2QQSA

Jmjd2a tandem tudor domains in complex with a trimethylated histone h4-k20 peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Distinct binding modes specify the recognition of methylated histones H3K4 and H4K20 by JMJD2A-tudor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 18
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqsA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2qqsA02
2R58A 3L42A 3ZEHA 1WGSA 2R57A 5FRMA 3DB3A 2QQRA 4A4HA 4IKFA 1G5VA 4BE0A 2RO0A 4QW2A 2DIGA 3Q1JA 3OYDA 3OMGA 3OYGA 3S3NA 3OYFA 2RJCA 3OYNA 2MWOA 5FRNA 2K3YA 4BD3A 1KHCA 2RI2A 3P8DA 2BKDN 2EQKA 3MO8A 1OYXA 2RJFA 3KUFA 3OYMA 3C4SA 1XNIA 5KE2A 3BDLA 5CIUA 4IUUA 2EQUA 4X34A 2RHYA 4LD6A 2RI3A 3OYHA 4N4GA 3L2QA 4E7HA 2X4XA 2PQWA 3LX7A 2MWPA 2O4XA 3OA6A 2EQMA 2BUDA 2RJDA 2M16A 3CEYA 2L3RA 3SD4A 3MEUA 4RG2A 4QQGA 3P8HA 2EQJA 2O4XB 2LVMA 2G3RA 5FROA 3EAEA 3FLGA 3LYIA 4BACA 3S6WA 2GFUA 2RHUA 3OY9A 2JTFA 2RHZA 2RJEA 4HCZA 4IUTA 2X4YA 4PLIA 5D6WA 5KCHA 3LH0A 3META 2WACA 3M9QA 4FU6A 5KH6A 4QQ6A 3S3OA 1SSFA 2M0OA 4IUQA 4Q5WA 2L8DA 3H6ZA 2D9TA 1WJSA 2DIQA 2YRVA 4A4GA 5J39A 3OS1A 3OYIA 3NTHA 4B9WA 3QKJA 2HQEA 2EFIA 3DLMA 2M1HA 4UC4A 3OYCA 2XK0A 3FEOA 3NTKA 4II1A 4IURA 3MEWA 3MP6A 3E9GA 5M9OA 2CKKA 3ME9A 2P0KA 1OI1A 1WJRA 3OMCA 3PMIA 2K3XA 4GY5A 4C5GA 4E7IA 2LCCA 1RI0A 4L59A 2QQSA 1OZ2A 3OB9A 3OQ5A 3ASKA 2FHDA 4IUVA 4PLLA 5D6XA 3MP1A 3L2WA 3GOXA 2DAQA 5IAYA 4C5IA 3OYLA 3FC3A 2F5KA 2LRQA 2E6NA 3S3MA 3E9FA 3NTIA 4BE1A 3O8VA 1N27A 4C5HA 3PMTA 3QJ6A 4IUPA 3L2RA 2HQXA 2R5MA 4QVZA 4N4IA 5C0MA 2EKOA 3L2VA 2RI5A 2NLUA 3LGFA 5J26A 3DB4A 5IN1A 3OS2A 3PFSA 3UWNA 4C5EA 4NS5A 1H3ZA 2XDPA 4A4FA 5C6SA 3FDRA 4QQDA 4E7LA 3MEVA 5KCOA 3OYKA 3MP8A 4B9XA 2VYTA 4ZTFA 3OYJA 2R5AA 4OVAA 2JZ2A 5KE3A 3OYAA 1OZ3A 2IG0A 2L89A 1WJQA 2X35A 2GF7A 3QIIA 4A4EA 4BE2A 2RHXA 3UT1A 2RHIA 4CRIA 3PNWC 3QBYA 3OYEA 2E5QA 3F70A 3LGLA 3MEAA 4EDUA 4FL6A 5D6YA 2X4WA 3L2UA 4BDYA 2B8AA 4Z02A 4ZTJA 3OYBA 4N4HA 2LTOA 2GFAA 3H8ZA 2BIVA 3OS0A 3LLRA 4E7JA 4PL6A 1MHNA 4E7KA 4BDZA 2LDMA
chains in the Genus database with same CATH superfamily
1F1BB 1WGSA 1K9MR 1ACMB 1QVFP 3SB2A 4OMPA 5B6CA 4LUDA 1VQ9A 1ZHIA 2YRCA 5LJ3e 1YCYA 1M3CA 3X26B 2K6DA 3CCMT 1M1KR 2B86A 4F7UF 4L5GA 1K4US 4N4GA 2E4HA 3L1AA 2XHCA 1YWPA 1CSKA 3I56T 4C8QC 1R0BG 3E1SA 2M16A 1HJDA 2L3RA 2O4XB 1VQOA 1TUGB 5FROA 4C8QB 3JCMW 3S3OA 3GF5A 3TU4K 3HTRA 2P4TA 1M2VB 3CBOA 4A4GA 1S72Q 2L3PA 4PJOG 5GJVB 3CC2A 1PCXA 4DEYA 5GAOq 4UC4A 2XK0A 1JQQA 1AWXA 2CZ1B 2OTLQ 4LDUA 3VS6A 1SSHA 4XTZA 5M9OA 2CKKA 3ME9A 2DJQA 3FPTA 1VQ7A 1I9GA 2P0PA 2W0ZA 4ORZA 1PRLC 3GOXA 3FJ5A 4P5NA 3CCJQ 1YJNT 2WSCE 4JLGA 1ZSZC 2DKGA 3VV0A 2RM4A 4RTVA 1KC8U 2DL5A 3EG0A 2YUQA 5IN1A 2MI6A 3GP8A 2FRYA 4E7ZA 3ULRB 2DZ9A 3OYKA 2YUPA 4JDSA 1C0MA 2DILA 1K9MU 1YJ9Q 2MK5A 2DTOA 2O2OA 5GANd 2IG0A 1VYVA 4MMLA 2XG8D 4J9BA 4C92E 1AT1B 3UT1A 1KG1A 4PK4A 1VQKA 2HL5C 3MHXA 4OP0A 1OU8A 3M0SA 2DYIA 5KYUA 2J05A 1Y71A 4J9HA 2BIVA 1M1KU 2A3LA 2KT8A 1M30A 1MGQA 1K73C 3QO3A 3SFMA 3VKIA 1M1FA 1W6XA 3G6ET 3JB9H 3OYNA 4PJMA 1Q86U 1VQLT 1KHCA 2EQKA 1WLPB 2QQAA 1LNXA 1X6OA 2O88A 2CREA 3L2ZA 4LDXA 4FW2A 1OPKA 1BU1A 1YHQQ 2RA2A 1PSFA 2EQIA 5FWCA 2IVWA 2BUDA 1PNJA 3X28B 2CZ7B 4C0DB 1R77A 4E6RA 1VQPQ 2VWFA 1N8RR 1AD5A 3S6WA 1X6BA 4CC2A 1V29B 4RCCA 1VQOT 1VIFA 5A0DA 5EPPA 5AYFA 3CCQA 2CS7A 4MZTA 3DLLA 2ZPFB 2D9TA 3HFOA 4X9DA 1GFDA 3CCLT 2KEAA 4DOVA 3DLMA 2KK4A 1NPPA 4IURA 4BI4A 2EYYA 4ZN1A 1OI1A 3CCUQ 2YUOA 4AMCA 4Z8AA 4L59A 3V8JA 2L3QA 2EVRA 4NL2A 4FM4B 1GRIA 4KDIA 5EC7A 5LJ5d 3RESA 4RTYA 1Y0MA 1HK9A 2PNIA 3CC7Q 1W70A 4D8KA 2KE9A 3PFSA 4QQDA 4EMHA 4RCBA 1MMNA 4LUEA 2G6FX 1VQ4T 3V8LA 4PJOD 1BKBA 1VYTA 1TUCA 3NFCA 3QDFA 1KQSA 5LL6S 3QBYA 4IIOA 3HSBA 2DA9A 4BDYA 5GMKj 3BFMA 4O5VA 2LDMA 3CCVQ 5KYUB 1X01A 2KDSA 3M0UA 3JCMQ 1Q82R 4QW2A 3Q1JA 5DM7R 4CC3A 2DF6A 3TIWA 3JV3A 1OV3A 3CCJA 3KXTA 2F1LA 5CKFA 1N8RU 3FRNA 1T0JA 4KDLA 1QWFA 5GAMh 2DYBA 3X25B 5C1BA 4KH1B 3JCMb 1RAEB 1AEYA 3NMZC 2ZPEB 4KUDK 1K0SA 5LJ3f 2DBKA 1OULA 1WQ7A 1WHGA 2FZCB 2XMFA 3CBMA 4PNOA 4PJNA 1YJ9A 5FWBA 3THKA 1M90C 5KCHA 2RN8A 1M27C 2QTVA 1SHGA 1K9AA 3META 2XIDA 1IZ6A 2BZ8A 3V7CA 1D1BA 1CKAA 1OEBA 2M9UA 3QKJA 3CCST 4QVDA 2FVUA 3FPUA 5DLOA 2JM8A 3MP6A 5GMKe 4GY5A 2QA4A 4C5GA 3LHDA 5FTJA 4CC7A 2FHDA 4AFUC 3VS0A 1UB4A 1YHQA 4A54A 2OI3A 1KC8C 4ARIA 3CMAQ 2FPEA 3FPRA 5GANj 4OMNA 2DXCA 1E7OA 2Y90A 2MIOA 3VS4A 1MMAA 2EKOA 2YRDA 4HXJA 1UGSB 1WHJA 1VQPA 1PD1A 1GCQA 2NUTA 5KCOA 1RAIB 4B9XA 3ZGZA 3VYHB 3VS7A 4PFOA 1K9MC 3CCMQ 2JZ2A 2NUPA 1D0ZA 2L89A 4A4KA 4JPBW 1B34A 4FT2A 3I5RA 4C92F 4JZ4A 4ZTJA 3I56Q 4OGCA 3H8ZA 1M1KC 3LLRA 1R0CB 3OW2P 4ESRA 3ZEHA 4DBQA 1ZA2B 3H41A 1WX6A 4BE0A 4PJLA 4C92G 1MNDA 3CCUA 1QDNA 3EH1A 2CDTA 5FRNA 4J6WA 3RUXA 4HVVA 4ME7A 5FLXE 1NE8A 2ZPIB 3RDVA 2K2VA 2RQRA 2LT4A 4LXCA 4X34A 2DERA 3CCJT 3GIBA 1N9SA 1GXIE 5AT1B 3X20B 3EG3A 2EQMA 4M77E 4ZN3A 2JN0A 2K2MA 2J7IA 5GANe 1NYFA 2OAUA 3FLGA 4EMKA 1QVGP 4M78E 1RLQC 2RQWA 1Q7YR 3OY9A 1YJNQ 3EGXA 3VUZA 1HD3A 3J81E 2WACA 1QCFA 1HYOA 1SSFA 3NPFA 3EG2A 3M0PA 3EHQA 7AT1B 2X3WD 2MOXA 1SRLA 3CCVA 3NTKA 5LJ5j 3MB5A 4JJCA 2GGRA 1NJIR 1SF9A 1WJRA 2KQWA 2LCCA 2RMOA 1RI0A 1G8XA 1I1JA 1W1FA 2DEQA 2QA4T 2ZZDA 4M7AG 3LWHA 1AZGB 1VOMA 5CR2A 4JJDA 2K7AA 2DO3A 5FU7C 1CKBA 3PMTA 1RAAB 2R5MA 4BY6C 1GCQC 2D0QB 3LGAA 3GPLA 3TEEA 1ZLMA 2KRSA 2Q1DX 2VXEA 2XDPA 1JBMA 4E7LA 1VQLQ 2GBQA 3CQTA 4ZGDB 4BY6B 3A98A 4F04B 2NUTB 1PHTA 1I5LA 3R6OA 2P0QA 2JJ9A 4CRIA 1QCOA 2NUPB 3H0HA 2X4WA 1B34B 2V1QA 3AT1B 5HCKA 1UG1A 3X24B 4C8QE 3URGA 2GFAA 4Y92A 2HEQA 1UJYA 3VS5A 1KQ1A 3OB9A 2FZKB 1FMVA 2CSQA 5HK0A 2KMTA 4F14A 4DOWA 2KRMA 3S3NA 2D6FA 1XJWB 2W10A 1VQOQ 1U3OA 5LJ5e 2J6OA 1NBEB 2KSSA 3JCMd 1XTDA 1N8RC 4FIBA 4GLKA 1Q7YU 1Y57A 3CCLQ 1RAHB 1UGRB 1QCNA 4JUVA 4JLIA 3CCET 4M75G 2KROA 3D7SB 4D8DA 1JO8A 4FYVB 4EMKC 4RG2A 1W2BS 2BZXA 5DYIA 3I35A 3MJXA 3M55A 3CCMA 3PIPA 4EMKB 1TH7A 3M9QA 5GAN6 3IQLA 4PJOA 2PUKB 3LW5E 4C92D 4QVCA 4AFZC 5GAOl 3I56A 4RTTA 1JXMA 1PD0A 2PU9B 1S1NA 1VQ4Q 2K4YA 2KRNA 1RACB 2LNHB 4X1VA 5KYYA 2K9GA 2ZAEA 5CCBA 1KFZA 3EFSA 1LPLA 3O5ZA 4HVUA 4R55A 1FMWA 1WFWA 2RF0A 3OYJA 4BB7A 3M4GA 2EPDA 1YJNA 4V2SA 4XTYA 1UTIA 1Q81R 3UPUA 2CP6A 3BY7A 2EYXA 2RHXA 3VS1A 3QUIA 1IREB 1NYGA 2BE7D 5LJ5g 4KGXB 5FW9A 3ZJUA 2A7YA 2PVOB 2R58A 1JRIA 2FEIA 2K57A 1VQNT 3M54A 4GBQA 4JRIA 2YUNA 4A53A 3BE3A 2K3BA 3OYFA 1RUWA 3CCRQ 3G71A 4PFZA 3JRZA 1XOVA 1GBRA 3EG9A 2EQUA 1H3HA 1OX8A 2AHJB 3CCSQ 2X4XA 2DEUA 1D0XA 1XQHA 2PVGB 3A1PA 2JW4A 2VB6A 4M77F 1VQLA 1KJWA 3LYIA 4CC4B 2EJFA 5GAOr 2DNUA 4M78F 1GCPA 2YDLA 4PJOC 1ZC1A 2KGTA 4OMFB 1ABQA 2CT4A 3J7AF 4M77G 1Y96A 3SWNA 1IGUA 4B9WA 4PJOB 1YFNA 2MPXC 4II1A 3MKDA 4RKUE 1BK2A 4XK8E 3PTAA 1QP2A 4DBRA 4F7UG 2FPFA 2LJ0A 4IUVA 4M75D 4RG8A 4ZGJB 1M90U 5D6XA 2B25A 3CCLA 2F5KA 1YIJT 1OOTA 2DETA 1I4K1 5KYYB 1UGQB 5GAN4 2RI5A 2DXUA 3DB4A 3UWNA 2HCKA 3QDRB 4J9GA 3JCMV 4LE9A 2RQTA 3CPWA 4ZTFA 3CPWS 2Y4XA 1UGVA 2LJ1A 3HHTB 