3P8H A;  4QVZ A;  1OZ3 A;  3BDL A;  2EQJ A;  2R58 A; 
#chains in the Genus database with same CATH topology
 2C06 A;  1SPK A;  1WXB A;  2AIR B;  1BYM A;  3X24 B;  1QWE A;  4AFQ C;  5I21 A;  5GAO l;  4PJJ A;  1YIT T;  1D0Z A;  5KYY A;  1QW1 A;  2C0O A;  1I81 A;  4PLI A;  3WVD B;  1OZ2 A;  1B34 A;  1VQL T;  1VQ9 A;  1RAA B;  2SRC A;  3PGG A;  1VQO A;  5LL6 S;  5M9O A;  5LJ3 d;  3L2W A;  1QKW A;  2E5K A;  1PC0 A;  3M58 A;  3VV0 A;  3N5B B;  4GLK A;  5AYF A;  2EGC A;  1B7T A;  2GQV A;  2QTV A;  2CP0 A;  4KO8 A;  4LDV A;  1E32 A;  5GJW B;  2J6K A;  2ZZD A;  4KLN A;  2K3X A;  3HU3 A;  1UTI A;  3FPT A;  2K4Y A;  3ZJT A;  2D9T A;  2DJQ A;  4NL3 A;  2DF6 A;  3MP8 A;  3SB2 A;  2JT4 A;  1K9M U;  3NTH A;  4C92 C;  4WCI A;  1JEG A;  1VYT A;  1N8R R;  2EKO A;  2YHT A;  3GF5 A;  3CCS A;  3EGX A;  3O8V A;  1BKB A;  2ED1 A;  1KG1 A;  4R0K A;  1RAI B;  4JRK A;  3RKY A;  3ZJU A;  5IHI A;  2HMA A;  2XHC A;  1G3Y A;  1T3L A;  1YWO A;  5LJ5 j;  4M7A C;  1W6X A;  3QZ9 B;  5IXB A;  3CC4 A;  3QKJ A;  3JRZ A;  3X26 B;  3RNJ A;  3FB9 A;  1JXO A;  1EX4 A;  2DIG A;  4L5G A;  1NM7 A;  1XQH A;  3EG9 B;  1VQ5 T;  2HSP A;  4HT9 A;  2JM8 A;  1K0S A;  2JTF A;  2KR3 A;  1VQ6 Q;  3VYG A;  3QDR B;  5C1B A;  2ESW A;  1QVG P;  1VQK T;  4A4H A;  2E6N A;  2K7A A;  2K5F A;  2MI6 A;  3I56 Q;  2VUB A;  1YJW T;  2CP2 A;  2E10 A;  4BI8 B;  5LJ5 d;  2IG0 A;  1VQP A;  1VQN Q;  1M4Z A;  2RO0 A;  5FU7 B;  2IVW A;  4LUD A;  3V8J A;  2V8K A;  2X3X D;  3E9F A;  3LWH A;  3FJP A;  4E2F B;  4RTT A;  3VUZ A;  1P92 A;  3QBY A;  1VOM A;  4Z89 A;  5FU6 C;  1SRL A;  2OJ2 A;  2V1R A;  4OVA A;  4F7U G;  4BUG A;  2XI9 A;  4C5I A;  4J9D A;  5IT9 E;  1UGV A;  4J7F A;  1UJ0 A;  4A4F A;  1ZHI A;  2PZ1 A;  4F7U A;  1KFZ A;  3CCV T;  3X20 B;  5KH6 A;  2DLP A;  1WHM A;  3QYG B;  4J8O A;  5KYU A;  3LGL A;  2R5M A;  3QC8 A;  1O54 A;  1EFN A;  1D3B A;  2CP3 A;  2FB7 A;  1WQW A;  2J05 A;  2KI7 A;  4NL2 A;  4OGC A;  4JLG A;  4C92 G;  2L3S A;  1GBR A;  4IKF A;  2KT8 A;  1M1K U;  3V8L A;  5KE3 A;  4C0F A;  2ZGW A;  3CCM T;  1O75 A;  1UJY A;  3RKW A;  2RH2 A;  3JCM W;  5GAN 5;  2NUT A;  3NHN A;  1BI2 A;  2V1Q A;  2GFU A;  3OW2 S;  4M7A G;  1UEC A;  1YHQ Q;  2HL5 C;  4CC2 A;  3OS5 A;  2DE0 X;  4IIO A;  2WSE E;  1TOV A;  4BE1 A;  2VC8 A;  2EQU A;  3M0U A;  1VQ4 A;  1XTD A;  2X4Y A;  5D6Y A;  3QXE B;  1Y7X A;  4M75 C;  3CMA Q;  3PIP A;  1WLP B;  1YCS B;  1RL2 A;  4XU0 A;  2EYZ A;  2FL7 A;  3VUB A;  4LXC A;  1ZUU A;  2CYZ B;  2RMO A;  2OX7 A;  4PJM A;  2KYB A;  5FRO A;  1M3C A;  4PJO F;  1YJ9 A;  4JS4 A;  1ZBJ A;  4BY6 C;  3QHS A;  4E7K A;  3SHW A;  5LJ3 e;  1T3S A;  1VQ8 Q;  1E6G A;  4HCZ A;  3G1J A;  2P0K A;  4HT8 A;  4EDU A;  4PFO A;  5LJ3 f;  4KH0 B;  2VGN A;  1GCP A;  1ZUY A;  1KC8 R;  2DFU A;  3GP8 A;  2F1L A;  2DZ9 A;  2EYX A;  3S6W A;  2JN0 A;  2JV2 A;  2PVD B;  2PVO B;  3H6Z A;  1VQ6 T;  2RHZ A;  1UGQ B;  5CKH A;  5I11 A;  1TWB A;  1MMG A;  3OS1 A;  2QQB A;  4QQG A;  4A63 B;  5FTJ A;  3I56 T;  3ME9 A;  2KBT A;  4EMK B;  2DTO A;  4AFU C;  3IQL A;  1LJO A;  4KGX B;  2COY A;  1JO8 A;  4KOD A;  3OYI A;  1ZSG A;  4E7Z A;  3M56 A;  3VKI A;  2RA2 A;  1VYV A;  1T0J A;  3CCQ Q;  3QQ7 A;  2QQS A;  3QO3 A;  2CKK A;  3RER A;  2OI3 A;  3KFV A;  1RAD B;  3C4S A;  2AKL A;  4FSS A;  2HEQ A;  3I35 A;  1JJ2 S;  4FYX B;  2GBQ A;  3CCJ A;  2XDB A;  5GAO n;  4II1 A;  2JTM A;  2QA4 T;  4M77 C;  4AT1 B;  5GAM d;  3JCM Q;  2AK5 A;  2XIC A;  1Z9Q A;  4M75 G;  3JB9 H;  5CQX A;  4F16 A;  2PU9 B;  1UDL A;  2F69 A;  3HRU A;  2OAW A;  4OF1 A;  4OB0 B;  1IHV A;  3TSW A;  3TU4 K;  4AG1 C;  5GJV B;  2LJ1 A;  1GCQ A;  2JTE A;  4BE2 A;  1RLP C;  1B34 B;  1WHG A;  1YHQ T;  2P0Q A;  3CBO A;  3OYG A;  3MEA A;  3HSB A;  2YRD A;  3UF4 A;  2ZPH B;  4MDX A;  2ED0 A;  5IXF