1ZC1A

Ufd1 exhibits the aaa-atpase fold with two distinct ubiquitin interaction sites
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
208
structure length
208
Chain Sequence
b'MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin fusion degradation protein 1
molecule tags Protein turnover
source organism Saccharomyces cerevisiae
publication title Ufd1 Exhibits the AAA-ATPase Fold with Two Distinct Ubiquitin Interaction Sites
pubmed doi rcsb
total genus 26
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03152 UFD1 Ubiquitin fusion degradation protein UFD1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1zc1A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1zc1A02
5DYIA 5C1BA 3QQ8A 2PJHB 4KDIA 1QDNA 1S3SA 5FTMA 5DYGA 3CF2A 3QQ7A 2YUJA 4KODA 5GLFA 1E32A 1CZ4A 5B6CA 5FTNA 3TIWA 1CR5A 5C18A 1ZC1A 4KDLA 1WLFA 5FTJA 1QCSA 1CZ5A 3QC8A 5EPPA 4KLNA 2JV2A 3HU1A 3HU2A 3HU3A 4KO8A 5FTKA 1R7RA 3QWZA 5FTLA 4RV0A
chains in the Genus database with same CATH superfamily
3X2KA 2JIPA 3HKZA 1H0HA 4C2MA 3GTOA 1PT1A 3PLXB 1SIWA 2VUMA 3GTLA 2JA6A 2Q1AX 1FDOA 3X2NA 1YNJD 3DMRA 1QDNA 2JIMA 2PJJA 1I50A 2YUJA 1R9TA 2Q19X 4JS7A 2WAQA 1WLFA 1UHDA 1Q16A 1Y1WA 2PICA 1CZ5A 2GAEA 4FERA 1BW4A 3X2LA 2E7ZA 3SUKA 2Q1CX 2AE0X 4JP7A 5GLYA 2YU9A 3ML1A 1FDIA 4JCWA 2MM0A 4ARIA 1PYUB 2KI8A 5D6WA 4KO8A 3TM7B 2B63A 2A6ED 3QWZA 3GTGA 2A6HD 1K83A 3O5AA 1E60A 1BW3A 5CD1A 5CCXA 3SULA 5T5ID 2G6GA 1UHEA 1DMRA 4AVRA 3M3GA 3IR6A 4ARCA 3QQ8A 1KQFA 2KY9A 2PJHB 4GA5A 3H0GA 4AAYA 4CRYG 1I9GA 1PQEA 5DYGA 4GA6A 3CF2A 3SUMA 1AW8B 1PPYA 2BH0A 1Y4ZA 3X2MA 2XDPA 1E32A 4AYBA 3GTMA 2LW6A 3CQZA 1OA7A 1Y1VA 4JP6A 1IW7D 2A68D 3GTKA 5C18A 4UC4A 2Y0SA 4L48A 3IR7A 5FTJA 4NOHA 5CCBA 3ZJVA 2BE5D 1PYQA 1VC3B 2A69D 3X2IA 3LGAA 3OUGA 5EPPA 4AOKB 4AONB 2PMZA 4CS0A 2EEOB 4AZDA 1EU1A 5GLXA 3X2OA 2NVXA 3X2HA 3X2GA 5FTLA 2NVYA 1OGYA 4JJOA 3ZJTA 1PQHA 2C45A 5ERGB 2JIRA 3BQBA 4DMRA 3GTPA 2VPWA 5DYIA 2YVLA 3D30A 1S3SA 5FTMA 2JA5A 2G5DA 4ENGA 2R93A 3QQ7A 4KODA 1PT0A 2KQAA 5GLFA 2JIOA 