4JJNK 5IXBA 3OYEA 4OB1B 3MEAA 2ROLA 4OB2B 2CGHA 4C8QF 1EZZB 5CKEA 4M7DC 2FO0A 3A8OB 1T0HA 2F2XA 1VQ4A 3OMGA 1ZUYA 3G4SA 2GCXA 4XU0A 2A0FB 2ZCFB 4HKEA 3QHSA 1C6VX 3PGGA 4M7DB 4J6YA 1PM3A 3M5AA 3G71T 1M4ZA 2OJ2A 4HCKA 1Q7YC 1IHVA 3CC4T 3EG9B 2JMAA 4KT0E 5KYWA 1QKXA 5LJ3g 2EJ9A 2CT3A 2FL7A 3OA6A 5I22A 5LJ5f 3OW2S 2DL4A 5C18A 4C0FA 2FYKA 2LVMA 2QXFA 2XD0A 3EAEA 1BI1A 2JT4A 1WHKA 4HVWA 2QA4Q 2C0IA 1OX9A 5FU6C 3ZBDA 5CVIA 1KQSP 3SWNC 2ENMA 5KH6A 2L8DA 2L0AA 4C0DC 4JRKA 2LZ6B 2RPNA 2LQKA 2KXDA 1D09B 1Y96B 5FU6B 2A28A 1RAGB 3SWNB 2FRWA 1PC0A 3FEOA 2MM0A 1M5Q1 3QWXX 4KLNA 4XTWA 5IT9E 1T3SA 1G3TA 2ABLA 3PMIA 2P0KA 2QQ9A 3JCMe 2CP3A 3CCRA 5GMKl 3RNJA 2QQSA 1OZ2A 2XU8A 3MPUB 1TOVA 1UE9A 2QG9B 3PE0A 3FC3A 3M0TA 3CCSA 3E9FA 1M2OA 3INZA 3M58A 2F5TX 3OS2A 4NS5A 4M77D 1IRXA 1N5ZA 3M56A 3MP8A 1CZ4A 1BCOA 3HRTA 4M78D 4XU2A 4A4EA 2EGCA 3UF4A 2RB6A 4JJBA 3CXCA 3ER0A 3CXCS 3CCEQ 2BE9B 4C92A 2HBWA 1I07A 2HL3A 3PVQA 5FRMA 5IHKA 3DB3A 4A4HA 4LNPA 2RJCA 2QGFB 3SHWA 1N6AA 3REBB 2MAMA 4KGVB 2E12A 3OYMA 2CSIA 1MMDA 4KUIA 3G4ST 1YI2T 5CIUA 2C06A 4HT9A 5FTMA 5CD1A 4LDVA 4ZGEB 4NOYA 2PQWA 3UA6A 2JTMA 2Q1AX 2RJDA 3QPHA 3MEUA 5KYWB 2YXYA 1T3LA 2QTXA 4Y91A 3PIOA 3QZ5B 4LN2A 2X4YA 2JOYA 2V26A 2YRVA 4KBMB 3JCMg 2QDLA 5GAMd 2KXCA 2HQEA 1IB8A 2M1HA 4C8QD 2QGGA 2COWA 3UATA 1VA7A 4FT4A 1M1GA 2DL8A 5DY9A 3A8MB 5KYXA 1X2QA 4M7AA 1E6HA 1VQ5T 5GLFA 1I81A 2XDDA 2HNIA 2O9SA 2D8JA 1KD1R 4L6V5 1JJ2A 3WVEB 3CCRT 1JJ2S 3FB9A 3C94A 5GAN3 1G83A 2J06A 3UDCA 2E6NA 4RTWA 1LJOA 1Q81C 3L2RA 2SRCA 3A8GB 1VQNQ 4N4IA 2EWNA 1FYNA 1UEBA 4HCCA 3A8HB 1H3ZA 4A4FA 3CMET 2YWWA 1PKSA 3EGUA 4TVRA 4WCIA 3OYAA 4LD9K 2EAYA 1X43A 3QIIA 3QXEB 1YITA 3LGLA 1WXUA 3UA7A 4FCYA 3CF2A 1U06A 2GTOA 3OS0A 1YCSB 4E7KA 4YTLA 3JCMP 4OGEA 4C92B 4IKFA 1QQJA 2DRMA 2XDBA 2HD0A 5A0LA 2JM9A 1LVKA 2JUFA 3P8DA 2BKDN 2FPDA 1Q82U 3BDLA 4M75A 5GMKi 4XTVA 2RHYA 1OPLA 1AHJB 2H3EB 1O75A 4J9CA 3HU3A 1PSEA 1E32A 2OX7A 2KR3A 3LX7A 3V8KA 3OYYA 1KQ2A 1G3WA 2L2PA 3P8HA 2G3RA 2VXFA 3C95A 2CZ0B 1D0YA 5IH2A 4MZPA 4BI8B 1X6GA 1YP5A 1VQ8T 4IIMA 1KHIA 5LJ3h 4X9CA 4RTXA 2RQVA 2BTTA 1YIJQ 2RNAA 3CCEA 2LX7A 2DTIA 2JMCA 2PTKA 1BCMA 3PT9A 3TQ7P 3M59A 2ATCB 3HPWA 2L5QA 4M7AC 2O9VA 5I21A 3QZ9B 5KYXB 4M7AB 2DVJA 4OF1A 2LQ8A 1I5OB 1HSQA 5IAYA 3VU3C 5CQYA 4FYYB 3S3MA 1SPKA 3M57A 1UGPB 3JCMf 5EG2A 2E65A 3LGFA 5CCAA 1OQKA 4VUBA 3RMQA 1X69A 1WXBA 3JCMX 3EH2A 2R5AA 2HAXA 4KULA 1A0NB 3E19A 1H8KA 2AZSA 4ANJA 1WJQA 4OMOA 2GF7A 3G71Q 4BE2A 4RTUA 1I8FA 4MDXA 3CC4Q 4ARCA 3EFRA 1YITT 2I2LA 2RK1A 1WDXA 2RD1A 3TREA 3SEMA 2JNGA 4PL6A 1QVPA 1ARKA 4AG1C 2LCLA 4PJOE 4QKUA 2K3YA 3V7SA 2RI2A 4M75C 6AT1B 2HBPA 1VQ6Q 1TSFA 5KE2A 3I5SA 1EFNA 2D1XA 2RI3A 2RH2A 4M75B 1VQNA 3HRSA 2ZGWA 2F2VA 4JRQA 4OMQA 1FMKA 2COZA 1EX4A 4CI0C 5GAMj 2COYA 2EYZA 2BZYA 2PUOB 2GFUA 3U23A 2C0TA 1IO6A 2JTFA 2E41A 2RHZA 1ABOA 2DK3A 1M9SA 4K11A 2J6FA 1WJSA 2DIQA 1VQMA 5GANg 1UDLA 3OS1A 2PWYA 4PFPA 2DL7A 4J6XA 3OYCA 1WHHA 4F7UA 1YJWT 1W2BA 3JSCA 3LH5A 1YWOA 3HFNA 3VRZA 1ZA1B 3A8LB 4LDYA 2V8JA 1QVGS 1SG5A 1P92A 4PLLA 1Y07A 4A63B 4EPCA 1NJIU 2F2WA 3BDUA 1R7RA 2JXBA 3OYLA 3EG1A 1JXOA 3RIRA 2LRQA 1RL2A 3HP9A 4E47A 3EGXB 5CKBA 3RMSA 2Q19X 3O8VA 1WYXA 1NLPC 4ZNXA 4RMOA 3H0IA 4QVZA 4M7DE 1MNEA 3HRUA 4FSSA 2Q18X 2KNBB 3KBGA 1O54A 5C6SA 1BI0A 2CZ6B 2MM2A 4OVAA 3G4SQ 2E6ZA 5KE3A 1YI2Q 5GAMe 1YIJA 2CUDA 2K5LA 3QG1A 1YNZA 1M8MA 3L2UA 2DRKA 3OYBA 4N4HA 1TG0A 2QQRA 1YBYA 2QEXA 3TSWA 4BD3A 3BW1A 3QYHB 4ATOA 3MO8A 3HU1A 1Q82C 3VS3A 1RABB 1IXDA 5FTNA 2QYZA 3RKYA 4E7HA 1RLPC 2VVKA 4J9EA 4FW1A 5ECAA 3CPWP 1VQ5Q 2D8HA 3C0CA 2VKNA 2AZVA 1C1AA 4IUTA 2DFUA 4PLIA 2PZ1A 3OBWA 4QQ6A 2MCNA 2AT1B 4J9FA 3CC4A 2QDYB 1Q95G 2JS2A 2OTJA 1ZSZA 2E5KA 1UUEA 2KYMA 1AOJA 1VQMT 2I0NA 1VUBA 1WXTA 1NG2A 3V7RA 3CMEQ 4F7UB 3OMCA 3TCJA 1OU9A 4J7FA 1VQ6A 1NLOC 4XTUA 3ASKA 4OB0B 1KC8R 5CAIA 5GAN8 2HQHA 5D7UA 3LWIA 1PRMC 4DBHA 2P4RA 3VUBA 4FYXB 4IUPA 5GANf 2DXBA 2HQXA 5A2QE 4M78G 2NLUA 5GAMg 2GQVA 3OS5A 3FDRA 4R56A 3J80E 3MEVA 1BI2A 1W4SA 5KYNA 5GMKh 1PWTA 4BI3A 3QQ7A 3JB9I 2A36A 1QWEA 3F70A 2YLBA 1B7TA 4FL6A 5GJWB 1G3SA 1Q81U 3E2UA 1AWJA 4E7JA 1QMCA 1Q86R 3CD6T 2K79A 3DKMA 3AHUA 1WLFA 3H9NA 2OAWA 4Y28E 2ROTA 2YUJA 4RTZA 4PJOF 3VS2A 5GAOn 1VQ8Q 4B6MA 5GAN2 2QEXT 3NGPA 1GL5A 3QJYA 2KI7A 2YVLA 1KIKA 4AT1B 4LD6A 1FX7A 4AQ7A 2PJHB 1K8AR 3CEYA 1IGQA 4QQGA 2Z0WA 8AT1B 4AS1A 5J3BA 3TVTA 1M8VA 3TSZA 2FZGB 1YI2A 4F17A 5D6WA 1YN8A 4C8QG 4FYWB 2MF2A 2KT1A 2M0OA 3CXCP 2ECZA 2WSFE 2CUBA 4WTOB 2DJZA 2OTJT 3RKWA 1U1SA 3OW2A 1ZSZB 2XKOC 1QVFA 3I55A 1QVFS 2DXTA 2DE0X 2K3XA 2K5IA 5GANh 5GAN5 9ATCB 3OQ5A 1NJIC 4C5IA 1VQ6T 1WPYA 2ZPGB 1YITQ 3RR6A 1ZBXA 2CP5A 2A08A 1N27A 4MMKA 1WHLA 2P84A 4R0KA 4O6JA 4M7DF 3ZJTA 2VASA 1MV0B 1ZBJA 1VQ5A 4HT8A 2CP7A 1E6GA 1BB9A 4EMGA 1AVZC 1R8OB 1FXXA 1VQ9T 4M7DG 1K1ZA 5HK3A 3GLXA 1WA7A 4EDUA 5L23A 2V1RA 1SEMA 3RBBB 5CCXA 2GTJA 4Z02A 2NYSA 4JZ3A 2JVVA 2RJEA 3VYGA 3CMEA 3L42A 4JRPA 3QWYA 5IHNA 1G5VA 2ED1A 3QYGB 1GBQA 3C12A 5GAMf 2RO0A 1K8AU 1QCSA 3OYDA 2HMAA 2NUZA 2X3XD 2DTHA 1RAFB 1JJ2P 3CPFA 5A0GA 2CP2A 1IHWA 2HDAA 2AKLA 1V1CA 1V76A 4M7AE 4J8OA 1YJWQ 1UHFA 4XQ3A 3JCMJ 3CC2T 2CP0A 4HA8A 1UJ0A 2E64A 2KAFA 1VQ7T 2GNCA 5LJ5h 4IUQA 2DX1A 2LCSA 1TUDA 1U5SA 4MZMA 3G6EA 4Z89A 2EFIA 2LMJA 2J6KA 2E3HA 4XTXA 2EBPA 1VQ8A 3JAME 2KBTA 1PG5B 4E7IA 2LT1A 2LJ3A 3ZL7C 3M0QA 4QT7A 3I55T 2H3JA 4KRTA 2DAQA 1EIFA 2DBMA 4KH0B 2LC4A 1KQSS 2EW3A 1AZEA 1QKWA 5ERGB 1S72A 4BE1A 4J7IA 3VJPA 3OBYA 1VQKT 3FJPA 1U8RA 3SDZA 3L2VA 4RV0A 2EKHA 1LOJA 5J26A 8ATCB 2OTLA 2X51A 5CQXA 2X4JA 2NWMA 1BYMA 4M75E 1ZUUA 2VC8A 2E3IA 2CH4W 1UHCA 4MDWA 1HXDA 2LX9A 2X35A 1GFCA 1MMGA 1ZX6A 1J3TA 2RHIA 2ZPHB 1BIAA 3N5BB 5D6YA 4XU1A 1O9SA 1K0XA 4Z88A 3OSSC 4XU3A 3M4YA 2E1HA 4J9DA 4PKCC 1BIBA 2DL3A 2HSEB 5FTKA 2Q1CX 3C4SA 1XNIA 1NEGA 1D3BA 5DYGA 4IUUA 4C92C 3CCQT 1UFFA 4AFSC 3OYHA 1VQMQ 2IIMA 2JV2A 2D0NA 4JS4A 1G3YA 1NM7A 2KY9A 2GQIA 4M7DD 2H8HA 5GAOm 1U1TA 2EQJA 3T9NA 4EIKA 2HKQB 2F69A 4E2FB 4C0GA 4BACA 3I9QA 2RHUA 1CZ5A 1ZQ1A 2AKKA 4Q5WA 3H6ZA 2C0OA 4KGZB 5J39A 1X27A 4ELYC 3OYIA 2EIFA 1MUZA 1TU0B 2QK0A 5L8RE 3QQ8A 1WQWA 2DZCA 2VGMA 3E9GA 1TTHB 4DQ2A 1WI7A 3PVLA 2PVDB 1SHFA 1M3AA 5LJ3d 3QC8A 3EGDA 2KVQG 3GBQA 4C5HA 2A37A 1KD1U 4M4ZA 1NPRA 1YJWA 3CD6Q 2LQNA 4C0ZA 1TS9A 1S72T 3QWZA 2M0YA 2MYSA 4C5EA 1JEGA 3EFOA 2QQBA 2QEXQ 2OTLT 3ZFJA 2VYTA 1Q86C 1SRMA 1JU5C 4KODA 4OMLA 1X75C 4DBFA 3JB9F 1WIEA 1CR5A 5GAOp 4J83A 3R6NA 3CC7A 3RERA 2B8AA 2QASA 1QW1A 2LTOA 2YLCA 1SKUB 4RUGA 3JB9G 2Y4YA 1W2BP 1NZ9A 1PKTA 1K8AC 2IPOB 2L3SA 3EHRA 2VGNA 4F16A 3OYGA 1DJ7B 3OSVA 2JTEA 5HKCA 2DD4A 1OYXA 1WZOA 1YJ9T 3H0FA 5DLQE 3REAB 3GNGA 1BBZA 4F7UE 2LNVA 2EYQA 2O31A 1K73R 3L2QA 1D3BB 2E10A 4M7AF 2OTJQ 1B3QA 2MWPA 3SD4A 2WSEE 2KYBA 4JS5A 2LP5A 1H641 3FIFA 1K76A 2ESWA 3KFVA 2E70A 1VYUA 4HCZA 2HZYA 3VRYA 1ZUKA 4FU6A 1I0CA 2AIRB 2M02A 2XI9A 1YHQT 2CYZB 3P8BB 4GLMA 3G6EQ 2RK2A 2DD5A 4N0AA 3MEWA 3QSUA 5FU7B 1B07A 3ZJVA 1VQPT 2V8IA 