A;  1KD1 R;  4OMN A;  5HY6 A;  2E12 A;  3I55 Q;  1MMA A;  2CZ6 B;  1QVP A;  3D7S B;  2QEX A;  2E6Z A;  3CMA T;  3TVT A;  4C92 D;  3VS3 A;  3S3M A;  4OMP A;  1WI7 A;  2I0N A;  5CVI A;  2E4H A;  1I8F A;  2CSQ A;  3G71 Q;  1AWW A;  2L89 A;  4OMF B;  1G83 A;  2DA9 A;  5ECA A;  3M0P A;  1YIJ Q;  3CC2 A;  2D1X A;  3I9Q A;  4M7A D;  3EGX B;  5CAI A;  1C0M A;  1U5S A;  2MPX C;  2ZPB B;  1M90 C;  2E64 A;  4FL6 A;  5IN1 A;  4RMO A;  1KC8 C;  5DYG A;  2MM2 A;  3EAE A;  4MMK A;  1MMD A;  4KGV B;  4XTW A;  5D6X A;  4ANJ A;  3M53 A;  2NLU A;  5GMK m;  4R55 A;  2H3E B;  4JJN K;  1GRI A;  2L2P A;  5ERG B;  2QXF A;  2LVM A;  2CT3 A;  2M02 A;  1IRX A;  1LPL A;  1BBZ A;  2LCS A;  3JSC A;  1ZQ1 A;  2WAC A;  3CCL Q;  2DX1 A;  3FRN A;  3BDU A;  4M77 G;  5EG2 A;  4LD9 K;  4JPB W;  4DQ2 A;  3OYH A;  1FWZ A;  2Q1A X;  3FC3 A;  3V7R A;  1X43 A;  1M9S A;  2JMA A;  1W1F A;  1ZBX A;  1NLP C;  1S72 Q;  1OQK A;  1Q81 R;  2MM0 A;  2MYS A;  4HVW A;  2LW6 A;  3C12 A;  3CCQ T;  3OSV A;  3HRT A;  3EFO B;  2QGF B;  1V29 B;  4D8D A;  3QDF A;  4E7J A;  4C8Q G;  4J6W A;  1R7R A;  2FZG B;  2QK0 A;  3UT1 A;  2V8J A;  1VA7 A;  4C8Q A;  4F7U B;  4JRI A;  1K73 C;  1R0B G;  2ZPE B;  1HK9 A;  2LT1 A;  2CH4 W;  1YIT A;  5KYU B;  1IZ6 A;  1BB9 A;  3MB5 A;  3QUI A;  1D3B B;  3REB B;  2RJD A;  1VQL A;  4ZN1 A;  4FM4 B;  3T9N A;  1VYU A;  1ZA1 B;  2IIM A;  2L5Q A;  2YXY A;  4PNO A;  4EMK C;  1Q82 U;  2R5A A;  1VIF A;  2PUK B;  3SFM A;  1G8X A;  1EZZ B;  1YI2 Q;  3CCU T;  2BKD N;  1KD1 C;  1Q86 U;  4HCK A;  2CSI A;  2HBP A;  2NUT B;  2LX7 A;  3PTA A;  5CD1 A;  3P8D A;  3MET A;  3QWX X;  1XNI A;  2YLB A;  1KQS S;  5GAN 7;  5GAN 8;  4M75 D;  3I55 T;  2A3L A;  5C6S A;  5GAM e;  1TUG B;  1X01 A;  5GAM f;  1FMK A;  3G71 T;  1QLY A;  2FZK B;  3MP6 A;  3OYF A;  2RM4 A;  1YIJ T;  1OEB A;  1IGQ A;  5GAO m;  4OB2 B;  2DEQ A;  1ABQ A;  4MDW A;  4JS5 A;  1UGS B;  2DBM A;  1Y57 A;  2YRC A;  3JV3 A;  4EMG A;  1W2B S;  2JMC A;  2RQU A;  4M7D G;  3PIO A;  2O9V A;  2DTH A;  3OYY A;  4M7D A;  1VQK A;  2K9G A;  2BUD A;  3CME T;  3CCL T;  2DZC A;  4J9H A;  1M8M A;  4C0D B;  1Q7Y C;  3G4S A;  2D6F A;  1QMC A;  2JS2 A;  3L2Q A;  2HDA A;  1TUC A;  2L8D A;  1JU5 C;  3G6E A;  1S72 T;  2DBK A;  5CQY A;  3JCM b;  2EYW A;  2DKG A;  2RN8 A;  2KRO A;  5KYX A;  4GBQ A;  2LMJ A;  2LQW A;  1K8A C;  4L6V 5;  5FTL A;  3MKD A;  2PTK A;  3I5R A;  4DBF A;  4DBR A;  2R58 A;  4RTU A;  2FRW A;  3L2V A;  1G3T A;  1FX7 A;  2YWW A;  2LQ8 A;  2HQX A;  2P84 A;  4HCC A;  2W0Z A;  5LJ3 j;  3MCA B;  2RI2 A;  2E1H A;  4M77 D;  3A8G B;  2NWM A;  4PJO C;  1PRL C;  2PWY A;  3M0T A;  3HPW A;  4IIM A;  4PL6 A;  2YVL A;  4PJO E;  2L0A A;  1M8V A;  1OU9 A;  5J39 A;  4M78 G;  2M1H A;  2EVR A;  3CD6 T;  4DBQ A;  2RD1 A;  3VS5 A;  1NJI U;  3CEY A;  4M78 A;  4PFP A;  3JB9 F;  2XKO C;  1QVF A;  1MV0 B;  2F2W A;  3X28 B;  2E3H A;  4OB1 B;  2MWP A;  3CCM Q;  1YI2 T;  1KJW A;  4C8Q D;  4Y91 A;  2LQK A;  4ARC A;  3S3O A;  4FIB A;  4E7H A;  2BTT A;  3NTK A;  3VS0 A;  2B8A A;  1AEY A;  4PJN A;  5CIU A;  1M30 A;  1MUZ A;  4LDX A;  3SWN A;  2RHX A;  1K9M R;  1WHK A;  1CZ4 A;  3MO8 A;  3EGD A;  2H8H A;  4FYY B;  5CKB A;  2LNV A;  1XOV A;  4R56 A;  2KAF A;  3NPF A;  3TQ7 P;  3E2U A;  4O5V A;  1WA7 A;  5CR2 A;  1LOJ A;  3TCJ A;  3HP9 A;  5KYW B;  1KQ2 A;  4EPC A;  2MMP A;  1D1B A;  2Z0W A;  3OYJ A;  2EYY A;  5GLF A;  2X4X A;  1QVG S;  2F5K A;  3KUF A;  2VWF A;  2OTJ Q;  3MEU A;  1E7O A;  3UAT A;  1K1Z A;  4RTX A;  2E70 A;  2BE7 D;  2X35 A;  4DA4 A;  2ZAE A;  2ZPG B;  1SRM A;  1H92 A;  3RMQ A;  1VQ6 A;  2DO3 A;  1ZUK A;  4XU3 A;  5HK0 A;  1NPP A;  2ZPF B;  4F17 A;  2XK0 A;  1M2V B;  2A36 A;  2JNG A;  3ZEH A;  3E1S A;  1VQN A;  3EHR A;  4OGE A;  2DER A;  1PWT A;  4O6J A;  2DAQ A;  