4D7ZB 1TWGA 1WCMA 2O5JD 1E18A 1G8KA 2GFAA 3FPRA 5FTNA 1CR5A 1ZC1A 1DMSA 4KDLA 1AA6A 5D6XA 1R27A 3FPTA 1QCSA 1WC2A 1TWFA 1TMOA 4CRZA 3CZBA 3FKIA 2NAPA 3QC8A 5GM9A 3ZGZA 4FFTA 1TWAA 1YNND 2VPXA 1O54A 3MB5A 1L8FA 3HU2A 4FG2A 3X2JA 2PNWA 2Q18X 3HU3A 2WB1A 1R7RA 4RV0A 3ENGA 3SUJA 2QQSA 1G8JA 2CW0D 2B25A 1H5NA 2JIQA 2V3VA 4FG4A 3GTQA 2E2HA 2GF7A 4FIBA 2HCZX 5C1BA 4ZM7A 1E61A 2ENGA 1N10A 4KDIA 1KQGA 3GTJA 1SMYD 2MM2A 2R92A 2IV2X 1SFOA 5H4UA 1TWCA 1Y5IA 1PQFA 2Q1DX 3X2PA 1CZ4A 5B6CA 5D6YA 4AS1A 2VPZA 3IR5A 3TIWA 1E5VA 1YLEA 2VPYA 3FPUA 1OA9A 2NYAA 5EQJB 5T5MD 2PI8A 4KLNA 4QIWA 2JV2A 2R7ZA 3HU1A 1TWHA 2PWYA 3ZJUA 1I3QA 3LHDA 4AQ7A 2DMRA 2V45A 1HD5A 1ZYRD 5FTKA 2E2IA 2JA7A 4CQNA 2QQRA
chains in the Genus database with same CATH topology
2JIPA 3HKZA 1H0HA 4C2MA 3GTOA 1PT1A 3PLXB 1SIWA 2VUMA 3GTLA 2JA6A 2Q1AX 1FDOA 1YNJD 3DMRA 1QDNA 2JIMA 2PJJA 1I50A 2YUJA 1R9TA 2Q19X 2WAQA 1WLFA 1UHDA 1Q16A 1Y1WA 2PICA 1CZ5A 2GAEA 2E7ZA 2Q1CX 2AE0X 2YU9A 3ML1A 1FDIA 2MM0A 4ARIA 1PYUB 2KI8A 5D6WA 4KO8A 3TM7B 2B63A 2A6ED 3QWZA 3GTGA 2A6HD 1K83A 3O5AA 1E60A 5CD1A 5CCXA 5T5ID 2G6GA 1UHEA 1DMRA 3IR6A 4ARCA 3QQ8A 1KQFA 2KY9A 2PJHB 4GA5A 3H0GA 4AAYA 4CRYG 1I9GA 1PQEA 5DYGA 4GA6A 3CF2A 1AW8B 1PPYA 1Y4ZA 2XDPA 1E32A 4AYBA 3GTMA 2LW6A 3CQZA 1Y1VA 1IW7D 2A68D 3GTKA 5C18A 4UC4A 2Y0SA 3IR7A 5FTJA 4NOHA 5CCBA 3ZJVA 2BE5D 1PYQA 1VC3B 2A69D 3LGAA 3OUGA 5EPPA 4AOKB 4AONB 2PMZA 4CS0A 2EEOB 4AZDA 1EU1A 2NVXA 5FTLA 2NVYA 1OGYA 3ZJTA 1PQHA 2C45A 5ERGB 2JIRA 3BQBA 4DMRA 3GTPA 2VPWA 5DYIA 2YVLA 1S3SA 5FTMA 2JA5A 2G5DA 2R93A 3QQ7A 4KODA 1PT0A 5GLFA 3FPRA 2JIOA 4D7ZB 1TWGA 1WCMA 2O5JD 1E18A 1G8KA 2GFAA 5FTNA 1CR5A 1ZC1A 1DMSA 4KDLA 1AA6A 5D6XA 1R27A 3FPTA 1QCSA 1TWFA 1TMOA 4CRZA 3CZBA 3FKIA 2NAPA 3QC8A 3ZGZA 1TWAA 1YNND 2VPXA 1O54A 3MB5A 3HU2A 2PNWA 2Q18X 3HU3A 2WB1A 1R7RA 4RV0A 2QQSA 1G8JA 2CW0D 2B25A 1H5NA 2JIQA 2V3VA 3GTQA 2E2HA 2GF7A 4FIBA 5C1BA 1E61A 4KDIA 1KQGA 3GTJA 1SMYD 2MM2A 2R92A 2IV2X 1SFOA 1TWCA 1Y5IA 1PQFA 2Q1DX 1CZ4A 5B6CA 5D6YA 4AS1A 2VPZA 3IR5A 3TIWA 1E5VA 