1VQ9Q 4M77A 4HCBA 3RKXA 2HKNA 3MP1A 3L2WA 2AK5A 1D1AA 5IXFA 5GAN7 1M3BA 2X9HA 4M78A 1LCKA 3A5ZB 3M53A 1RADB 2DVEA 4DEXA 3EGDB 3HU2A 2JS0A 2RQUA 2O01E 2M51A 1S3SA 3BQBA 5I2SA 4M75F 4LDWA 1QVGA 1D1CA 1KSWA 4KO8A 3CCUT 3JCMh 3EFOB 1OZ3A 2EJGA 2YSQA 5CKHA 3PNWC 1H92A 5EQJB 2DLPA 1RI9A 3CMAA 5FTLA 1G2BA 1MHNA 2VUBA 2VV5A 4XAXB 4BDZA 3CC2Q 3CC7T 2V8KA 2EYWA 2R57A 3G1JA 1K73U 4AFQC 2DIGA 2LQWA 2YHTA 2MWOA 4ELZC 5I2MA 1VQ7Q 4NL3A 2RJFA 3KUFA 1KK7A 1AWWA 1NEBA 4OB3B 2EGAA 3G7ZA 2HSPA 2ZPBB 3CD6A 2O4XA 2EGEA 1Z9QA 3CCVT 4OMMA 1UECA 4C8QA 5HY6A 1FWZA 3I55Q 1WHMA 2DPPB 4DA4A 1M2VA 3LH0A 1TWBA 3JB9D 4J5YA 5GMKm 1VQKQ 4BUGA 1BI3A 3NTHA 4AG2C 3WVDB 4N0AC 5IHIA 3NHNA 3HKSA 5LJ3j 5CKDA 1ZSGA 1M90R 4M77C 5CO7A 5I11A 2K5FA 4FSXA 2MMPA 1N9RA 2QI2A 3JCMc 4M78C 4WF2A 2LW6A 2ED0A 2YT6A 2FG0A 4M77B 1X2KA 1Z9ZA 1VIEA 3NTIA 3MCAB 1KD1C 3QJ6A 4M78B 2QAZA 2DMOA 5CK9A 5C0MA 1AWOA 4M7AD 1WNLA 4J9IA 2FB7A 1QLYA 3WXMB 4M7DA 3GNFB 3HL8A 4E7SA 4CQNA 1QP3A 3CCQQ 2SEMA 3CBPA 4PJJA 2E5QA 1TXQA 2DM1A 4D6WA 3JB9J 2CH4A 3M0RA 1JB0E 2XICA 3CMAT 1Y7XA 1MV3A
chains in the Genus database with same CATH topology
4JRPA 3L42A 3JCMP 1WGSA 4OGEA 4C92B 5HK0A 2KMTA 4IKFA 1G5VA 3QYGB 3C12A 3SB2A 5GAMf 2RO0A 1K8AU 4DOWA 1QCSA 3OYDA 2XDBA 3UPUA 2HD0A 5A0LA 3S3NA 1VQ9A 2D6FA 1ZHIA 5B6CA 2DTHA 5LJ3e 1YCYA 2JUFA 5LJ5e 3P8DA 2BKDN 3X26B 3CCMT 1Q82U 2KSSA 3CPFA 1XTDA 3JCMd 1N8RC 4FIBA 5A0GA 3BDLA 4GLKA 4M75A 5GMKi 4XTVA 1Q7YU 2RHYA 1AHJB 4F7UF 4L5GA 1O75A 3HU3A 1UGRB 4N4GA 1PSEA 2XHCA 3L1AA 1E32A 4M7AE 4JUVA 4J8OA 4JLIA 3LX7A 4M75G 3CCET 3V8KA 3OYYA 4XQ3A 4C8QC 3I56T 3E1SA 2M16A 2L3RA 4EMKC 3JCMJ 4RG2A 1KQ2A 1G3WA 3CC2T 1W2BS 3P8HA 2O4XB 1VQOA 5DYIA 2G3RA 2VXFA 3C95A 4HA8A 5FROA 3M55A 2CZ0B 3CCMA 4MZPA 4BI8B 3PIPA 4C8QB 1VQ8T 4EMKB 1TH7A 1KHIA 2E64A 2KAFA 3M9QA 4X9CA 5LJ3h 3JCMW 5GAN6 3S3OA 5LJ5h 4IUQA 3GF5A 4PJOA 2PUKB 3TU4K 3LW5E 4C92D 2P4TA 3CBOA 4A4GA 3CCEA 4QVCA 5GAOl 3I56A 3CMAT 2DTIA 4MZMA 3PT9A 3G6EA 3M59A 4PJOG 3CC2A 2EFIA 5GAOq 3HPWA 2L5QA 4UC4A 4M7AC 2XK0A 2CZ1B 5I21A 4XTXA 4LDUA 2PU9B 4XTZA 5M9OA 2CKKA 3ME9A 1VQ8A 3JAME 3FPTA 4E7IA 1VQ7A 2LT1A 2K4YA 1I9GA 3QZ9B 2P0PA 4M7AB 3GOXA 3I55T 2H3JA 4OF1A 2LQ8A 4P5NA 2DAQA 1EIFA 5IAYA 1YJNT 3VU3C 2LC4A 1KQSS 5CQYA 2WSCE 4JLGA 2DKGA 5ERGB 3VV0A 3S3MA 1S72A 4BE1A 2RM4A 3M57A 4J7IA 3VJPA 1KC8U 3EFSA 3OBYA 5CCBA 1VQKT 1UGPB 3JCMf 3FJPA 5EG2A 1U8RA 2E65A 3SDZA 4R55A 3L2VA 4RV0A 3LGFA 1LOJA 5J26A 5IN1A 2OTLA 2MI6A 5CQXA 2X4JA 5CCAA 3GP8A 4VUBA 3RMQA 1BYMA 2DZ9A 3OYKA 4M75E 4JDSA 2VC8A 3OYJA 4BB7A 3M4GA 3JCMX 1YJNA 1K9MU 4V2SA 2R5AA 2HAXA 2DTOA 4KULA 4XTYA 5GANd 3E19A 4MDWA 1HXDA 2IG0A 2LX9A 2X35A 1WJQA 4MMLA 2GF7A 2XG8D 3BY7A 4C92E 2RHXA 1I8FA 3UT1A 2RHIA 4BE2A 3QUIA 1KG1A 2ZPHB 1VQKA 1BIAA 4MDXA 3N5BB 1IREB 5D6YA 3MHXA 4OP0A 3EFRA 4XU1A 1O9SA 1YITT 2I2LA 4ARCA 2RK1A 2RD1A 3TREA 1Y71A 2BIVA 3OSSC 2JNGA 5LJ5g 4PL6A 1M1KU 1QVPA 2A3LA 2A7YA 3ZJUA 2PVOB 2R58A 4XU3A 1JRIA 2K57A 1VQNT 1MGQA 3M54A 3QO3A 3M4YA 4JRIA 3SFMA 3VKIA 2E1HA 1K73C 4PKCC 1M1FA 4A53A 3G6ET 2LCLA 1BIBA 3JB9H 4PJOE 3OYFA 3OYNA 1VQLT 2K3YA 1Q86U 1KHCA 3V7SA 2RI2A 4M75C 5FTKA 2HBPA 2EQKA 3G71A 2Q1CX 2QQAA 3C4SA 1XNIA 1LNXA 5KE2A 3JRZA 1X6OA 1XOVA 1D3BA 5DYGA 4IUUA 2EQUA 3L2ZA 4C92C 3CCQT 4LDXA 2AHJB 2RI3A 3OYHA 2RH2A 4M75B 2RA2A 2X4XA 1PSFA 1VQNA 2JV2A 3HRSA 4JS4A 1G3YA 1XQHA 2KY9A 2IVWA 2ZGWA 3QC8A 2BUDA 2PVGB 4M77F 4JRQA 3X28B 2CZ7B 4M7DD 4C0DB 5GAOm 1VQLA 1U1TA 2EQJA 4CI0C 5GAMj 3T9NA 2F69A 3ZJVA 4C0GA 3LYIA 4BACA 2EJFA 5GAOr 4M78F 2PUOB 3S6WA 2GFUA 2RHUA 4PJOC 1CZ5A 1V29B 2E41A 2JTFA 1VIFA 1ZQ1A 2RHZA 4RCCA 5A0DA 1VQOT 2DK3A 5AYFA 1M9SA 3CCQA 5EPPA 2CS7A 4MZTA 4OMFB 3DLLA 3J7AF 4M77G 1Y96A 2ZPFB 3H6ZA 2D9TA 1WJSA 2DIQA 4Q5WA 1VQMA 3HFOA 5J39A 5GANg 3SWNA 4ELYC 3OS1A 3OYIA 4X9DA 2PWYA 4B9WA 4PJOB 3CCLT 2EIFA 4DOVA 3DLMA 4J6XA 3OYCA 4F7UA 5L8RE 1YJWT 4II1A 3QQ8A 2KK4A 1NPPA 3JSCA 1WQWA 2DZCA 4IURA 4BI4A 2VGMA 3HFNA 4RKUE 1W2BA 3E9GA 4ZN1A 1OI1A 3A8LB 4LDYA 4DQ2A 2V8JA 4XK8E 3PTAA 1QP2A 1QVGS 4F7UG 4L59A 3V8JA 2PVDB 1P92A 4IUVA 4M75D 4RG8A 4ZGJB 4NL2A 4PLLA 1Y07A 5D6XA 4EPCA 1M90U 1NJIU 4FM4B 3BDUA 1R7RA 3OYLA 4KDIA 5LJ3d 2B25A 3RIRA 2F5KA 3CCLA 2LRQA 1RL2A 3HP9A 4E47A 3RMSA 5CKBA 3RESA 5LJ5d 1YIJT 2KVQG 2Q19X 1I4K1 1HK9A 3O8VA 4C5HA 1KD1U 1NPRA 1YJWA 4C0ZA 4RMOA 1UGQB 4QVZA 4M7DE 5GAN4 1S72T 2RI5A 2DXUA 3DB4A 3HRUA 3QWZA 3PFSA 3UWNA 3QDRB 4C5EA 2Q18X 3KBGA 1O54A 5C6SA 3JCMV 4QQDA 4EMHA 4RCBA 1BI0A 2QQBA 3CPWA 2OTLT 3ZFJA 2CZ6B 2VYTA 4ZTFA 3CPWS 1Q86C 2Y4XA 2MM2A 4KODA 3HHTB 1X75C 4OVAA 1VQ4T 2E6ZA 3V8LA 5KE3A 3JB9F 1BKBA 4JJNK 4PJOD 1CR5A 5GAMe 5GAOp 1YIJA 2K5LA 3NFCA 1KQSA 4J83A 5LL6S 3QBYA 3OYEA 3QG1A 4OB1B 3MEAA 3HSBA 3L2UA 3CC7A 4BDYA 3RERA 2B8AA 3OYBA 4N4HA 2CGHA 4OB2B 1QW1A 2LTOA 4C8QF 2YLCA 5GMKj 3BFMA 5CKEA 4O5VA 2LDMA 3JB9G 4M7DC 2Y4YA 2QQRA 1YBYA 1X01A 1NZ9A 3A8OB 2KDSA 3JCMQ 2QEXA 4QW2A 1K8AC 3Q1JA 5DM7R 1VQ4A 2VGNA 3OMGA 3OYGA 1DJ7B 3G4SA 2GCXA 3OSVA 4XU0A 4BD3A 3BW1A 3QYHB 2ZCFB 4HKEA 5HKCA 4ATOA 3TIWA 3QHSA 2DD4A 3MO8A 1OYXA 3CCJA 3KXTA 3PGGA 4M7DB 1YJ9T 5CKFA 1Q82C 3HU1A 1N8RU 5DLQE 3GNGA 4J6YA 3FRNA 3M5AA 4KDLA 3G71T 1M4ZA 4F7UE 5GAMh 1Q7YC 5FTNA 2LNVA 2EYQA 3RKYA 3X25B 4E7HA 3L2QA 5C1BA 1D3BB 3CC4T 2E10A 3JCMb 4KT0E 4M7AF 5LJ3g 2ZPEB 2EJ9A 2FL7A 2MWPA 3OA6A 4KUDK 5LJ3f 3SD4A 5LJ5f 3OW2S 5C18A 2WSEE 4C0FA 1WQ7A 2FYKA 4JS5A 2LVMA 3CBMA 1H641 2QXFA 4PNOA 2XD0A 3EAEA 1BI1A 1YJ9A 3FIFA 1M90C 2E70A 5KCHA 4HCZA 4IUTA 4PLIA 5FU6C 3ZBDA 3META 5CVIA 3OBWA 3SWNC 4FU6A 5KH6A 4QQ6A 2L8DA 3CC4A 2XIDA 1IZ6A 4C0DC 2QDYB 4JRKA 3V7CA 2XI9A 2OTJA 2LQKA 1Y96B 2M9UA 3QKJA 3CCST 4QVDA 1YHQT 5FU6B 1VQMT 2CYZB 3P8BB 3SWNB 1VUBA 3FEOA 3V7RA 1M5Q1 2RK2A 2DD5A 2FVUA 2MM0A 3FPUA 4N0AA 4XTWA 5DLOA 3MEWA 5IT9E 4KLNA 3MP6A 5GMKe 3QSUA 1G3TA 5FU7B 4GY5A 3PMIA 2P0KA 2QQ9A 4C5GA 3OMCA 4F7UB 3JCMe 2QA4A 3TCJA 1VQPT 3CCRA 3LHDA 2V8IA 5FTJA 4J7FA 1VQ6A 5GMKl 4M77A 4XTUA 4HCBA 2QQSA 1OZ2A 3OB9A 3RKXA 3ASKA 2FHDA 2XU8A 4OB0B 3MP1A 5CAIA 3L2WA 1UB4A 5GAN7 3FC3A 5GAN8 4M78A 3CCSA 3LWIA 1YHQA 3A5ZB 3E9FA 3M53A 3VUBA 4A54A 3INZA 1KC8C 4ARIA 2DVEA 3FPRA 5GANj 4IUPA 5GANf 2DXBA 2DXCA 2HQXA 2Y90A 3M58A 2F5TX 5A2QE 4M78G 2EKOA 2NLUA 3OS2A 5GAMg 3HU2A 1UGSB 2GQVA 1VQPA 4NS5A 1VQ7T 4M77D 3OS5A 2O01E 3FDRA 4R56A 3M56A 3J80E 3MEVA 1BI2A 5KCOA 1W4SA 3MP8A 4B9XA 1S3SA 5I2SA 4M75F 3VYHB 1CZ4A 4LDWA 3ZGZA 1QVGA 1K9MC 5GMKh 4KO8A 3HRTA 4M78D 2JZ2A 3JCMh 4BI3A 3CCUT 3CMEA 1OZ3A 4XU2A 2EJGA 2L89A 4A4EA 4A4KA 3QQ7A 3JB9I 1B34A 4FT2A 5CKHA 4C92F 3PNWC 2RB6A 3F70A 2YLBA 5EQJB 4FL6A 3CMAA 3CXCA 1G3SA 3ER0A 3CXCS 5FTLA 4ZTJA 4OGCA 4C92A 1Q81U 3H8ZA 1M1KC 3LLRA 4E7JA 1MHNA 2VUBA 2VV5A 4XAXB 4BDZA 3CC7T 3ZEHA 2V8KA 3CD6T 2R57A 5FRMA 3DKMA 3BQBA 3DB3A 3AHUA 4A4HA 1K73U 1WLFA 4BE0A 4C92G 2DIGA 4Y28E 3CCUA 1QDNA 2YUJA 2RJCA 2YHTA 4PJOF 5GAOn 2MWOA 5FRNA 5GAN2 1N6AA 4J6WA 3RUXA 2QEXT 4ME7A 5I2MA 5FLXE 4ELZC 4NL3A 2MAMA 2RJFA 3KUFA 1NE8A 2ZPIB 