1WJS A;  2LDM A;  4ZTJ A;  1Z9Z A;  2YRV A;  2RQV A;  4BI4 A;  2K5I A;  4M7D D;  5KE2 A;  1R77 A;  3L2U A;  2P4R A;  1HSQ A;  1UHF A;  3LLR A;  4RCC A;  1M2O A;  1D0Y A;  2DXU A;  5A0L A;  1KSW A;  2RHU A;  2HQE A;  5FWB A;  2DMO A;  4BI3 A;  1JBM A;  2RQT A;  2C0T A;  4MZT A;  4B6M A;  1M1K R;  2QA4 Q;  1H64 1;  4XTU A;  5DLO A;  1N9R A;  3REA B;  3EH1 A;  5A2Q E;  1Y07 A;  2JVV A;  3M54 A;  1YHQ A;  4C92 A;  4PJL A;  1VQM T;  2Q1C X;  4IUP A;  4JLI A;  1OV3 A;  2O2O A;  2YLC A;  4PK4 A;  1UEB A;  1GBQ A;  3THK A;  1YJN T;  2KE9 A;  1ZSZ B;  2K5L A;  4RTZ A;  4PLL A;  4FW2 A;  1IO6 A;  1YWP A;  3LYI A;  4M7A A;  4LNP A;  4M78 D;  2Y90 A;  4KBM B;  1I1J A;  1WGS A;  1RLQ C;  1JQQ A;  1N8R C;  3WVE B;  4J83 A;  3EG0 A;  2EGA A;  2YUQ A;  4ESR A;  2KYM A;  2XID A;  5FLX E;  1VQ8 A;  1VQ9 T;  3HU2 A;  4JJD A;  3MEW A;  2FO0 A;  2DIL A;  2OTJ T;  3VS1 A;  4QQD A;  3RKX A;  1B07 A;  2DL3 A;  1M1G A;  2L3R A;  4DOW A;  3BY7 A;  3TIW A;  3JB9 I;  2DXC A;  2LC4 A;  2G3R A;  1Y71 A;  4FSX A;  1NYG A;  4DOV A;  2MWO A;  4QVD A;  4D8K A;  2NUP A;  4WF2 A;  1VIE A;  1R0C B;  4BD3 A;  3UA7 A;  1QVF S;  2AKK A;  2AT1 B;  2CZ7 B;  4CQN A;  1PD0 A;  4M7D B;  3FLG A;  2KRM A;  3CCS T;  3UDC A;  2J6F A;  1D1A A;  1WPY A;  5I2S A;  2LCL A;  4D6W A;  4ATO A;  5GAM j;  1WQ7 A;  2BZ8 A;  4JJC A;  5CKF A;  3CC7 Q;  3M55 A;  3VS7 A;  4KGZ B;  3DB4 A;  3H0H A;  3R6O A;  3ER0 A;  4HCB A;  1SF9 A;  1QVF P;  5KYX B;  1E6H A;  2OAU A;  2DXT A;  3GOX A;  5FWC A;  4F7U F;  2RHY A;  2DTI A;  4FW1 A;  5D6W A;  2HBW A;  2EJG A;  2YUO A;  4IUQ A;  2A7Y A;  5DLQ E;  1X6G A;  5HK3 A;  3JCM e;  2DRM A;  3CPW A;  3HKS A;  2NYS A;  1X69 A;  2SEM A;  2P4T A;  3VRZ A;  3QJ6 A;  2LNH B;  1X2K A;  1WHL A;  2GNC A;  2EYQ A;  3VS2 A;  3HFN A;  4C92 F;  1VQP T;  1IXD A;  2QQR A;  5A0G A;  3JCM g;  3Q1J A;  3JCM J;  4M75 A;  2QI2 A;  1TS9 A;  1ZX6 A;  1RAG B;  4FYW B;  1QP3 A;  3A8O B;  2EIF A;  2OTL Q;  1WIE A;  5KYY B;  2J7I A;  4M7A F;  4J6X A;  3NGP A;  1OYX A;  2FPD A;  4FT4 A;  2GQI A;  3I55 A;  3CCU Q;  5FU7 C;  3OYA A;  1TXQ A;  3JCM h;  2HD0 A;  3CCJ Q;  3EFS A;  3VS4 A;  2GTO A;  4E7L A;  3G71 A;  3SWN B;  4HKE A;  2O01 E;  4JZ3 A;  1S3S A;  3EGD B;  2LT4 A;  3L42 A;  4ELY C;  3C95 A;  4C0G A;  3CF2 A;  1YIJ A;  3PMT A;  5GAN 4;  1K73 U;  2ABL A;  1BIB A;  1S1N A;  2CGH A;  4IUT A;  3PMI A;  3CXC A;  3CCE Q;  3DB3 A;  2BIV A;  2FHD A;  1OU8 A;  1FYN A;  5C0M A;  2MAM A;  3U23 A;  1M5Q 1;  1PKT A;  1YP5 A;  4KH1 B;  1SKU B;  1O9S A;  2K6D A;  4Z88 A;  5L23 A;  3HTR A;  1CKA A;  1GFC A;  3MEV A;  3CCL A;  3JCM V;  1MV3 A;  2FVU A;  4FYV B;  2EQK A;  1ZSZ C;  4KT0 E;  1H3Z A;  3VRY A;  3INZ A;  1GXI E;  1JXM A;  1UUE A;  5CKD A;  2LP5 A;  4F14 A;  5KCH A;  3CME Q;  4NOY A;  1S72 A;  2O4X A;  2X9H A;  3OYB A;  4M77 A;  2KK4 A;  4UC4 A;  2DEU A;  3CC7 T;  2BZX A;  2YUJ A;  2HZY A;  4CC7 A;  1VQ7 A;  3QYH B;  3OYE A;  3BW1 A;  5FTM A;  3QPH A;  3FDR A;  2YDL A;  1K4U S;  4LDU A;  4XQ3 A;  4L59 A;  2NUZ A;  1WX6 A;  3JCM c;  1JB0 E;  1R8O B;  1RAB B;  2WSF E;  1OZ3 A;  2EWN A;  2GCX A;  2AZS A;  5CCA A;  2COZ A;  4MZM A;  2QAS A;  5FW9 A;  2HCK A;  1NE8 A;  3ASK A;  3M5A A;  1PG5 B;  3OYN A;  2ROL A;  4M75 F;  4WTO B;  4N0A C;  1UFF A;  1Q82 R;  1PNJ A;  2ZPI B;  5FRN A;  2VV5 A;  3J80 E;  4RCB A;  4ELZ C;  1Q7Y U;  5CCX A;  1CR5 A;  5DM7 R;  1YI2 A;  3CD6 Q;  1Q86 R;  1YBY A;  4J9G A;  1U1S A;  2VAS A;  3L2R A;  2OTL T;  1NEB A;  2WSC E;  3EG1 A;  4C92 B;  2PJH B;  1Y96 A;  3M57 A;  4PKC C;  3CCR Q;  1RI9 A;  1K8A U;  4E7I A;  1D09 B;  3CCJ T;  4QKU A;  2FZC B;  2E65 A;  1BIA A;  3OBY A;  3LW5 E;  4A4G A;  1TSF A;  2DVE A;  1WXU A;  2IPO B;  1SSF A;  4CI0 C;  5DYI A;  3QII A;  1VUB A;  4M7A B;  5FRM