1YLEA 2VPYA 3FPUA 2NYAA 5EQJB 5T5MD 2PI8A 4KLNA 4QIWA 2JV2A 2R7ZA 3HU1A 1TWHA 2PWYA 3ZJUA 1I3QA 3LHDA 4AQ7A 2DMRA 2V45A 4CQNA 1ZYRD 5FTKA 2E2IA 2JA7A 2QQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYI A;  5C1B A;  3QQ8 A;  2PJH B;  4KDI A;  1QDN A;  1S3S A;  5FTM A;  5DYG A;  3CF2 A;  3QQ7 A;  2YUJ A;  4KOD A;  5GLF A;  1E32 A;  1CZ4 A;  5B6C A;  5FTN A;  3TIW A;  1CR5 A;  5C18 A;  1ZC1 A;  4KDL A;  1WLF A;  5FTJ A;  1QCS A;  1CZ5 A;  3QC8 A;  5EPP A;  4KLN A;  2JV2 A;  3HU1 A;  3HU2 A;  3HU3 A;  4KO8 A;  5FTK A;  1R7R A;  3QWZ A;  5FTL A;  4RV0 A; 
#chains in the Genus database with same CATH topology
 3X2K A;  2JIP A;  3HKZ A;  1H0H A;  4C2M A;  3GTO A;  1PT1 A;  3PLX B;  1SIW A;  2VUM A;  3GTL A;  2JA6 A;  2Q1A X;  1FDO A;  3X2N A;  1YNJ D;  3DMR A;  1QDN A;  2JIM A;  2PJJ A;  1I50 A;  2YUJ A;  1R9T A;  2Q19 X;  4JS7 A;  2WAQ A;  1WLF A;  1UHD A;  1Q16 A;  1Y1W A;  2PIC A;  1CZ5 A;  2GAE A;  4FER A;  1BW4 A;  3X2L A;  2E7Z A;  3SUK A;  2Q1C X;  2AE0 X;  4JP7 A;  5GLY A;  2YU9 A;  3ML1 A;  1FDI A;  4JCW A;  2MM0 A;  4ARI A;  1PYU B;  2KI8 A;  5D6W A;  4KO8 A;  3TM7 B;  2B63 A;  2A6E D;  3QWZ A;  3GTG A;  2A6H D;  1K83 A;  3O5A A;  1E60 A;  1BW3 A;  5CD1 A;  5CCX A;  3SUL A;  5T5I D;  2G6G A;  1UHE A;  1DMR A;  4AVR A;  3M3G A;  3IR6 A;  4ARC A;  3QQ8 A;  1KQF A;  2KY9 A;  2PJH B;  4GA5 A;  3H0G A;  4AAY A;  4CRY G;  1I9G A;  1PQE A;  5DYG A;  4GA6 A;  3CF2 A;  3SUM A;  1AW8 B;  1PPY A;  2BH0 A;  1Y4Z A;  3X2M A;  2XDP A;  1E32 A;  4AYB A;  3GTM A;  2LW6 A;  3CQZ A;  1OA7 A;  1Y1V A;  4JP6 A;  1IW7 D;  2A68 D;  3GTK A;  5C18 A;  4UC4 A;  2Y0S A;  4L48 A;  3IR7 A;  5FTJ A;  4NOH A;  5CCB A;  3ZJV A;  2BE5 D;  1PYQ A;  1VC3 B;  2A69 D;  3X2I A;  3LGA A;  3OUG A;  5EPP A;  4AOK B;  4AON B;  2PMZ A;  4CS0 A;  2EEO B;  4AZD A;  1EU1 A;  5GLX A;  3X2O A;  2NVX A;  3X2H A;  3X2G A;  5FTL A;  2NVY A;  1OGY A;  4JJO A;  3ZJT A;  1PQH A;  2C45 A;  5ERG B;  2JIR A;  3BQB A;  4DMR A;  3GTP A;  2VPW A;  5DYI A;  2YVL A;  3D30 A;  