2E12A 3OYMA 3QJYA 4KUIA 2YVLA 3G4ST 1YI2T 2K2VA 5CIUA 2C06A 4HT9A 2LT4A 4OB3B 4X34A 5FTMA 3CCJT 3G7ZA 4LD6A 1N9SA 3GIBA 1FX7A 4AQ7A 1GXIE 5CD1A 2PJHB 2ZPBB 4LDVA 3CD6A 4ZGEB 4NOYA 2PQWA 2JTMA 2O4XA 3X20B 2Q1AX 2EQMA 2RJDA 3CEYA 2JN0A 3QPHA 4M77E 4ZN3A 3MEUA 4QQGA 3CCVT 5GANe 4AS1A 5J3BA 2OAUA 4C8QA 2QTXA 1M8VA 5HY6A 1FWZA 4Y91A 3FLGA 4EMKA 4M78E 3PIOA 3QZ5B 1YI2A 3OY9A 2DPPB 5D6WA 2X4YA 3VUZA 4DA4A 3LH0A 3JB9D 4C8QG 2WACA 3J81E 2MF2A 1SSFA 2M0OA 2JOYA 4J5YA 2YRVA 4KBMB 5GMKm 2WSFE 3JCMg 4BUGA 5GAMd 1BI3A 3NTHA 3WVDB 4N0AC 2HQEA 3CCVA 2DJZA 2M1HA 3HKSA 4C8QD 5LJ3j 3RKWA 1U1SA 3NTKA 3OW2A 2OTJT 4FT4A 1M1GA 5CKDA 2XKOC 5LJ5j 4M77C 5CO7A 3MB5A 1QVFA 5DY9A 3I55A 3A8MB 1QVFS 4M7AA 1WJRA 2K5FA 2MMPA 2DXTA 2K3XA 2K5IA 2KQWA 4FSXA 2LCCA 1VQ5T 1RI0A 5GANh 5GAN5 1N9RA 1I81A 2QI2A 3JCMc 5GLFA 4M78C 3OQ5A 2DEQA 4WF2A 2XDDA 2HNIA 2QA4T 1JJ2A 4L6V5 2ZZDA 1NJIC 2LW6A 4M7AG 3WVEB 3LWHA 3CCRT 4M77B 1JJ2S 4C5IA 3FB9A 3C94A 5GAN3 1WPYA 1VQ6T 5CR2A 2ZPGB 3UDCA 1H3ZA 2E6NA 1ZBXA 1VIEA 3NTIA 2DO3A 1N27A 1LJOA 5FU7C 3MCAB 3PMTA 3QJ6A 4M78B 3L2RA 4MMKA 2R5MA 1Q81C 4BY6C 5CK9A 1KD1C 3A8GB 4N4IA 2D0QB 4O6JA 5C0MA 4M7DF 4M7AD 3LGAA 2EWNA 3GPLA 1WNLA 3TEEA 3ZJTA 1UEBA 2Q1DX 2VXEA 3A8HB 1VQ5A 2XDPA 1JBMA 4A4FA 2FB7A 3CMET 4HCCA 4E7LA 3WXMB 4HT8A 4M7DA 3GNFB 4ZGDB 4BY6B 3HL8A 4EMGA 1R8OB 4TVRA 1FXXA 3OYAA 1VQ9T 4LD9K 1I5LA 4CQNA 3R6OA 2EAYA 2P0QA 3QIIA 3QXEB 1QP3A 1YITA 4M7DG 4CRIA 3CBPA 5HK3A 3GLXA 2E5QA 3LGLA 4EDUA 2X4WA 5CCXA 4D6WA 3JB9J 1B34B 4Z02A 1ZC1A 3CF2A 3X24B 4C8QE 3URGA 2GFAA 3OS0A 2JVVA 1JB0E 2XICA 4E7KA 1KQ1A 1Y7XA 4YTLA 2RJEA 3VYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R58 A;  3L42 A;  3ZEH A;  1WGS A;  2R57 A;  5FRM A;  3DB3 A;  2QQR A;  4A4H A;  4IKF A;  1G5V A;  4BE0 A;  2RO0 A;  4QW2 A;  2DIG A;  3Q1J A;  3OYD A;  3OMG A;  3OYG A;  3S3N A;  3OYF A;  2RJC A;  3OYN A;  2MWO A;  5FRN A;  2K3Y A;  4BD3 A;  1KHC A;  2RI2 A;  3P8D A;  2BKD N;  2EQK A;  3MO8 A;  1OYX A;  2RJF A;  3KUF A;  3OYM A;  3C4S A;  1XNI A;  5KE2 A;  3BDL A;  5CIU A;  4IUU A;  2EQU A;  4X34 A;  2RHY A;  4LD6 A;  2RI3 A;  3OYH A;  4N4G A;  3L2Q A;  4E7H A;  2X4X A;  2PQW A;  3LX7 A;  2MWP A;  2O4X A;  3OA6 A;  2EQM A;  2BUD A;  2RJD A;  2M16 A;  3CEY A;  2L3R A;  3SD4 A;  3MEU A;  4RG2 A;  4QQG A;  3P8H A;  2EQJ A;  2O4X B;  2LVM A;  2G3R A;  5FRO A;  3EAE A;  3FLG A;  3LYI A;  4BAC A;  3S6W A;  2GFU A;  2RHU A;  3OY9 A;  2JTF A;  2RHZ A;  2RJE A;  4HCZ A;  4IUT A;  2X4Y A;  4PLI A;  5D6W A;  5KCH A;  3LH0 A;  3MET A;  2WAC A;  3M9Q A;  4FU6 A;  5KH6 A;  4QQ6 A;  3S3O A;  1SSF A;  2M0O A;  4IUQ A;  4Q5W A;  2L8D A;  3H6Z A;  2D9T A;  1WJS A;  2DIQ A;  2YRV A;  4A4G A;  5J39 A;  3OS1 A;  3OYI A;  3NTH A;  4B9W A;  3QKJ A;  2HQE A;  2EFI A;  3DLM A;  2M1H A;  4UC4 A;  3OYC A;  2XK0 A;  3FEO A;  3NTK A;  4II1 A;  4IUR A;  3MEW A;  3MP6 A;  3E9G A;  5M9O A;  2CKK A;  3ME9 A;  2P0K A;  1OI1 A;  1WJR A;  3OMC A;  3PMI A;  2K3X A;  4GY5 A;  4C5G A;  4E7I A;  2LCC A;  1RI0 A;  4L59 A;  2QQS A;  1OZ2 A;  3OB9 A;  3OQ5 A;  3ASK A;  2FHD A;  4IUV A;  4PLL A;  5D6X A;  3MP1 A;  3L2W A;  3GOX A;  2DAQ A;  5IAY A;  4C5I A;  3OYL A;  3FC3 A;  2F5K A;  2LRQ A;  2E6N A;  3S3M A;  3E9F A;  3NTI A;  4BE1 A;  3O8V A;  1N27 A;  4C5H A;  3PMT A;  3QJ6 A;  4IUP A;  3L2R A;  2HQX A;  2R5M A;  4QVZ A;  4N4I A;  5C0M A;  2EKO A;  3L2V A;  2RI5 A;  2NLU A;  3LGF A;  5J26 A;  3DB4 A;  5IN1 A;  3OS2 A;  3PFS A;  3UWN A;  4C5E A;  4NS5 A;  1H3Z A;  2XDP A;  4A4F A;  5C6S A;  3FDR A;  4QQD A;  4E7L A;  3MEV A;  5KCO A;  3OYK A;  3MP8 A;  4B9X A;  2VYT A;  4ZTF A;  3OYJ A;  2R5A A;  4OVA A;  2JZ2 A;  5KE3 A;  3OYA A;  1OZ3 A;  2IG0 A;  2L89 A;  1WJQ A;  2X35 A;  2GF7 A;  3QII A;  4A4E A;  4BE2 A;  2RHX A;  3UT1 A;  2RHI A;  4CRI A;  3PNW C;  3QBY A;  3OYE A;  2E5Q A;  3F70 A;  3LGL A;  3MEA A;  4EDU A;  4FL6 A;  5D6Y A;  2X4W A;  3L2U A;  4BDY A;  2B8A A;  4Z02 A;  4ZTJ A;  3OYB A;  4N4H A;  2LTO A;  2GFA A;  3H8Z A;  2BIV A;  3OS0 A;  3LLR A;  4E7J A;  4PL6 A;  1MHN A;  4E7K A;  4BDZ A;  2LDM A; 
#chains in the Genus database with same CATH topology
 1F1B B;  1WGS A;  1K9M R;  1ACM B;  1QVF P;  3SB2 A;  4OMP A;  5B6C A;  4LUD A;  1VQ9 A;  1ZHI A;  2YRC A;  5LJ3 e;  1YCY A;  1M3C A;  3X26 B;  2K6D A;  3CCM T;  1M1K R;  2B86 A;  4F7U F;  4L5G A;  1K4U S;  4N4G A;  2E4H A;  3L1A A;  2XHC A;  1YWP A;  1CSK A;  3I56 T;  4C8Q C;  1R0B G;  3E1S A;  2M16 A;  1HJD A;  2L3R A;  2O4X B;  1VQO A;  1TUG B;  5FRO A;  4C8Q B;  3JCM W;  3S3O A;  3GF5 A;  3TU4 K;  3HTR A;  2P4T A;  1M2V B;  3CBO A;  4A4G A;  1S72 Q;  2L3P A;  4PJO G;  5GJV B;  3CC2 A;  1PCX A;  4DEY A;  5GAO q;  4UC4 A;  2XK0 A;  1JQQ A;  1AWX A;  2CZ1 B;  2OTL Q;  4LDU A;  3VS6 A;  1SSH A;  4XTZ A;  5M9O A;  2CKK A;  3ME9 A;  2DJQ A;  3FPT A;  1VQ7 A;  1I9G A;  2P0P A;  2W0Z A;  4ORZ A;  1PRL C;  3GOX A;  3FJ5 A;  4P5N A;  3CCJ Q;  1YJN T;  2WSC E;  4JLG A;  1ZSZ C;  2DKG A;  3VV0 A;  2RM4 A;  4RTV A;  1KC8 U;  2DL5 A;  3EG0 A;  2YUQ A;  5IN1 A;  2MI6 A;  3GP8 A;  2FRY A;  4E7Z A;  3ULR B;  2DZ9 A;  3OYK A;  2YUP A;  4JDS A;  1C0M A;  2DIL A;  1K9M U;  1YJ9 Q;  2MK5 A;  2DTO A;  2O2O A;  5GAN d;  2IG0 A;  1VYV A;  4MML A;  2XG8 D;  4J9B A;  4C92 E;  1AT1 B;  3UT1 A;  1KG1 A;  4PK4 A;  1VQK A;  2HL5 C;  3MHX A;  4OP0 A;  1OU8 A;  3M0S A;  2DYI A;  5KYU A;  2J05 A;  1Y71 A;  4J9H A;  2BIV A;  1M1K U;  2A3L A;  2KT8 A;  1M30 A;  1MGQ A;  1K73 C;  3QO3 A;  3SFM A;  3VKI A;  1M1F A;  1W6X A;  3G6E T;  3JB9 H;  3OYN A;  4PJM A;  1Q86 U;  1VQL T;  1KHC A;  2EQK A;  1WLP B;  2QQA A;  1LNX A;  1X6O A;  2O88 A;  2CRE A;  3L2Z A;  4LDX A;  4FW2 A;  1OPK A;  1BU1 A;  1YHQ Q;  2RA2 A;  1PSF A;  2EQI A;  5FWC A;  2IVW A;  2BUD A;  1PNJ A;  3X28 B;  2CZ7 B;  4C0D B;  1R77 A;  4E6R A;  1VQP Q;  2VWF A;  1N8R R;  1AD5 A;  3S6W A;  1X6B A;  4CC2 A;  1V29 B;  4RCC A;  1VQO T;  1VIF A;  5A0D A;  5EPP A;  5AYF A;  3CCQ A;  2CS7 A;  4MZT A;  3DLL A;  2ZPF B;  2D9T A;  3HFO A;  4X9D A;  1GFD A;  3CCL T;  2KEA A;  4DOV A;  3DLM A;  2KK4 A;  1NPP A;  4IUR A;  4BI4 A;  2EYY A;  4ZN1 A;  1OI1 A;  3CCU Q;  2YUO A;  4AMC A;  4Z8A A;  4L59 A;  3V8J A;  2L3Q A;  2EVR A;  4NL2 A;  4FM4 B;  1GRI A;  4KDI A;  5EC7 A;  5LJ5 d;  3RES A;  4RTY A;  1Y0M A;  1HK9 A;  2PNI A;  3CC7 Q;  1W70 A;  4D8K A;  2KE9 A;  3PFS A;  4QQD A;  4EMH A;  4RCB A;  1MMN A;  4LUE A;  2G6F X;  1VQ4 T;  3V8L A;  4PJO D;  1BKB A;  1VYT A;  1TUC A;  3NFC A;  3QDF A;  1KQS A;  5LL6 S;  3QBY A;  4IIO A;  3HSB A;  2DA9 A;  4BDY A;  5GMK j;  3BFM A;  4O5V A;  2LDM A;  3CCV Q;  5KYU B;  1X01 A;  2KDS A;  3M0U A;  3JCM Q;  1Q82 R;  4QW2 A;  3Q1J A;  5DM7 R;  4CC3 A;  2DF6 A;  3TIW A;  3JV3 A;  1OV3 A;  3CCJ A;  3KXT A;  2F1L A;  5CKF A;  1N8R U;  3FRN A;  1T0J A;  4KDL A;  1QWF A;  5GAM h;  2DYB A;  3X25 B;  5C1B A;  4KH1 B;  