A;  1Q95 G;  1RAH B;  2XU8 A;  6AT1 B;  3JB9 G;  1UHC A;  1X6O A;  3J81 E;  1BCO A;  2E5Q A;  2YT6 A;  4A4K A;  5GAN 6;  1I5L A;  3CCE T;  3AHU A;  2CUB A;  3L2Z A;  3EHQ A;  1JRI A;  5I2M A;  5IH2 A;  2KDS A;  1N27 A;  4X34 A;  1KHI A;  3WXM B;  2O88 A;  1QP2 A;  4RG8 A;  2LJ0 A;  4HXJ A;  4KUL A;  3M4G A;  4EIK A;  1MGQ A;  2HSE B;  1TG0 A;  4XTV A;  2VVK A;  1VQ5 A;  1NLO C;  4AG2 C;  2NUP B;  3PVQ A;  2HAX A;  4BDZ A;  4E6R A;  1U1T A;  2KXD A;  4YTL A;  2GFA A;  1SEM A;  3JCM P;  4KDL A;  2FRY A;  2E41 A;  4M77 F;  5FU6 B;  1ZLM A;  1YJW A;  5FTK A;  3CPW P;  3CQT A;  3FPR A;  4XU1 A;  4BDY A;  1PCX A;  1WZO A;  1Q81 C;  1X27 A;  3VYH B;  3OS2 A;  5FTN A;  1W70 A;  2CH4 A;  3LGA A;  1CSK A;  2X4W A;  4ZGD B;  3RBB B;  4E7S A;  3EFR A;  3QJY A;  4OML A;  1I4K 1;  1QCF A;  2PQW A;  5CO7 A;  1PM3 A;  4OMM A;  4EMK A;  2KXC A;  3CCV A;  1KQ1 A;  3SDZ A;  1UE9 A;  4C8Q F;  3OW2 A;  2DYI A;  4RKU E;  3TEE A;  1Q82 C;  4J5Y A;  3BFM A;  2QDY B;  1NJI R;  3KBG A;  3G4S Q;  3TSZ A;  2EW3 A;  2W10 A;  5L8R E;  2EGE A;  3G6E Q;  4ARI A;  2K57 A;  3CCM A;  3ZJV A;  4P5N A;  1HJD A;  3QG1 A;  3CBP A;  3M59 A;  4MML A;  4CC3 A;  4JZ4 A;  3MJX A;  2RJF A;  3CXC P;  4M75 B;  1RI0 A;  1W4S A;  4OMQ A;  2D8J A;  2DRK A;  2CRE A;  1H8K A;  1X6B A;  1TU0 B;  3CCR T;  1VQM Q;  2K79 A;  1KHC A;  3OYC A;  1YJN Q;  2RB6 A;  4LD6 A;  4J9F A;  1OPL A;  3QQ8 A;  2V8I A;  4BY6 B;  1MNE A;  3PE0 A;  4IUR A;  2Q1D X;  2YUP A;  3OYL A;  1OUL A;  2LTO A;  3GBQ A;  4XTX A;  3DKM A;  1ZC1 A;  4J9I A;  3GNF B;  2H3J A;  3ZGZ A;  2A37 A;  1MHN A;  2DVJ A;  4BB7 A;  4ZGJ B;  1CZ5 A;  1UGR B;  4KUD K;  2OTJ A;  1QCS A;  4J7I A;  1XJW B;  3RMS A;  4F7U E;  2JJ9 A;  8AT1 B;  3C94 A;  1UG1 A;  2EJ9 A;  1M27 C;  1VQ9 Q;  3EH2 A;  1X2Q A;  3DLL A;  2EJF A;  1VQO Q;  9ATC B;  5I22 A;  4AFS C;  3TRE A;  1HYO A;  3OY9 A;  1UB4 A;  2PUO B;  2ENM A;  4K11 A;  5EQJ B;  3VU3 C;  4M7D F;  5GAO r;  2V26 A;  1WHH A;  3JB9 D;  2CZ1 B;  3VJP A;  4XU2 A;  5GAN e;  2C0I A;  5AT1 B;  5B6C A;  4C92 E;  5KYN A;  3OYM A;  2RQR A;  4HVU A;  5GAN f;  3I56 A;  1JJ2 A;  1HD3 A;  1I9G A;  3JCM d;  4PJO G;  1YN8 A;  1RUW A;  5GAN g;  1N8R U;  3CCS Q;  3A1P A;  2K3Y A;  5A0D A;  4PJO A;  4OP0 A;  4M7A E;  2M0O A;  4GY5 A;  2O4X B;  4X1V A;  2HKQ B;  2KQW A;  4MZP A;  4PFZ A;  2HL3 A;  4M77 B;  2I2L A;  2VXF A;  4CRI A;  1MMN A;  2FEI A;  1C1A A;  1AT1 B;  3CC4 Q;  2KRS A;  5GAN h;  1AZG B;  1D1C A;  2CZ0 B;  3LX7 A;  2L3P A;  1AVZ C;  1NJI C;  2DL4 A;  3OMC A;  3OYD A;  3H0I A;  2QA4 A;  5GMK e;  2KVQ G;  4DEX A;  4FCY A;  3G4S T;  1GFD A;  3QSU A;  2RHI A;  5GMK i;  4M78 F;  4C8Q B;  1RAC B;  3G6E T;  1BI1 A;  3EFO A;  2CUD A;  2EAY A;  3QWY A;  1OOT A;  2CDT A;  4DBH A;  2CT4 A;  8ATC B;  1VQP Q;  3JCM X;  4C0D C;  1WLF A;  2LQN A;  1YFN A;  3A5Z B;  2PNI A;  5HCK A;  3OBW A;  1YNZ A;  2D0N A;  2QAZ A;  1M3A A;  3JAM E;  2D8H A;  5GAO q;  1EIF A;  2EKH A;  5GMK h;  2FG0 A;  2MF2 A;  1Y96 B;  3BDL A;  1K9M C;  1PSF A;  2KSS A;  3OYK A;  2RJC A;  1AZE A;  4RV0 A;  2O31 A;  3E9G A;  3PT9 A;  4C5G A;  3CMA A;  4VUB A;  4RTV A;  3AT1 B;  4HA8 A;  4QQ6 A;  3V7S A;  4JRP A;  2A08 A;  1I5O B;  1OPK A;  2PVG B;  3M4Y A;  2LCC A;  2M16 A;  4OB3 B;  3UWN A;  4RUG A;  2X4J A;  2EQI A;  1M3B A;  2DL7 A;  2KNB B;  2DL5 A;  1Y0M A;  1ABO A;  4XTY A;  2CP7 A;  2VGM A;  3G7Z A;  2XDD A;  2MCN A;  2EPD A;  3NTI A;  1NG2 A;  1T0H A;  1RAE B;  4JDS A;  3O5Z A;  1VQO T;  5GAN 2;  5EC7 A;  2J06 A;  3RUX A;  4FU6 A;  4N4I A;  3UPU A;  2RI5 A;  1BI0 A;  3HRS A;  4LE9 A;  2YSQ A;  5IHN A;  1MND A;  4N4H A;  1VQ4 Q;  4M75 E;  1IGU A;  3UA6 A;  3ZFJ A;  1LCK A;  1GCQ C;  3ZL7 C;  2VKN A;  1SSH A;  2FPF A;  4ZTF A;  4HVV A;  3OW2 P;  2LJ3 A;  