3JCM b;  1RAE B;  1AEY A;  3NMZ C;  2ZPE B;  4KUD K;  1K0S A;  5LJ3 f;  2DBK A;  1OUL A;  1WQ7 A;  1WHG A;  2FZC B;  2XMF A;  3CBM A;  4PNO A;  4PJN A;  1YJ9 A;  5FWB A;  3THK A;  1M90 C;  5KCH A;  2RN8 A;  1M27 C;  2QTV A;  1SHG A;  1K9A A;  3MET A;  2XID A;  1IZ6 A;  2BZ8 A;  3V7C A;  1D1B A;  1CKA A;  1OEB A;  2M9U A;  3QKJ A;  3CCS T;  4QVD A;  2FVU A;  3FPU A;  5DLO A;  2JM8 A;  3MP6 A;  5GMK e;  4GY5 A;  2QA4 A;  4C5G A;  3LHD A;  5FTJ A;  4CC7 A;  2FHD A;  4AFU C;  3VS0 A;  1UB4 A;  1YHQ A;  4A54 A;  2OI3 A;  1KC8 C;  4ARI A;  3CMA Q;  2FPE A;  3FPR A;  5GAN j;  4OMN A;  2DXC A;  1E7O A;  2Y90 A;  2MIO A;  3VS4 A;  1MMA A;  2EKO A;  2YRD A;  4HXJ A;  1UGS B;  1WHJ A;  1VQP A;  1PD1 A;  1GCQ A;  2NUT A;  5KCO A;  1RAI B;  4B9X A;  3ZGZ A;  3VYH B;  3VS7 A;  4PFO A;  1K9M C;  3CCM Q;  2JZ2 A;  2NUP A;  1D0Z A;  2L89 A;  4A4K A;  4JPB W;  1B34 A;  4FT2 A;  3I5R A;  4C92 F;  4JZ4 A;  4ZTJ A;  3I56 Q;  4OGC A;  3H8Z A;  1M1K C;  3LLR A;  1R0C B;  3OW2 P;  4ESR A;  3ZEH A;  4DBQ A;  1ZA2 B;  3H41 A;  1WX6 A;  4BE0 A;  4PJL A;  4C92 G;  1MND A;  3CCU A;  1QDN A;  3EH1 A;  2CDT A;  5FRN A;  4J6W A;  3RUX A;  4HVV A;  4ME7 A;  5FLX E;  1NE8 A;  2ZPI B;  3RDV A;  2K2V A;  2RQR A;  2LT4 A;  4LXC A;  4X34 A;  2DER A;  3CCJ T;  3GIB A;  1N9S A;  1GXI E;  5AT1 B;  3X20 B;  3EG3 A;  2EQM A;  4M77 E;  4ZN3 A;  2JN0 A;  2K2M A;  2J7I A;  5GAN e;  1NYF A;  2OAU A;  3FLG A;  4EMK A;  1QVG P;  4M78 E;  1RLQ C;  2RQW A;  1Q7Y R;  3OY9 A;  1YJN Q;  3EGX A;  3VUZ A;  1HD3 A;  3J81 E;  2WAC A;  1QCF A;  1HYO A;  1SSF A;  3NPF A;  3EG2 A;  3M0P A;  3EHQ A;  7AT1 B;  2X3W D;  2MOX A;  1SRL A;  3CCV A;  3NTK A;  5LJ5 j;  3MB5 A;  4JJC A;  2GGR A;  1NJI R;  1SF9 A;  1WJR A;  2KQW A;  2LCC A;  2RMO A;  1RI0 A;  1G8X A;  1I1J A;  1W1F A;  2DEQ A;  2QA4 T;  2ZZD A;  4M7A G;  3LWH A;  1AZG B;  1VOM A;  5CR2 A;  4JJD A;  2K7A A;  2DO3 A;  5FU7 C;  1CKB A;  3PMT A;  1RAA B;  2R5M A;  4BY6 C;  1GCQ C;  2D0Q B;  3LGA A;  3GPL A;  3TEE A;  1ZLM A;  2KRS A;  2Q1D X;  2VXE A;  2XDP A;  1JBM A;  4E7L A;  1VQL Q;  2GBQ A;  3CQT A;  4ZGD B;  4BY6 B;  3A98 A;  4F04 B;  2NUT B;  1PHT A;  1I5L A;  3R6O A;  2P0Q A;  2JJ9 A;  4CRI A;  1QCO A;  2NUP B;  3H0H A;  2X4W A;  1B34 B;  2V1Q A;  3AT1 B;  5HCK A;  1UG1 A;  3X24 B;  4C8Q E;  3URG A;  2GFA A;  4Y92 A;  2HEQ A;  1UJY A;  3VS5 A;  1KQ1 A;  3OB9 A;  2FZK B;  1FMV A;  2CSQ A;  5HK0 A;  2KMT A;  4F14 A;  4DOW A;  2KRM A;  3S3N A;  2D6F A;  1XJW B;  2W10 A;  1VQO Q;  1U3O A;  5LJ5 e;  2J6O A;  1NBE B;  2KSS A;  3JCM d;  1XTD A;  1N8R C;  4FIB A;  4GLK A;  1Q7Y U;  1Y57 A;  3CCL Q;  1RAH B;  1UGR B;  1QCN A;  4JUV A;  4JLI A;  3CCE T;  4M75 G;  2KRO A;  3D7S B;  4D8D A;  1JO8 A;  4FYV B;  4EMK C;  4RG2 A;  1W2B S;  2BZX A;  5DYI A;  3I35 A;  3MJX A;  3M55 A;  3CCM A;  3PIP A;  4EMK B;  1TH7 A;  3M9Q A;  5GAN 6;  3IQL A;  4PJO A;  2PUK B;  3LW5 E;  4C92 D;  4QVC A;  4AFZ C;  5GAO l;  3I56 A;  4RTT A;  1JXM A;  1PD0 A;  2PU9 B;  1S1N A;  1VQ4 Q;  2K4Y A;  2KRN A;  1RAC B;  2LNH B;  4X1V A;  5KYY A;  2K9G A;  2ZAE A;  5CCB A;  1KFZ A;  3EFS A;  1LPL A;  3O5Z A;  4HVU A;  4R55 A;  1FMW A;  1WFW A;  2RF0 A;  3OYJ A;  4BB7 A;  3M4G A;  2EPD A;  1YJN A;  4V2S A;  4XTY A;  1UTI A;  1Q81 R;  3UPU A;  2CP6 A;  3BY7 A;  2EYX A;  2RHX A;  3VS1 A;  3QUI A;  1IRE B;  1NYG A;  2BE7 D;  5LJ5 g;  4KGX B;  5FW9 A;  3ZJU A;  2A7Y A;  2PVO B;  2R58 A;  1JRI A;  2FEI A;  2K57 A;  1VQN T;  3M54 A;  4GBQ A;  4JRI A;  2YUN A;  4A53 A;  3BE3 A;  2K3B A;  3OYF A;  1RUW A;  3CCR Q;  3G71 A;  4PFZ A;  3JRZ A;  1XOV A;  1GBR A;  3EG9 A;  2EQU A;  1H3H A;  1OX8 A;  2AHJ B;  3CCS Q;  2X4X A;  2DEU A;  1D0X A;  1XQH A;  2PVG B;  3A1P A;  2JW4 A;  2VB6 A;  4M77 F;  1VQL A;  1KJW A;  3LYI A;  4CC4 B;  2EJF A;  5GAO r;  2DNU A;  4M78 F;  1GCP A;  2YDL A;  4PJO C;  1ZC1 A;  2KGT A;  4OMF B;  1ABQ A;  2CT4 A;  3J7A F;  4M77 G;  1Y96 A;  3SWN A;  1IGU A;  4B9W A;  4PJO B;  1YFN A;  2MPX C;  4II1 A;  3MKD A;  4RKU E;  1BK2 A;  4XK8 E;  3PTA A;  1QP2 A;  4DBR A;  4F7U G;  2FPF A;  2LJ0 A;  4IUV A;  4M75 D;  4RG8 A;  4ZGJ B;  1M90 U;  5D6X A;  2B25 A;  3CCL A;  2F5K A;  1YIJ T;  1OOT A;  2DET A;  1I4K 1;  5KYY B;  1UGQ B;  5GAN 4;  2RI5 A;  2DXU A;  3DB4 A;  3UWN A;  2HCK A;  3QDR B;  4J9G A;  3JCM V;  4LE9 A;  2RQT A;  3CPW A;  4ZTF A;  3CPW S;  2Y4X A;  1UGV A;  2LJ1 A;  3HHT B;  4JJN K;  5IXB A;  3OYE A;  4OB1 B;  3MEA A;  2ROL A;  4OB2 B;  2CGH A;  4C8Q F;  1EZZ B;  5CKE A;  4M7D C;  2FO0 A;  3A8O B;  1T0H A;  2F2X A;  1VQ4 A;  3OMG A;  1ZUY A;  3G4S A;  2GCX A;  4XU0 A;  2A0F B;  2ZCF B;  4HKE A;  3QHS A;  1C6V X;  3PGG A;  4M7D B;  4J6Y A;  1PM3 A;  3M5A A;  3G71 T;  1M4Z A;  2OJ2 A;  4HCK A;  1Q7Y C;  1IHV A;  3CC4 T;  3EG9 B;  2JMA A;  4KT0 E;  5KYW A;  1QKX A;  5LJ3 g;  2EJ9 A;  2CT3 A;  2FL7 A;  3OA6 A;  5I22 A;  5LJ5 f;  3OW2 S;  2DL4 A;  5C18 A;  4C0F A;  2FYK A;  2LVM A;  2QXF A;  2XD0 A;  3EAE A;  1BI1 A;  2JT4 A;  1WHK A;  4HVW A;  2QA4 Q;  2C0I A;  1OX9 A;  5FU6 C;  3ZBD A;  5CVI A;  1KQS P;  3SWN C;  2ENM A;  5KH6 A;  2L8D A;  2L0A A;  4C0D C;  4JRK A;  2LZ6 B;  2RPN A;  2LQK A;  2KXD A;  1D09 B;  1Y96 B;  5FU6 B;  2A28 A;  1RAG B;  3SWN B;  2FRW A;  1PC0 A;  3FEO A;  2MM0 A;  1M5Q 1;  3QWX X;  4KLN A;  4XTW A;  5IT9 E;  1T3S A;  1G3T A;  2ABL A;  3PMI A;  2P0K A;  2QQ9 A;  3JCM e;  2CP3 A;  3CCR A;  5GMK l;  3RNJ A;  2QQS A;  1OZ2 A;  2XU8 A;  3MPU B;  1TOV A;  1UE9 A;  2QG9 B;  3PE0 A;  3FC3 A;  3M0T A;  3CCS A;  3E9F A;  1M2O A;  3INZ A;  3M58 A;  2F5T X;  3OS2 A;  4NS5 A;  4M77 D;  1IRX A;  1N5Z A;  3M56 A;  3MP8 A;  1CZ4 A;  1BCO A;  3HRT A;  4M78 D;  4XU2 A;  4A4E A;  2EGC A;  3UF4 A;  2RB6 A;  4JJB A;  3CXC A;  3ER0 A;  3CXC S;  3CCE Q;  2BE9 B;  4C92 A;  2HBW A;  1I07 A;  2HL3 A;  3PVQ A;  5FRM A;  5IHK A;  3DB3 A;  4A4H A;  4LNP A;  2RJC A;  2QGF B;  3SHW A;  1N6A A;  3REB B;  2MAM A;  4KGV B;  2E12 A;  3OYM A;  2CSI A;  1MMD A;  4KUI A;  3G4S T;  1YI2 T;  5CIU A;  2C06 A;  4HT9 A;  5FTM A;  5CD1 A;  4LDV A;  4ZGE B;  4NOY A;  2PQW A;  3UA6 A;  2JTM A;  2Q1A X;  2RJD A;  3QPH A;  3MEU A;  5KYW B;  2YXY A;  1T3L A;  2QTX A;  4Y91 A;  3PIO A;  3QZ5 B;  4LN2 A;  2X4Y A;  2JOY A;  2V26 A;  2YRV A;  4KBM B;  3JCM g;  2QDL A;  5GAM d;  2KXC A;  2HQE A;  1IB8 A;  2M1H A;  4C8Q D;  2QGG A;  2COW A;  3UAT A;  1VA7 A;  4FT4 A;  1M1G A;  2DL8 A;  5DY9 A;  3A8M B;  5KYX A;  1X2Q A;  4M7A A;  1E6H A;  1VQ5 T;  5GLF A;  1I81 A;  2XDD A;  2HNI A;  2O9S A;  2D8J A;  1KD1 R;  4L6V 5;  1JJ2 A;  3WVE B;  3CCR T;  1JJ2 S;  3FB9 A;  3C94 A;  5GAN 3;  1G83 A;  2J06 A;  3UDC A;  2E6N A;  4RTW A;  1LJO A;  1Q81 C;  3L2R A;  2SRC A;  3A8G B;  1VQN Q;  4N4I A;  2EWN A;  1FYN A;  1UEB A;  4HCC A;  3A8H B;  1H3Z A;  4A4F A;  3CME T;  2YWW A;  1PKS A;  3EGU A;  4TVR A;  4WCI