4AQ7 A;  2KT1 A;  3GIB A;  2RJE A;  2DNU A;  3CC7 A;  2RK2 A;  3H8Z A;  5CK9 A;  1NBE B;  4EMH A;  1M90 R;  4JJB A;  1YJ9 Q;  3FEO A;  4KDI A;  4C0Z A;  4FT2 A;  3SD4 A;  3CBM A;  5LJ3 g;  3CCQ A;  3CC4 T;  3S3N A;  1IRE B;  1BK2 A;  1G3W A;  2QTX A;  3A8H B;  4BAC A;  1M90 U;  1PSE A;  2D0Q B;  2Q18 X;  1KC8 U;  1G3S A;  4ZGE B;  4F04 B;  3R6N A;  1RAF B;  3H9N A;  4PJO D;  3FPU A;  4XTZ A;  1M1K C;  1AWX A;  5LJ3 h;  1VQN T;  5DY9 A;  4QVZ A;  5KCO A;  1KQS A;  2EQJ A;  3H41 A;  2M9U A;  2JUF A;  5EPP A;  3JCM f;  2F5T X;  2BE9 B;  2GTJ A;  2ZCF B;  2OTL A;  2CP5 A;  2DET A;  3M0Q A;  4KUI A;  2A0F B;  3CCU A;  5HKC A;  4JUV A;  5GAO p;  4M78 B;  4J6Y A;  5IAY A;  1NEG A;  2M51 A;  2K2V A;  2YUN A;  4M77 E;  3FIF A;  2DIQ A;  2LZ6 B;  3QZ5 B;  4B9X A;  3MP1 A;  3GNG A;  1BI3 A;  2DXB A;  4Z8A A;  3KXT A;  1W2B A;  1K73 R;  1I0C A;  1AOJ A;  5LJ5 e;  1PKS A;  3I5S A;  2ECZ A;  3CCE A;  5LJ5 f;  1WHJ A;  2QQ9 A;  2XDP A;  1F1B B;  2XD0 A;  3RR6 A;  1K9A A;  5LJ5 g;  1JJ2 P;  3OQ5 A;  4NS5 A;  1NPR A;  3OS0 A;  1J3T A;  4C8Q C;  4ZNX A;  2JM9 A;  1NYF A;  4XK8 E;  2LRQ A;  4LDW A;  2JXB A;  4C8Q E;  4AFZ C;  3E19 A;  3MHX A;  2DK3 A;  2DPP B;  3RES A;  5IHK A;  2BZY A;  1NZ9 A;  2Y4X A;  3ULR B;  4DEY A;  5LJ5 h;  2R57 A;  1VQ4 T;  3A98 A;  1HXD A;  2GGR A;  1KD1 U;  4Y92 A;  5KYW A;  1SHF A;  3CME A;  2QEX Q;  2ROT A;  1N9S A;  2DJZ A;  1FMW A;  2MK5 A;  2JW4 A;  1A0N B;  1D0X A;  2DYB A;  2GF7 A;  2O9S A;  1VQ8 T;  1AHJ B;  3P8H A;  2A28 A;  2RNA A;  3CC2 Q;  1IB8 A;  1YJ9 T;  2RQW A;  4PJO B;  1C6V X;  1UGP B;  1M2V A;  1OX8 A;  2AZV A;  2VYT A;  2DD4 A;  3EG9 A;  4V2S A;  1AWJ A;  3NFC A;  2RK1 A;  3LGF A;  4LUE A;  2QYZ A;  1PRM C;  2K2M A;  4QW2 A;  1WYX A;  1ZA2 B;  2Y4Y A;  1WFW A;  2JZ2 A;  3EGU A;  1IHW A;  2RF0 A;  1U8R A;  2AHJ B;  3LH0 A;  2DD5 A;  5CKE A;  1V76 A;  1KK7 A;  3FJ5 A;  1Q7Y R;  2JS0 A;  1FXX A;  3P8B B;  1N5Z A;  3EG2 A;  5D7U A;  5J26 A;  5GAN 3;  4X9D A;  3CD6 A;  4E47 A;  1QDN A;  2QDL A;  5GAN j;  1AD5 A;  2F2V A;  2XG8 D;  1QKX A;  4RTY A;  4A54 A;  1QQJ A;  4M7D C;  2MIO A;  5CCB A;  2RI3 A;  1OX9 A;  2EFI A;  1VQ7 Q;  2M0Y A;  3CCR A;  1OI1 A;  1K8A R;  4M7D E;  4RG2 A;  3QWZ A;  4A4E A;  2HQH A;  4AMC A;  5J3B A;  2EBP A;  1Q81 U;  2MOX A;  3M9Q A;  1K0X A;  3SEM A;  2P0P A;  2KY9 A;  1QVG A;  1YCY A;  2DM1 A;  4IUV A;  1V1C A;  2CS7 A;  2FPE A;  4IUU A;  4Q5W A;  4KRT A;  3NMZ C;  3M0S A;  5GAN d;  3URG A;  4QT7 A;  2ATC B;  1U3O A;  2B25 A;  4CC4 B;  1YIT Q;  3J7A F;  1BU1 A;  1ACM B;  1TH7 A;  2F2X A;  2QQA A;  1B3Q A;  1LVK A;  5GMK j;  2G6F X;  2JOY A;  1ZSZ A;  3CPF A;  1VQL Q;  1U06 A;  4X9C A;  3V7C A;  2HKN A;  3F70 A;  5GMK l;  1N6A A;  2KMT A;  3PFS A;  3RIR A;  3CPW S;  1QWF A;  2Q19 X;  3OMG A;  2K3B A;  3HHT B;  2RPN A;  2QG9 B;  3H0F A;  1DJ7 B;  3PNW C;  1G2B A;  4M78 C;  3JB9 J;  4XAX B;  3LWI A;  4J9B A;  1SHG A;  1TUD A;  5C18 A;  2CP6 A;  1CKB A;  4M78 E;  3GPL A;  2QEX T;  3VS6 A;  4Z02 A;  5GAM g;  4GLM A;  3LH5 A;  2HNI A;  3DLM A;  2EQM A;  2X3W D;  1QCN A;  2KRN A;  4AS1 A;  4C5H A;  4ZN3 A;  4TVR A;  1KQS P;  3MPU B;  3L1A A;  3SWN C;  1M1F A;  3CC2 T;  1WJQ A;  4A53 A;  3BQB A;  2VXE A;  2DL8 A;  1ARK A;  5GAM h;  1I07 A;  3X25 B;  4N0A A;  4B9W A;  3GLX A;  3HL8 A;  1LNX A;  3BE3 A;  3V8K A;  3OSS C;  1H3H A;  1VQ5 Q;  2B86 A;  3C0C A;  1G5V A;  1WDX A;  3CXC S;  1K76 A;  2VB6 A;  3RDV A;  4LDY A;  1BCM A;  3OA6 A;  3M0R A;  1VQK Q;  3LHD A;  2XMF A;  1PD1 A;  2COW A;  2QGG A;  1YJW Q;  4N4G A;  1W2B P;  1GL5 A;  2L3Q A;  4OMO A;  4LN2 A;  1Q86 C;  1X75 C;  1WXT A;  2LX9 A;  1VQ7 T;  2J6O A;  4ORZ A;  3EG3 A;  1KIK A;  1PHT A;  2X51 A;  2E3I A;  1VQM A;  4QVC A;  1WNL A;  3HU1 A;  4BE0 A;  2FYK A;  4M4Z A;  3A8M B;  1WJR A;  3OB9 A;  3ZBD A;  1QCO A;  1YJN A;  2KGT A;  7AT1 B;  4Y28 E;  1TTH B;  4ME7 A;  3CCV Q;  4J9C A;  4RTW A;  3PVL A;  4C5E A;  4JRQ A;  4J9E A;  3HFO A;  3A8L B;  2KEA A;  1AWO A;  1SG5 A;  1FMV A; 