A;  3OYA A;  4LD9 K;  2EAY A;  1X43 A;  3QII A;  3QXE B;  1YIT A;  3LGL A;  1WXU A;  3UA7 A;  4FCY A;  3CF2 A;  1U06 A;  2GTO A;  3OS0 A;  1YCS B;  4E7K A;  4YTL A;  3JCM P;  4OGE A;  4C92 B;  4IKF A;  1QQJ A;  2DRM A;  2XDB A;  2HD0 A;  5A0L A;  2JM9 A;  1LVK A;  2JUF A;  3P8D A;  2BKD N;  2FPD A;  1Q82 U;  3BDL A;  4M75 A;  5GMK i;  4XTV A;  2RHY A;  1OPL A;  1AHJ B;  2H3E B;  1O75 A;  4J9C A;  3HU3 A;  1PSE A;  1E32 A;  2OX7 A;  2KR3 A;  3LX7 A;  3V8K A;  3OYY A;  1KQ2 A;  1G3W A;  2L2P A;  3P8H A;  2G3R A;  2VXF A;  3C95 A;  2CZ0 B;  1D0Y A;  5IH2 A;  4MZP A;  4BI8 B;  1X6G A;  1YP5 A;  1VQ8 T;  4IIM A;  1KHI A;  5LJ3 h;  4X9C A;  4RTX A;  2RQV A;  2BTT A;  1YIJ Q;  2RNA A;  3CCE A;  2LX7 A;  2DTI A;  2JMC A;  2PTK A;  1BCM A;  3PT9 A;  3TQ7 P;  3M59 A;  2ATC B;  3HPW A;  2L5Q A;  4M7A C;  2O9V A;  5I21 A;  3QZ9 B;  5KYX B;  4M7A B;  2DVJ A;  4OF1 A;  2LQ8 A;  1I5O B;  1HSQ A;  5IAY A;  3VU3 C;  5CQY A;  4FYY B;  3S3M A;  1SPK A;  3M57 A;  1UGP B;  3JCM f;  5EG2 A;  2E65 A;  3LGF A;  5CCA A;  1OQK A;  4VUB A;  3RMQ A;  1X69 A;  1WXB A;  3JCM X;  3EH2 A;  2R5A A;  2HAX A;  4KUL A;  1A0N B;  3E19 A;  1H8K A;  2AZS A;  4ANJ A;  1WJQ A;  4OMO A;  2GF7 A;  3G71 Q;  4BE2 A;  4RTU A;  1I8F A;  4MDX A;  3CC4 Q;  4ARC A;  3EFR A;  1YIT T;  2I2L A;  2RK1 A;  1WDX A;  2RD1 A;  3TRE A;  3SEM A;  2JNG A;  4PL6 A;  1QVP A;  1ARK A;  4AG1 C;  2LCL A;  4PJO E;  4QKU A;  2K3Y A;  3V7S A;  2RI2 A;  4M75 C;  6AT1 B;  2HBP A;  1VQ6 Q;  1TSF A;  5KE2 A;  3I5S A;  1EFN A;  2D1X A;  2RI3 A;  2RH2 A;  4M75 B;  1VQN A;  3HRS A;  2ZGW A;  2F2V A;  4JRQ A;  4OMQ A;  1FMK A;  2COZ A;  1EX4 A;  4CI0 C;  5GAM j;  2COY A;  2EYZ A;  2BZY A;  2PUO B;  2GFU A;  3U23 A;  2C0T A;  1IO6 A;  2JTF A;  2E41 A;  2RHZ A;  1ABO A;  2DK3 A;  1M9S A;  4K11 A;  2J6F A;  1WJS A;  2DIQ A;  1VQM A;  5GAN g;  1UDL A;  3OS1 A;  2PWY A;  4PFP A;  2DL7 A;  4J6X A;  3OYC A;  1WHH A;  4F7U A;  1YJW T;  1W2B A;  3JSC A;  3LH5 A;  1YWO A;  3HFN A;  3VRZ A;  1ZA1 B;  3A8L B;  4LDY A;  2V8J A;  1QVG S;  1SG5 A;  1P92 A;  4PLL A;  1Y07 A;  4A63 B;  4EPC A;  1NJI U;  2F2W A;  3BDU A;  1R7R A;  2JXB A;  3OYL A;  3EG1 A;  1JXO A;  3RIR A;  2LRQ A;  1RL2 A;  3HP9 A;  4E47 A;  3EGX B;  5CKB A;  3RMS A;  2Q19 X;  3O8V A;  1WYX A;  1NLP C;  4ZNX A;  4RMO A;  3H0I A;  4QVZ A;  4M7D E;  1MNE A;  3HRU A;  4FSS A;  2Q18 X;  2KNB B;  3KBG A;  1O54 A;  5C6S A;  1BI0 A;  2CZ6 B;  2MM2 A;  4OVA A;  3G4S Q;  2E6Z A;  5KE3 A;  1YI2 Q;  5GAM e;  1YIJ A;  2CUD A;  2K5L A;  3QG1 A;  1YNZ A;  1M8M A;  3L2U A;  2DRK A;  3OYB A;  4N4H A;  1TG0 A;  2QQR A;  1YBY A;  2QEX A;  3TSW A;  4BD3 A;  3BW1 A;  3QYH B;  4ATO A;  3MO8 A;  3HU1 A;  1Q82 C;  3VS3 A;  1RAB B;  1IXD A;  5FTN A;  2QYZ A;  3RKY A;  4E7H A;  1RLP C;  2VVK A;  4J9E A;  4FW1 A;  5ECA A;  3CPW P;  1VQ5 Q;  2D8H A;  3C0C A;  2VKN A;  2AZV A;  1C1A A;  4IUT A;  2DFU A;  4PLI A;  2PZ1 A;  3OBW A;  4QQ6 A;  2MCN A;  2AT1 B;  4J9F A;  3CC4 A;  2QDY B;  1Q95 G;  2JS2 A;  2OTJ A;  1ZSZ A;  2E5K A;  1UUE A;  2KYM A;  1AOJ A;  1VQM T;  2I0N A;  1VUB A;  1WXT A;  1NG2 A;  3V7R A;  3CME Q;  4F7U B;  3OMC A;  3TCJ A;  1OU9 A;  4J7F A;  1VQ6 A;  1NLO C;  4XTU A;  3ASK A;  4OB0 B;  1KC8 R;  5CAI A;  5GAN 8;  2HQH A;  5D7U A;  3LWI A;  1PRM C;  4DBH A;  2P4R A;  3VUB A;  4FYX B;  4IUP A;  5GAN f;  2DXB A;  2HQX A;  5A2Q E;  4M78 G;  2NLU A;  5GAM g;  2GQV A;  3OS5 A;  3FDR A;  4R56 A;  3J80 E;  3MEV A;  1BI2 A;  1W4S A;  5KYN A;  5GMK h;  1PWT A;  4BI3 A;  3QQ7 A;  3JB9 I;  2A36 A;  1QWE A;  3F70 A;  2YLB A;  1B7T A;  4FL6 A;  5GJW B;  1G3S A;  1Q81 U;  3E2U A;  1AWJ A;  4E7J A;  1QMC A;  1Q86 R;  3CD6 T;  2K79 A;  3DKM A;  3AHU A;  1WLF A;  3H9N A;  2OAW A;  4Y28 E;  2ROT A;  2YUJ A;  4RTZ A;  4PJO F;  3VS2 A;  5GAO n;  1VQ8 Q;  4B6M A;  5GAN 2;  2QEX T;  3NGP A;  1GL5 A;  3QJY A;  2KI7 A;  2YVL A;  1KIK A;  4AT1 B;  4LD6 A;  1FX7 A;  4AQ7 A;  2PJH B;  1K8A R;  3CEY A;  1IGQ A;  4QQG A;  2Z0W A;  8AT1 B;  4AS1 A;  5J3B A;  3TVT A;  1M8V A;  3TSZ A;  2FZG B;  1YI2 A;  4F17 A;  5D6W A;  1YN8 A;  4C8Q G;  4FYW B;  2MF2 A;  2KT1 A;  2M0O A;  3CXC P;  2ECZ A;  2WSF E;  2CUB A;  4WTO B;  2DJZ A;  2OTJ T;  3RKW A;  1U1S A;  3OW2 A;  1ZSZ B;  2XKO C;  1QVF A;  3I55 A;  1QVF S;  2DXT A;  2DE0 X;  2K3X A;  2K5I A;  5GAN h;  5GAN 5;  9ATC B;  3OQ5 A;  1NJI C;  4C5I A;  1VQ6 T;  1WPY A;  2ZPG B;  1YIT Q;  3RR6 A;  1ZBX A;  2CP5 A;  2A08 A;  1N27 A;  4MMK A;  1WHL A;  2P84 A;  4R0K A;  4O6J A;  4M7D F;  3ZJT A;  2VAS A;  1MV0 B;  1ZBJ A;  1VQ5 A;  4HT8 A;  2CP7 A;  1E6G A;  1BB9 A;  4EMG A;  1AVZ C;  1R8O B;  1FXX A;  1VQ9 T;  4M7D G;  1K1Z A;  5HK3 A;  3GLX A;  1WA7 A;  4EDU A;  5L23 A;  2V1R A;  1SEM A;  3RBB B;  5CCX A;  2GTJ A;  4Z02 A;  2NYS A;  4JZ3 A;  2JVV A;  2RJE A;  3VYG A;  3CME A;  3L42 A;  4JRP A;  3QWY A;  5IHN A;  1G5V A;  2ED1 A;  3QYG B;  1GBQ A;  3C12 A;  5GAM f;  2RO0 A;  1K8A U;  1QCS A;  3OYD A;  2HMA A;  2NUZ A;  2X3X D;  2DTH A;  1RAF B;  1JJ2 P;  3CPF A;  5A0G A;  2CP2 A;  1IHW A;  2HDA A;  2AKL A;  1V1C A;  1V76 A;  4M7A E;  4J8O A;  1YJW Q;  1UHF A;  4XQ3 A;  3JCM J;  3CC2 T;  2CP0 A;  4HA8 A;  1UJ0 A;  2E64 A;  2KAF A;  1VQ7 T;  2GNC A;  5LJ5 h;  4IUQ A;  2DX1 A;  2LCS A;  1TUD A;  1U5S A;  4MZM A;  3G6E A;  4Z89 A;  2EFI A;  2LMJ A;  2J6K A;  2E3H A;  4XTX A;  2EBP A;  1VQ8 A;  3JAM E;  2KBT A;  1PG5 B;  4E7I A;  2LT1 A;  2LJ3 A;  3ZL7 C;  3M0Q A;  4QT7 A;  3I55 T;  2H3J A;  4KRT A;  2DAQ A;  1EIF A;  2DBM A;  4KH0 B;  2LC4 A;  1KQS S;  2EW3 A;  1AZE A;  1QKW A;  5ERG B;  1S72 A;  4BE1 A;  4J7I A;  3VJP A;  3OBY A;  1VQK T;  3FJP A;  1U8R A;  3SDZ A;  3L2V A;  4RV0 A;  2EKH A;  1LOJ A;  5J26 A;  8ATC B;  2OTL A;  2X51 A;  5CQX A;  2X4J A;  2NWM A;  1BYM A;  4M75 E;  1ZUU A;  2VC8 A;  2E3I A;  2CH4 W;  1UHC A;  4MDW A;  1HXD A;  2LX9 A;  2X35 A;  1GFC A;  1MMG A;  1ZX6 A;  1J3T A;  2RHI A;  2ZPH B;  1BIA A;  3N5B B;  5D6Y A;  4XU1 A;  1O9S A;  1K0X A;  4Z88 A;  3OSS C;  4XU3 A;  3M4Y A;  2E1H A;  4J9D A;  4PKC C;  1BIB A;  2DL3 A;  2HSE B;  5FTK A;  2Q1C X;  3C4S A;  1XNI A;  1NEG A;  1D3B A;  5DYG A;  4IUU A;  4C92 C;  3CCQ T;  1UFF A;  4AFS C;  3OYH A;  1VQM Q;  2IIM A;  2JV2 A;  2D0N A;  4JS4 A;  1G3Y A;  1NM7 A;  2KY9 A;  2GQI A;  4M7D D;  2H8H A;  5GAO m;  1U1T A;  2EQJ A;  3T9N A;  4EIK A;  2HKQ B;  2F69 A;  4E2F B;  4C0G A;  4BAC A;  3I9Q A;  2RHU A;  1CZ5 A;  1ZQ1 A;  2AKK A;  4Q5W A;  3H6Z A;  2C0O A;  4KGZ B;  5J39 A;  1X27 A;  4ELY C;  3OYI A;  2EIF A;  1MUZ A;  1TU0 B;  2QK0 A;  5L8R E;  3QQ8 A;  1WQW A;  2DZC A;  2VGM A;  3E9G A;  1TTH B;  4DQ2 A;  1WI7 A;  3PVL A;  2PVD B;  1SHF A;  1M3A A;  5LJ3 d;  3QC8 A;  3EGD A;  2KVQ G;  3GBQ A;  4C5H A;  2A37 A;  1KD1 U;  4M4Z A;  1NPR A;  1YJW A;  3CD6 Q;  2LQN A;  4C0Z A;  1TS9 A;  1S72 T;  3QWZ A;  