#chains in the Genus database with same CATH homology
 2C06 A;  1K9M C;  2L5Q A;  4PNO A;  4EMK C;  1Q82 U;  2R5A A;  1PSF A;  2KSS A;  3X24 B;  4J6X A;  3OYK A;  2RJC A;  4M7A F;  1BYM A;  1OYX A;  1VIF A;  4FT4 A;  3I55 A;  5I21 A;  4RV0 A;  3PT9 A;  3E9G A;  2PUK B;  5FU7 C;  3SFM A;  4C5G A;  5GAO l;  3OYA A;  3CMA A;  1YIT T;  4VUB A;  3JCM h;  3CCU T;  2BKD N;  2HD0 A;  1QW1 A;  1KD1 C;  1I81 A;  4HA8 A;  4QQ6 A;  1Q86 U;  4PLI A;  3V7S A;  2HBP A;  1OZ2 A;  3EFS A;  3WVD B;  3PTA A;  4JRP A;  5CD1 A;  3P8D A;  1B34 A;  3MET A;  2PVG B;  4E7L A;  1VQ9 A;  3M4Y A;  1VQL T;  2LCC A;  1XNI A;  2M16 A;  3PGG A;  4OB3 B;  5LL6 S;  3UWN A;  3SWN B;  2YLB A;  2X4J A;  4HKE A;  5LJ3 d;  5M9O A;  5GAN 7;  2O01 E;  3L2W A;  3M58 A;  5GAN 8;  3VV0 A;  1KQS S;  1S3S A;  3N5B B;  2LT4 A;  3L42 A;  4GLK A;  4M75 D;  5AYF A;  2A3L A;  4ELY C;  3I55 T;  3C95 A;  4C0G A;  3CF2 A;  1YIJ A;  4XTY A;  3PMT A;  5GAN 4;  2GQV A;  1K73 U;  5C6S A;  5GAM e;  2VGM A;  1BIB A;  3G7Z A;  4KO8 A;  4LDV A;  2CGH A;  1X01 A;  2XDD A;  1E32 A;  4IUT A;  2ZZD A;  3PMI A;  3CXC A;  3NTI A;  3DB3 A;  2BIV A;  5GAM f;  2FHD A;  2K3X A;  4KLN A;  4JDS A;  3G71 T;  1VQO T;  3HU3 A;  5GAN 2;  3FPT A;  2K4Y A;  3RUX A;  2MAM A;  5C0M A;  3ZJT A;  2D9T A;  4FU6 A;  3MP6 A;  4N4I A;  4NL3 A;  2RI5 A;  3MP8 A;  3SB2 A;  3UPU A;  1M5Q 1;  3OYF A;  1BI0 A;  1K9M U;  3NTH A;  2RM4 A;  3HRS A;  4C92 C;  1YIJ T;  4N4H A;  5GAO m;  4OB2 B;  2DEQ A;  2EKO A;  2YHT A;  3GF5 A;  4M75 E;  4MDW A;  3CCS A;  1O9S A;  3O8V A;  1BKB A;  4JS5 A;  3ZFJ A;  1M90 C;  1KG1 A;  4JRK A;  1UGS B;  3RKY A;  3ZJU A;  4ZTF A;  4EMG A;  2XHC A;  1G3Y A;  3MEV A;  3JCM V;  1W2B S;  3CCL A;  4AQ7 A;  2FVU A;  5LJ5 j;  4M7A C;  2EQK A;  4M7D G;  3GIB A;  3QZ9 B;  4KT0 E;  2RJE A;  1H3Z A;  3PIO A;  3CC4 A;  3CC7 A;  2RK2 A;  3INZ A;  3H8Z A;  1GXI E;  3QKJ A;  2DTH A;  5CKD A;  3OYY A;  3JRZ A;  4M7D A;  3X26 B;  5CK9 A;  4EMH A;  3FB9 A;  1VQK A;  5KCH A;  4NOY A;  1S72 A;  2BUD A;  2O4X A;  3CME T;  3CCL T;  3FEO A;  2DZC A;  5CCX A;  2DIG A;  4L5G A;  3OYB A;  4C0Z A;  4FT2 A;  3SD4 A;  3CBM A;  4KDI A;  4C0D B;  5LJ3 g;  1XQH A;  1VQ5 T;  3CCQ A;  1Q7Y C;  4HT9 A;  4M77 A;  2KK4 A;  4UC4 A;  3G4S A;  3CC4 T;  3S3N A;  2JTF A;  3CC7 T;  2D6F A;  2YUJ A;  2MF2 A;  3L2Q A;  1IRE B;  3VYG A;  1G3W A;  2QTX A;  3QDR B;  1VQ7 A;  5C1B A;  3QYH B;  3OYE A;  2L8D A;  3A8H B;  4BAC A;  1M90 U;  3BW1 A;  1VQK T;  4A4H A;  1PSE A;  2D0Q B;  2E6N A;  2Q18 X;  3G6E A;  1G3S A;  2K5F A;  2MI6 A;  3QPH A;  1KC8 U;  5FTM A;  1S72 T;  4ZGE B;  2VUB A;  3FDR A;  5CQY A;  3JCM b;  1YJW T;  4LDU A;  4XQ3 A;  4L59 A;  2E10 A;  4BI8 B;  2DKG A;  3JCM c;  1JB0 E;  4PJO D;  3FPU A;  1R8O B;  2IG0 A;  4XTZ A;  5LJ5 d;  1VQP A;  1K8A C;  1M4Z A;  1M1K C;  2RO0 A;  4L6V 5;  5FTL A;  2WSF E;  5FU7 B;  5LJ3 h;  1VQN T;  5DY9 A;  2IVW A;  4QVZ A;  1OZ3 A;  5KCO A;  2EWN A;  2GCX A;  2EQJ A;  2R58 A;  3V8J A;  1KQS A;  2V8K A;  3E9F A;  3L2V A;  5CCA A;  3LWH A;  1G3T A;  3FJP A;  4MZM A;  3VUZ A;  1FX7 A;  1P92 A;  2M9U A;  2JUF A;  2LQ8 A;  3QBY A;  5EPP A;  1NE8 A;  3JCM f;  2HQX A;  4HCC A;  3ASK A;  5LJ3 j;  2F5T X;  3MCA B;  2RI2 A;  2E1H A;  5FU6 C;  3M5A A;  4M77 D;  2ZCF B;  4OVA A;  3OYN A;  3A8G B;  4F7U G;  4M75 F;  2OTL A;  4PJO C;  4N0A C;  4BUG A;  2XI9 A;  4C5I A;  2PWY A;  2ZPI B;  3HPW A;  5IT9 E;  5FRN A;  2VV5 A;  4J7F A;  4KUI A;  4PL6 A;  3J80 E;  2YVL A;  4A4F A;  1ZHI A;  4RCB A;  4ELZ C;  4F7U A;  