2M0Y A;  2MYS A;  4C5E A;  1JEG A;  3EFO A;  2QQB A;  2QEX Q;  2OTL T;  3ZFJ A;  2VYT A;  1Q86 C;  1SRM A;  1JU5 C;  4KOD A;  4OML A;  1X75 C;  4DBF A;  3JB9 F;  1WIE A;  1CR5 A;  5GAO p;  4J83 A;  3R6N A;  3CC7 A;  3RER A;  2B8A A;  2QAS A;  1QW1 A;  2LTO A;  2YLC A;  1SKU B;  4RUG A;  3JB9 G;  2Y4Y A;  1W2B P;  1NZ9 A;  1PKT A;  1K8A C;  2IPO B;  2L3S A;  3EHR A;  2VGN A;  4F16 A;  3OYG A;  1DJ7 B;  3OSV A;  2JTE A;  5HKC A;  2DD4 A;  1OYX A;  1WZO A;  1YJ9 T;  3H0F A;  5DLQ E;  3REA B;  3GNG A;  1BBZ A;  4F7U E;  2LNV A;  2EYQ A;  2O31 A;  1K73 R;  3L2Q A;  1D3B B;  2E10 A;  4M7A F;  2OTJ Q;  1B3Q A;  2MWP A;  3SD4 A;  2WSE E;  2KYB A;  4JS5 A;  2LP5 A;  1H64 1;  3FIF A;  1K76 A;  2ESW A;  3KFV A;  2E70 A;  1VYU A;  4HCZ A;  2HZY A;  3VRY A;  1ZUK A;  4FU6 A;  1I0C A;  2AIR B;  2M02 A;  2XI9 A;  1YHQ T;  2CYZ B;  3P8B B;  4GLM A;  3G6E Q;  2RK2 A;  2DD5 A;  4N0A A;  3MEW A;  3QSU A;  5FU7 B;  1B07 A;  3ZJV A;  1VQP T;  2V8I A;  1VQ9 Q;  4M77 A;  4HCB A;  3RKX A;  2HKN A;  3MP1 A;  3L2W A;  2AK5 A;  1D1A A;  5IXF A;  5GAN 7;  1M3B A;  2X9H A;  4M78 A;  1LCK A;  3A5Z B;  3M53 A;  1RAD B;  2DVE A;  4DEX A;  3EGD B;  3HU2 A;  2JS0 A;  2RQU A;  2O01 E;  2M51 A;  1S3S A;  3BQB A;  5I2S A;  4M75 F;  4LDW A;  1QVG A;  1D1C A;  1KSW A;  4KO8 A;  3CCU T;  3JCM h;  3EFO B;  1OZ3 A;  2EJG A;  2YSQ A;  5CKH A;  3PNW C;  1H92 A;  5EQJ B;  2DLP A;  1RI9 A;  3CMA A;  5FTL A;  1G2B A;  1MHN A;  2VUB A;  2VV5 A;  4XAX B;  4BDZ A;  3CC2 Q;  3CC7 T;  2V8K A;  2EYW A;  2R57 A;  3G1J A;  1K73 U;  4AFQ C;  2DIG A;  2LQW A;  2YHT A;  2MWO A;  4ELZ C;  5I2M A;  1VQ7 Q;  4NL3 A;  2RJF A;  3KUF A;  1KK7 A;  1AWW A;  1NEB A;  4OB3 B;  2EGA A;  3G7Z A;  2HSP A;  2ZPB B;  3CD6 A;  2O4X A;  2EGE A;  1Z9Q A;  3CCV T;  4OMM A;  1UEC A;  4C8Q A;  5HY6 A;  1FWZ A;  3I55 Q;  1WHM A;  2DPP B;  4DA4 A;  1M2V A;  3LH0 A;  1TWB A;  3JB9 D;  4J5Y A;  5GMK m;  1VQK Q;  4BUG A;  1BI3 A;  3NTH A;  4AG2 C;  3WVD B;  4N0A C;  5IHI A;  3NHN A;  3HKS A;  5LJ3 j;  5CKD A;  1ZSG A;  1M90 R;  4M77 C;  5CO7 A;  5I11 A;  2K5F A;  4FSX A;  2MMP A;  1N9R A;  2QI2 A;  3JCM c;  4M78 C;  4WF2 A;  2LW6 A;  2ED0 A;  2YT6 A;  2FG0 A;  4M77 B;  1X2K A;  1Z9Z A;  1VIE A;  3NTI A;  3MCA B;  1KD1 C;  3QJ6 A;  4M78 B;  2QAZ A;  2DMO A;  5CK9 A;  5C0M A;  1AWO A;  4M7A D;  1WNL A;  4J9I A;  2FB7 A;  1QLY A;  3WXM B;  4M7D A;  3GNF B;  3HL8 A;  4E7S A;  4CQN A;  1QP3 A;  3CCQ Q;  2SEM A;  3CBP A;  4PJJ A;  2E5Q A;  1TXQ A;  2DM1 A;  4D6W A;  3JB9 J;  2CH4 A;  3M0R A;  1JB0 E;  2XIC A;  3CMA T;  1Y7X A;  1MV3 A; 
#chains in the Genus database with same CATH homology
 4JRP A;  3L42 A;  3JCM P;  1WGS A;  4OGE A;  4C92 B;  5HK0 A;  2KMT A;  4IKF A;  1G5V A;  3QYG B;  3C12 A;  3SB2 A;  5GAM f;  2RO0 A;  1K8A U;  4DOW A;  1QCS A;  3OYD A;  2XDB A;  3UPU A;  2HD0 A;  5A0L A;  3S3N A;  1VQ9 A;  2D6F A;  1ZHI A;  5B6C A;  2DTH A;  5LJ3 e;  1YCY A;  2JUF A;  5LJ5 e;  3P8D A;  2BKD N;  3X26 B;  3CCM T;  1Q82 U;  2KSS A;  3CPF A;  1XTD A;  3JCM d;  1N8R C;  4FIB A;  5A0G A;  3BDL A;  4GLK A;  4M75 A;  5GMK i;  4XTV A;  1Q7Y U;  2RHY A;  1AHJ B;  4F7U F;  4L5G A;  1O75 A;  3HU3 A;  1UGR B;  4N4G A;  1PSE A;  2XHC A;  3L1A A;  1E32 A;  4M7A E;  4JUV A;  4J8O A;  4JLI A;  3LX7 A;  4M75 G;  3CCE T;  3V8K A;  3OYY A;  4XQ3 A;  4C8Q C;  3I56 T;  3E1S A;  2M16 A;  2L3R A;  4EMK C;  3JCM J;  4RG2 A;  1KQ2 A;  1G3W A;  3CC2 T;  1W2B S;  3P8H A;  2O4X B;  1VQO A;  5DYI A;  2G3R A;  2VXF A;  3C95 A;  4HA8 A;  5FRO A;  3M55 A;  2CZ0 B;  3CCM A;  4MZP A;  4BI8 B;  3PIP A;  4C8Q B;  1VQ8 T;  4EMK B;  1TH7 A;  1KHI A;  2E64 A;  2KAF A;  3M9Q A;  4X9C A;  5LJ3 h;  3JCM W;  5GAN 6;  3S3O A;  5LJ5 h;  4IUQ A;  3GF5 A;  4PJO A;  2PUK B;  3TU4 K;  3LW5 E;  4C92 D;  2P4T A;  3CBO A;  4A4G A;  3CCE A;  4QVC A;  5GAO l;  3I56 A;  3CMA T;  2DTI A;  4MZM A;  3PT9 A;  3G6E A;  3M59 A;  4PJO G;  3CC2 A;  2EFI A;  5GAO q;  3HPW A;  2L5Q A;  4UC4 A;  4M7A C;  2XK0 A;  2CZ1 B;  5I21 A;  4XTX A;  4LDU A;  2PU9 B;  4XTZ A;  5M9O A;  2CKK A;  3ME9 A;  1VQ8 A;  3JAM E;  3FPT A;  4E7I A;  1VQ7 A;  2LT1 A;  2K4Y A;  1I9G A;  3QZ9 B;  2P0P A;  4M7A B;  3GOX A;  3I55 T;  2H3J A;  4OF1 A;  2LQ8 A;  4P5N A;  2DAQ A;  1EIF A;  5IAY A;  1YJN T;  3VU3 C;  2LC4 A;  1KQS S;  5CQY A;  2WSC E;  4JLG A;  2DKG A;  5ERG B;  3VV0 A;  3S3M A;  1S72 A;  4BE1 A;  2RM4 A;  3M57 A;  4J7I A;  3VJP A;  1KC8 U;  3EFS A;  3OBY A;  5CCB A;  1VQK T;  1UGP B;  3JCM f;  3FJP A;  5EG2 A;  1U8R A;  2E65 A;  3SDZ A;  4R55 A;  3L2V A;  4RV0 A;  3LGF A;  1LOJ A;  5J26 A;  5IN1 A;  2OTL A;  2MI6 A;  5CQX A;  2X4J A;  5CCA A;  3GP8 A;  4VUB A;  3RMQ A;  1BYM A;  2DZ9 A;  3OYK A;  4M75 E;  4JDS A;  2VC8 A;  3OYJ A;  4BB7 A;  3M4G A;  3JCM X;  1YJN A;  1K9M U;  4V2S A;  2R5A A;  2HAX A;  2DTO A;  4KUL A;  4XTY A;  5GAN d;  3E19 A;  4MDW A;  1HXD A;  2IG0 A;  2LX9 A;  2X35 A;  1WJQ A;  4MML A;  2GF7 A;  2XG8 D;  3BY7 A;  4C92 E;  2RHX A;  1I8F A;  3UT1 A;  2RHI A;  4BE2 A;  3QUI A;  1KG1 A;  2ZPH B;  1VQK A;  1BIA A;  4MDX A;  3N5B B;  1IRE B;  5D6Y A;  3MHX A;  4OP0 A;  3EFR A;  4XU1 A;  1O9S A;  1YIT T;  2I2L A;  4ARC A;  2RK1 A;  2RD1 A;  3TRE A;  1Y71 A;  2BIV A;  3OSS C;  2JNG A;  5LJ5 g;  4PL6 A;  1M1K U;  1QVP A;  2A3L A;  2A7Y A;  3ZJU A;  2PVO B;  2R58 A;  4XU3 A;  1JRI A;  2K57 A;  1VQN T;  1MGQ A;  3M54 A;  3QO3 A;  3M4Y A;  4JRI A;  3SFM A;  3VKI A;  2E1H A;  1K73 C;  4PKC C;  1M1F A;  4A53 A;  3G6E T;  2LCL A;  1BIB A;  3JB9 H;  4PJO E;  3OYF A;  3OYN A;  1VQL T;  2K3Y A;  1Q86 U;  1KHC A;  3V7S A;  2RI2 A;  4M75 C;  5FTK A;  2HBP A;  2EQK A;  3G71 A;  2Q1C X;  2QQA A;  3C4S A;  1XNI A;  1LNX A;  5KE2 A;  3JRZ A;  1X6O A;  1XOV A;  1D3B A;  5DYG A;  4IUU A;  2EQU A;  3L2Z A;  4C92 C;  3CCQ T;  4LDX A;  2AHJ B;  2RI3 A;  3OYH A;  2RH2 A;  4M75 B;  2RA2 A;  2X4X A;  1PSF A;  1VQN A;  2JV2 A;  3HRS A;  4JS4 A;  1G3Y A;  1XQH A;  2KY9 A;  2IVW A;  2ZGW A;  3QC8 A;  2BUD A;  2PVG B;  4M77 F;  4JRQ A;  3X28 B;  2CZ7 B;  4M7D D;  4C0D B;  5GAO m;  1VQL A;  1U1T A;  2EQJ A;  4CI0 C;  5GAM j;  3T9N A;  2F69 A;  3ZJV A;  4C0G A;  3LYI A;  4BAC A;  2EJF A;  5GAO r;  4M78 F;  2PUO B;  3S6W A;  2GFU A;  2RHU A;  4PJO C;  1CZ5 A;  1V29 B;  2E41 A;  2JTF A;  1VIF A;  1ZQ1 A;  2RHZ A;  4RCC A;  5A0D A;  1VQO T;  2DK3 A;  5AYF A;  1M9S A;  3CCQ A;  5EPP A;  2CS7 A;  4MZT A;  4OMF B;  3DLL A;  3J7A F;  4M77 G;  1Y96 A;  2ZPF B;  3H6Z A;  2D9T A;  1WJS A;  2DIQ A;  4Q5W A;  1VQM A;  3HFO A;  5J39 A;  5GAN g;  3SWN A;  4ELY C;  3OS1 A;  3OYI A;  4X9D A;  2PWY A;  4B9W A;  4PJO B;  3CCL T;  2EIF A;  4DOV A;  3DLM A;  4J6X A;  3OYC A;  4F7U A;  5L8R E;  1YJW T;  4II1 A;  3QQ8 A;  2KK4 A;  1NPP A;  3JSC A;  1WQW A;  2DZC A;  4IUR A;  4BI4 A;  2VGM A;  3HFN A;  4RKU E;  1W2B A;  3E9G A;  4ZN1 A;  1OI1 A;  