4JUV A;  5HKC A;  3CCU A;  5GAO p;  3CCV T;  1Q7Y U;  3X20 B;  5DM7 R;  1YI2 A;  4PJO E;  1M8V A;  1CR5 A;  5J39 A;  4M78 B;  5KH6 A;  4M78 G;  4J6Y A;  1YBY A;  2M1H A;  3QYG B;  4J8O A;  5IAY A;  3CD6 T;  2RD1 A;  1NJI U;  1U1S A;  3LGL A;  3L2R A;  3CEY A;  2R5M A;  2OTL T;  3QC8 A;  4M78 A;  1O54 A;  1D3B A;  2K2V A;  2WSC E;  2FB7 A;  1WQW A;  3JB9 F;  2XKO C;  4NL2 A;  4OGC A;  4JLG A;  4C92 B;  2PJH B;  1Y96 A;  3M57 A;  4PKC C;  4C92 G;  4M77 E;  1QVF A;  3FIF A;  2DIQ A;  3X28 B;  4IKF A;  3QZ5 B;  1K8A U;  4OB1 B;  4B9X A;  1M1K U;  3MP1 A;  2MWP A;  3GNG A;  4E7I A;  1BI3 A;  2DXB A;  3V8L A;  5KE3 A;  4C0F A;  3KXT A;  1YI2 T;  1W2B A;  2ZGW A;  5LJ5 e;  4C8Q D;  3CCM T;  1O75 A;  4Y91 A;  3CCJ T;  2LQK A;  4ARC A;  2E65 A;  3RKW A;  1BIA A;  3OBY A;  3LW5 E;  4A4G A;  2RH2 A;  2DVE A;  4FIB A;  5LJ5 f;  5GAN 5;  3CCE A;  4E7H A;  3JCM W;  1SSF A;  2QQ9 A;  3NTK A;  1BI2 A;  2B8A A;  5CIU A;  2XDP A;  1VUB A;  3QII A;  4CI0 C;  5DYI A;  4M7A B;  5FRM A;  2GFU A;  3OW2 S;  4M7A G;  2XU8 A;  2XD0 A;  3JB9 G;  4LDX A;  3SWN A;  2RHX A;  3OS5 A;  1X6O A;  5LJ5 g;  3J81 E;  1CZ4 A;  3MO8 A;  2E5Q A;  3OQ5 A;  2WSE E;  4NS5 A;  1NPR A;  4BE1 A;  3OS0 A;  2VC8 A;  2EQU A;  4C8Q C;  4A4K A;  5GAN 6;  1VQ4 A;  5CKB A;  1I5L A;  2LNV A;  1XOV A;  1XTD A;  4R56 A;  2X4Y A;  3CCE T;  5D6Y A;  4XK8 E;  2LRQ A;  3QXE B;  2KAF A;  4LDW A;  3AHU A;  4C8Q E;  3L2Z A;  3E19 A;  3MHX A;  4O5V A;  1Y7X A;  2DK3 A;  2DPP B;  4M75 C;  3RES A;  3PIP A;  1JRI A;  1RL2 A;  1NZ9 A;  5I2M A;  5CR2 A;  1LOJ A;  4XU0 A;  3TCJ A;  2Y4X A;  2KDS A;  3HP9 A;  5LJ5 h;  1N27 A;  1KQ2 A;  2R57 A;  2MMP A;  4X34 A;  4EPC A;  1VQ4 T;  1KHI A;  1HXD A;  3WXM B;  3OYJ A;  5GLF A;  2X4X A;  1QP2 A;  4RG8 A;  1KD1 U;  2FL7 A;  3VUB A;  1QVG S;  2F5K A;  3KUF A;  2CYZ B;  3M4G A;  4KUL A;  3MEU A;  1MGQ A;  3CME A;  5FRO A;  4PJO F;  4XTV A;  1YJ9 A;  2E70 A;  4JS4 A;  1N9S A;  1VQ5 A;  2DJZ A;  4BY6 C;  2X35 A;  3QHS A;  4E7K A;  4DA4 A;  2HAX A;  2ZPG B;  5LJ3 e;  4BDZ A;  2GF7 A;  4HCZ A;  3RMQ A;  1U1T A;  2P0K A;  4HT8 A;  4EDU A;  1VQ6 A;  4YTL A;  1VQ8 T;  5LJ3 f;  1AHJ B;  2DO3 A;  2GFA A;  4XU3 A;  3JCM P;  5HK0 A;  4KDL A;  2E41 A;  3P8H A;  2VGN A;  4M77 F;  1NPP A;  2ZPF B;  3GP8 A;  5FU6 B;  2XK0 A;  1YJW A;  2DZ9 A;  5FTK A;  3S6W A;  1YJ9 T;  2JN0 A;  4PJO B;  2JNG A;  3FPR A;  3ZEH A;  2JV2 A;  2PVD B;  2PVO B;  4XU1 A;  4BDY A;  1UGP B;  3E1S A;  3H6Z A;  1VQN A;  1VQ6 T;  2RHZ A;  2VYT A;  2DD4 A;  4V2S A;  1UGQ B;  5CKH A;  1Q81 C;  4OGE A;  3VYH B;  3OS2 A;  5FTN A;  3NFC A;  2QQB A;  2RK1 A;  3LGF A;  4QQG A;  3OS1 A;  3LGA A;  4O6J A;  2DAQ A;  4QW2 A;  1WJS A;  2LDM A;  3ME9 A;  3I56 T;  4ZTJ A;  5FTJ A;  2X4W A;  4ZGD B;  4EMK B;  2YRV A;  2DTO A;  2Y4Y A;  2JZ2 A;  4BI4 A;  3EFR A;  3QJY A;  2K5I A;  1I4K 1;  1U8R A;  4M7D D;  2AHJ B;  3LH0 A;  5KE2 A;  2PQW A;  5CO7 A;  2DD5 A;  1LJO A;  4EMK A;  5CKE A;  3L2U A;  3CCV A;  1KQ1 A;  3SDZ A;  4C8Q F;  4KOD A;  1FXX A;  3OW2 A;  3LLR A;  3OYI A;  3P8B B;  4RCC A;  5J26 A;  5GAN 3;  3M56 A;  1QDN A;  4X9D A;  3CD6 A;  4E47 A;  2DXU A;  5A0L A;  4RKU E;  3VKI A;  3TEE A;  2RA2 A;  1Q82 C;  4J5Y A;  3BFM A;  2QDY B;  2RHU A;  5GAN j;  3QQ7 A;  2HQE A;  2QQS A;  3QO3 A;  2XG8 D;  3KBG A;  4A54 A;  2CKK A;  4BI3 A;  3RER A;  4M7D C;  1JBM A;  5CCB A;  2RI3 A;  2EFI A;  3C4S A;  4MZT A;  5L8R E;  3CCR A;  1OI1 A;  1JJ2 S;  4M7D E;  4RG2 A;  4ARI A;  3QWZ A;  4A4E A;  2K57 A;  3CCM A;  3ZJV A;  5J3B A;  3CCJ A;  4P5N A;  1Q81 U;  5GAO n;  1H64 1;  2XDB A;  3QG1 A;  2JTM A;  3CBP A;  3M9Q A;  1N9R A;  4II1 A;  4XTU A;  5DLO A;  2QA4 T;  4M77 C;  3M59 A;  4MML A;  5GAM d;  5A2Q E;  2RJF A;  3JCM Q;  4M75 B;  2P0P A;  1RI0 A;  1W4S A;  2KY9 A;  2XIC A;  4M75 G;  5CQX A;  1QVG A;  3JB9 H;  2PU9 B;  1YCY A;  2F69 A;  3HRU A;  1Y07 A;  4IUV A;  3G71 A;  3CCR T;  4OF1 A;  2JVV A;  3M54 A;  1YHQ A;  2CS7 A;  4C92 A;  4OB0 B;  1VQM T;  1KHC A;  4IUU A;  4Q5W A;  2Q1C X;  4IUP A;  3OYC A;  3TU4 K;  4JLI A;  2YLC A;  1UEB A;  2RB6 A;  4LD6 A;  5GAN d;  1YJN T;  3URG A;  3QQ8 A;  4BE2 A;  2B25 A;  2V8I A;  4BY6 B;  3J7A F;  2K5L A;  4IUR A;  1B34 B;  1TH7 A;  2QQA A;  1YHQ T;  2Q1D X;  2P0Q A;  4PLL A;  3CBO A;  3OYL A;  3OYG A;  3LYI A;  3MEA A;  5GMK j;  3HSB A;  4M7A A;  2JOY A;  2LTO A;  3CPF A;  4XTX A;  2ZPH B;  3DKM A;  2Y90 A;  4M78 D;  4MDX A;  4X9C A;  1ZC1 A;  3GNF B;  1WGS A;  4KBM B;  3V7C A;  2H3J A;  5HY6 A;  3ZGZ A;  1MHN A;  3F70 A;  2E12 A;  4BB7 A;  4ZGJ B;  5GMK l;  1N6A A;  2KMT A;  1CZ5 A;  1N8R C;  1UGR B;  3PFS A;  3WVE B;  4J83 A;  4KUD K;  2CZ6 B;  4J7I A;  2OTJ A;  1QVP A;  3RIR A;  1QCS A;  3CPW S;  2QEX A;  2E6Z A;  3RMS A;  3CMA T;  4C92 D;  3S3M A;  2Q19 X;  4F7U E;  2XID A;  3OMG A;  5CVI A;  3C94 A;  2EJ9 A;  3HHT B;  1DJ7 B;  3PNW C;  5FLX E;  3DLL A;  1I8F A;  2EJF A;  4M78 C;  3JB9 J;  1VQ9 T;  1VQ8 A;  3HU2 A;  4XAX B;  3LWI A;  3MEW A;  2L89 A;  4OMF B;  5C18 A;  3TRE A;  3OY9 A;  1UB4 A;  2PUO B;  2OTJ T;  4M78 E;  5EQJ B;  3GPL A;  2QEX T;  4QQD A;  3VU3 C;  3CC2 A;  3RKX A;  5GAO r;  2L3R A;  1M1G A;  4Z02 A;  5GAM g;  4M7D F;  4DOW A;  5CAI A;  4M7A D;  3BY7 A;  3TIW A;  3JB9 D;  2CZ1 B;  2HNI A;  3VJP A;  3DLM A;  2ZPB B;  4XU2 A;  2DXC A;  2EQM A;  2E64 A;  2G3R A;  2LC4 A;  4FL6 A;  5IN1 A;  1Y71 A;  4FSX A;  5GAN e;  4RMO A;  1KC8 C;  5DYG A;  4C92 E;  4DOV A;  2MWO A;  3OYM A;  2MM2 A;  4QVD A;  5B6C A;  4AS1 A;  3EAE A;  4MMK A;  1VIE A;  4WF2 A;  4C5H A;  4TVR A;  4ZN3 A;  5GAN f;  4BD3 A;  4XTW A;  1QVF S;  3I56 A;  3L1A A;  5D6X A;  3SWN C;  1JJ2 A;  3M53 A;  1I9G A;  1M1F A;  2NLU A;  3JCM d;  5GMK m;  1WJQ A;  3CC2 T;  2CZ7 B;  4PJO G;  4R55 A;  4CQN A;  4A53 A;  5GAN g;  3BQB A;  4M7D B;  2VXE A;  1N8R U;  4JJN K;  5GAM h;  5ERG B;  2QXF A;  3FLG A;  2K3Y A;  2LVM A;  5A0D A;  3UDC A;  3CCS T;  4PJO A;  4OP0 A;  4N0A A;  3X25 B;  4B9W A;  2M0O A;  4GY5 A;  4M7A E;  1VQO A;  2O4X B;  2KQW A;  1WPY A;  5I2S A;  3JSC A;  4MZP A;  1ZQ1 A;  2LCL A;  3GLX A;  2WAC A;  4D6W A;  3HL8 A;  3FRN A;  4ATO A;  4M77 B;  1LNX A;  2I2L A;  2VXF A;  3BDU A;  4M77 G;  3OSS C;  3V8K A;  5EG2 A;  4CRI A;  5GAM j;  1WQ7 A;  4LD9 K;  4DQ2 A;  3OYH A;  1FWZ A;  1G5V A;  2Q1A X;  5CKF A;  3FC3 A;  3CXC S;  3M55 A;  5GAN h;  3DB4 A;  3R6O A;  3ER0 A;  4LDY A;  3V7R A;  2CZ0 B;  3OA6 A;  3LX7 A;  4HCB A;  3LHD A;  1M9S A;  1ZBX A;  1NJI C;  4N4G A;  3OMC A;  3OYD A;  2OAU A;  3JB9 I;  2DXT A;  3GOX A;  2QA4 A;  2MM0 A;  4F7U F;  5GMK e;  2RHY A;  2KVQ G;  2LW6 A;  2DTI A;  5D6W A;  3C12 A;  2EJG A;  3OSV A;  3CCQ T;  3HRT A;  3G4S T;  4IUQ A;  1Q86 C;  2A7Y A;  5DLQ E;  1X75 C;  2LX9 A;  1V29 B;  5HK3 A;  1VQ7 T;  3QSU A;  2RHI A;  5GMK i;  4E7J A;  3JCM e;  4M78 F;  4C8Q B;  3CPW A;  3HKS A;  4C8Q G;  4J6W A;  1VQM A;  3G6E T;  1BI1 A;  4QVC A;  2P4T A;  2EAY A;  1WNL A;  1R7R A;  3QJ6 A;  3HU1 A;  4BE0 A;  3UT1 A;  2V8J A;  2FYK A;  4C8Q A;  3A8M B;  1WJR A;  3OB9 A;  3ZBD A;  4F7U B;  3JCM X;  1YJN A;  4C0D C;  4JRI A;  1WLF A;  2EYQ A;  1VQP T;  3HFN A;  4C92 F;  3A5Z B;  1K73 C;  2QQR A;  5A0G A;  4Y28 E;  3JCM g;  3S3O A;  4ME7 A;  2ZPE B;  1HK9 A;  3Q1J A;  3JCM J;  2LT1 A;  3OBW A;  1YIT A;  4M75 A;  1IZ6 A;  3JAM E;  2QI2 A;  4C5E A;  4JRQ A;  5GAO q;  3MB5 A;  3QUI A;  1D3B B;  1EIF A;  1QP3 A;  3HFO A;  2RJD A;  1VQL A;  4ZN1 A;  3A8O B;  3A8L B;  4FM4 B;  3T9N A;  5GMK h;  2EIF A;  1Y96 B;  3BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...