3A8L B;  4LDY A;  4DQ2 A;  2V8J A;  4XK8 E;  3PTA A;  1QP2 A;  1QVG S;  4F7U G;  4L59 A;  3V8J A;  2PVD B;  1P92 A;  4IUV A;  4M75 D;  4RG8 A;  4ZGJ B;  4NL2 A;  4PLL A;  1Y07 A;  5D6X A;  4EPC A;  1M90 U;  1NJI U;  4FM4 B;  3BDU A;  1R7R A;  3OYL A;  4KDI A;  5LJ3 d;  2B25 A;  3RIR A;  2F5K A;  3CCL A;  2LRQ A;  1RL2 A;  3HP9 A;  4E47 A;  3RMS A;  5CKB A;  3RES A;  5LJ5 d;  1YIJ T;  2KVQ G;  2Q19 X;  1I4K 1;  1HK9 A;  3O8V A;  4C5H A;  1KD1 U;  1NPR A;  1YJW A;  4C0Z A;  4RMO A;  1UGQ B;  4QVZ A;  4M7D E;  5GAN 4;  1S72 T;  2RI5 A;  2DXU A;  3DB4 A;  3HRU A;  3QWZ A;  3PFS A;  3UWN A;  3QDR B;  4C5E A;  2Q18 X;  3KBG A;  1O54 A;  5C6S A;  3JCM V;  4QQD A;  4EMH A;  4RCB A;  1BI0 A;  2QQB A;  3CPW A;  2OTL T;  3ZFJ A;  2CZ6 B;  2VYT A;  4ZTF A;  3CPW S;  1Q86 C;  2Y4X A;  2MM2 A;  4KOD A;  3HHT B;  1X75 C;  4OVA A;  1VQ4 T;  2E6Z A;  3V8L A;  5KE3 A;  3JB9 F;  1BKB A;  4JJN K;  4PJO D;  1CR5 A;  5GAM e;  5GAO p;  1YIJ A;  2K5L A;  3NFC A;  1KQS A;  4J83 A;  5LL6 S;  3QBY A;  3OYE A;  3QG1 A;  4OB1 B;  3MEA A;  3HSB A;  3L2U A;  3CC7 A;  4BDY A;  3RER A;  2B8A A;  3OYB A;  4N4H A;  2CGH A;  4OB2 B;  1QW1 A;  2LTO A;  4C8Q F;  2YLC A;  5GMK j;  3BFM A;  5CKE A;  4O5V A;  2LDM A;  3JB9 G;  4M7D C;  2Y4Y A;  2QQR A;  1YBY A;  1X01 A;  1NZ9 A;  3A8O B;  2KDS A;  3JCM Q;  2QEX A;  4QW2 A;  1K8A C;  3Q1J A;  5DM7 R;  1VQ4 A;  2VGN A;  3OMG A;  3OYG A;  1DJ7 B;  3G4S A;  2GCX A;  3OSV A;  4XU0 A;  4BD3 A;  3BW1 A;  3QYH B;  2ZCF B;  4HKE A;  5HKC A;  4ATO A;  3TIW A;  3QHS A;  2DD4 A;  3MO8 A;  1OYX A;  3CCJ A;  3KXT A;  3PGG A;  4M7D B;  1YJ9 T;  5CKF A;  1Q82 C;  3HU1 A;  1N8R U;  5DLQ E;  3GNG A;  4J6Y A;  3FRN A;  3M5A A;  4KDL A;  3G71 T;  1M4Z A;  4F7U E;  5GAM h;  1Q7Y C;  5FTN A;  2LNV A;  2EYQ A;  3RKY A;  3X25 B;  4E7H A;  3L2Q A;  5C1B A;  1D3B B;  3CC4 T;  2E10 A;  3JCM b;  4KT0 E;  4M7A F;  5LJ3 g;  2ZPE B;  2EJ9 A;  2FL7 A;  2MWP A;  3OA6 A;  4KUD K;  5LJ3 f;  3SD4 A;  5LJ5 f;  3OW2 S;  5C18 A;  2WSE E;  4C0F A;  1WQ7 A;  2FYK A;  4JS5 A;  2LVM A;  3CBM A;  1H64 1;  2QXF A;  4PNO A;  2XD0 A;  3EAE A;  1BI1 A;  1YJ9 A;  3FIF A;  1M90 C;  2E70 A;  5KCH A;  4HCZ A;  4IUT A;  4PLI A;  5FU6 C;  3ZBD A;  3MET A;  5CVI A;  3OBW A;  3SWN C;  4FU6 A;  5KH6 A;  4QQ6 A;  2L8D A;  3CC4 A;  2XID A;  1IZ6 A;  4C0D C;  2QDY B;  4JRK A;  3V7C A;  2XI9 A;  2OTJ A;  2LQK A;  1Y96 B;  2M9U A;  3QKJ A;  3CCS T;  4QVD A;  1YHQ T;  5FU6 B;  1VQM T;  2CYZ B;  3P8B B;  3SWN B;  1VUB A;  3FEO A;  3V7R A;  1M5Q 1;  2RK2 A;  2DD5 A;  2FVU A;  2MM0 A;  3FPU A;  4N0A A;  4XTW A;  5DLO A;  3MEW A;  5IT9 E;  4KLN A;  3MP6 A;  5GMK e;  3QSU A;  1G3T A;  5FU7 B;  4GY5 A;  3PMI A;  2P0K A;  2QQ9 A;  4C5G A;  3OMC A;  4F7U B;  3JCM e;  2QA4 A;  3TCJ A;  1VQP T;  3CCR A;  3LHD A;  2V8I A;  5FTJ A;  4J7F A;  1VQ6 A;  5GMK l;  4M77 A;  4XTU A;  4HCB A;  2QQS A;  1OZ2 A;  3OB9 A;  3RKX A;  3ASK A;  2FHD A;  2XU8 A;  4OB0 B;  3MP1 A;  5CAI A;  3L2W A;  1UB4 A;  5GAN 7;  3FC3 A;  5GAN 8;  4M78 A;  3CCS A;  3LWI A;  1YHQ A;  3A5Z B;  3E9F A;  3M53 A;  3VUB A;  4A54 A;  3INZ A;  1KC8 C;  4ARI A;  2DVE A;  3FPR A;  5GAN j;  4IUP A;  5GAN f;  2DXB A;  2DXC A;  2HQX A;  2Y90 A;  3M58 A;  2F5T X;  5A2Q E;  4M78 G;  2EKO A;  2NLU A;  3OS2 A;  5GAM g;  3HU2 A;  1UGS B;  2GQV A;  1VQP A;  4NS5 A;  1VQ7 T;  4M77 D;  3OS5 A;  2O01 E;  3FDR A;  4R56 A;  3M56 A;  3J80 E;  3MEV A;  1BI2 A;  5KCO A;  1W4S A;  3MP8 A;  4B9X A;  1S3S A;  5I2S A;  4M75 F;  3VYH B;  1CZ4 A;  4LDW A;  3ZGZ A;  1QVG A;  1K9M C;  5GMK h;  4KO8 A;  3HRT A;  4M78 D;  2JZ2 A;  3JCM h;  4BI3 A;  3CCU T;  3CME A;  1OZ3 A;  4XU2 A;  2EJG A;  2L89 A;  4A4E A;  4A4K A;  3QQ7 A;  3JB9 I;  1B34 A;  4FT2 A;  5CKH A;  4C92 F;  3PNW C;  2RB6 A;  3F70 A;  2YLB A;  5EQJ B;  4FL6 A;  3CMA A;  3CXC A;  1G3S A;  3ER0 A;  3CXC S;  5FTL A;  4ZTJ A;  4OGC A;  4C92 A;  1Q81 U;  3H8Z A;  1M1K C;  3LLR A;  4E7J A;  1MHN A;  2VUB A;  2VV5 A;  4XAX B;  4BDZ A;  3CC7 T;  3ZEH A;  2V8K A;  3CD6 T;  2R57 A;  5FRM A;  3DKM A;  3BQB A;  3DB3 A;  3AHU A;  4A4H A;  1K73 U;  1WLF A;  4BE0 A;  4C92 G;  2DIG A;  4Y28 E;  3CCU A;  1QDN A;  2YUJ A;  2RJC A;  2YHT A;  4PJO F;  5GAO n;  2MWO A;  5FRN A;  5GAN 2;  1N6A A;  4J6W A;  3RUX A;  2QEX T;  4ME7 A;  5I2M A;  5FLX E;  4ELZ C;  4NL3 A;  2MAM A;  2RJF A;  3KUF A;  1NE8 A;  2ZPI B;  2E12 A;  3OYM A;  3QJY A;  4KUI A;  2YVL A;  3G4S T;  1YI2 T;  2K2V A;  5CIU A;  2C06 A;  4HT9 A;  2LT4 A;  4OB3 B;  4X34 A;  5FTM A;  3CCJ T;  3G7Z A;  4LD6 A;  1N9S A;  3GIB A;  1FX7 A;  4AQ7 A;  1GXI E;  5CD1 A;  2PJH B;  2ZPB B;  4LDV A;  3CD6 A;  4ZGE B;  4NOY A;  2PQW A;  2JTM A;  2O4X A;  3X20 B;  2Q1A X;  2EQM A;  2RJD A;  3CEY A;  2JN0 A;  3QPH A;  4M77 E;  4ZN3 A;  3MEU A;  4QQG A;  3CCV T;  5GAN e;  4AS1 A;  5J3B A;  2OAU A;  4C8Q A;  2QTX A;  1M8V A;  5HY6 A;  1FWZ A;  4Y91 A;  3FLG A;  4EMK A;  4M78 E;  3PIO A;  3QZ5 B;  1YI2 A;  3OY9 A;  2DPP B;  5D6W A;  2X4Y A;  3VUZ A;  4DA4 A;  3LH0 A;  3JB9 D;  4C8Q G;  2WAC A;  3J81 E;  2MF2 A;  1SSF A;  2M0O A;  2JOY A;  4J5Y A;  2YRV A;  4KBM B;  5GMK m;  2WSF E;  3JCM g;  4BUG A;  5GAM d;  1BI3 A;  3NTH A;  3WVD B;  4N0A C;  2HQE A;  3CCV A;  2DJZ A;  2M1H A;  3HKS A;  4C8Q D;  5LJ3 j;  3RKW A;  1U1S A;  3NTK A;  3OW2 A;  2OTJ T;  4FT4 A;  1M1G A;  5CKD A;  2XKO C;  5LJ5 j;  4M77 C;  5CO7 A;  3MB5 A;  1QVF A;  5DY9 A;  3I55 A;  3A8M B;  1QVF S;  4M7A A;  1WJR A;  2K5F A;  2MMP A;  2DXT A;  2K3X A;  2K5I A;  2KQW A;  4FSX A;  2LCC A;  1VQ5 T;  1RI0 A;  5GAN h;  5GAN 5;  1N9R A;  1I81 A;  2QI2 A;  3JCM c;  5GLF A;  4M78 C;  3OQ5 A;  2DEQ A;  4WF2 A;  2XDD A;  2HNI A;  2QA4 T;  1JJ2 A;  4L6V 5;  2ZZD A;  1NJI C;  2LW6 A;  4M7A G;  3WVE B;  3LWH A;  3CCR T;  4M77 B;  1JJ2 S;  4C5I A;  3FB9 A;  3C94 A;  5GAN 3;  1WPY A;  1VQ6 T;  5CR2 A;  2ZPG B;  3UDC A;  1H3Z A;  2E6N A;  1ZBX A;  1VIE A;  3NTI A;  2DO3 A;  1N27 A;  1LJO A;  5FU7 C;  3MCA B;  3PMT A;  3QJ6 A;  4M78 B;  3L2R A;  4MMK A;  2R5M A;  1Q81 C;  4BY6 C;  5CK9 A;  1KD1 C;  3A8G B;  4N4I A;  2D0Q B;  4O6J A;  5C0M A;  4M7D F;  4M7A D;  3LGA A;  2EWN A;  3GPL A;  1WNL A;  3TEE A;  3ZJT A;  1UEB A;  2Q1D X;  2VXE A;  3A8H B;  1VQ5 A;  2XDP A;  1JBM A;  4A4F A;  2FB7 A;  3CME T;  4HCC A;  4E7L A;  3WXM B;  4HT8 A;  4M7D A;  3GNF B;  4ZGD B;  4BY6 B;  3HL8 A;  4EMG A;  1R8O B;  4TVR A;  1FXX A;  3OYA A;  1VQ9 T;  4LD9 K;  1I5L A;  4CQN A;  3R6O A;  2EAY A;  2P0Q A;  3QII A;  3QXE B;  1QP3 A;  1YIT A;  4M7D G;  4CRI A;  3CBP A;  5HK3 A;  3GLX A;  2E5Q A;  3LGL A;  4EDU A;  2X4W A;  5CCX A;  4D6W A;  3JB9 J;  1B34 B;  4Z02 A;  1ZC1 A;  3CF2 A;  3X24 B;  4C8Q E;  3URG A;  2GFA A;  3OS0 A;  2JVV A;  1JB0 E;  2XIC A;  4E7K A;  1KQ1 A;  1Y7X A;  4YTL A;  2RJE A;  3VYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...