1S3S A;  5FTM A;  2JA5 A;  2G5D A;  4ENG A;  2R93 A;  3QQ7 A;  4KOD A;  1PT0 A;  2KQA A;  5GLF A;  2JIO A;  4D7Z B;  1TWG A;  1WCM A;  2O5J D;  1E18 A;  1G8K A;  2GFA A;  3FPR A;  5FTN A;  1CR5 A;  1ZC1 A;  1DMS A;  4KDL A;  1AA6 A;  5D6X A;  1R27 A;  3FPT A;  1QCS A;  1WC2 A;  1TWF A;  1TMO A;  4CRZ A;  3CZB A;  3FKI A;  2NAP A;  3QC8 A;  5GM9 A;  3ZGZ A;  4FFT A;  1TWA A;  1YNN D;  2VPX A;  1O54 A;  3MB5 A;  1L8F A;  3HU2 A;  4FG2 A;  3X2J A;  2PNW A;  2Q18 X;  3HU3 A;  2WB1 A;  1R7R A;  4RV0 A;  3ENG A;  3SUJ A;  2QQS A;  1G8J A;  2CW0 D;  2B25 A;  1H5N A;  2JIQ A;  2V3V A;  4FG4 A;  3GTQ A;  2E2H A;  2GF7 A;  4FIB A;  2HCZ X;  5C1B A;  4ZM7 A;  1E61 A;  2ENG A;  1N10 A;  4KDI A;  1KQG A;  3GTJ A;  1SMY D;  2MM2 A;  2R92 A;  2IV2 X;  1SFO A;  5H4U A;  1TWC A;  1Y5I A;  1PQF A;  2Q1D X;  3X2P A;  1CZ4 A;  5B6C A;  5D6Y A;  4AS1 A;  2VPZ A;  3IR5 A;  3TIW A;  1E5V A;  1YLE A;  2VPY A;  3FPU A;  1OA9 A;  2NYA A;  5EQJ B;  5T5M D;  2PI8 A;  4KLN A;  4QIW A;  2JV2 A;  2R7Z A;  3HU1 A;  1TWH A;  2PWY A;  3ZJU A;  1I3Q A;  3LHD A;  4AQ7 A;  2DMR A;  2V45 A;  1HD5 A;  1ZYR D;  5FTK A;  2E2I A;  2JA7 A;  4CQN A;  2QQR A; 
#chains in the Genus database with same CATH homology
 2JIP A;  3HKZ A;  1H0H A;  4C2M A;  3GTO A;  1PT1 A;  3PLX B;  1SIW A;  2VUM A;  3GTL A;  2JA6 A;  2Q1A X;  1FDO A;  1YNJ D;  3DMR A;  1QDN A;  2JIM A;  2PJJ A;  1I50 A;  2YUJ A;  1R9T A;  2Q19 X;  2WAQ A;  1WLF A;  1UHD A;  1Q16 A;  1Y1W A;  2PIC A;  1CZ5 A;  2GAE A;  2E7Z A;  2Q1C X;  2AE0 X;  2YU9 A;  3ML1 A;  1FDI A;  2MM0 A;  4ARI A;  1PYU B;  2KI8 A;  5D6W A;  4KO8 A;  3TM7 B;  2B63 A;  2A6E D;  3QWZ A;  3GTG A;  2A6H D;  1K83 A;  3O5A A;  1E60 A;  5CD1 A;  5CCX A;  5T5I D;  2G6G A;  1UHE A;  1DMR A;  3IR6 A;  4ARC A;  3QQ8 A;  1KQF A;  2KY9 A;  2PJH B;  4GA5 A;  3H0G A;  4AAY A;  4CRY G;  1I9G A;  1PQE A;  5DYG A;  4GA6 A;  3CF2 A;  1AW8 B;  1PPY A;  1Y4Z A;  2XDP A;  1E32 A;  4AYB A;  3GTM A;  2LW6 A;  3CQZ A;  1Y1V A;  1IW7 D;  2A68 D;  3GTK A;  5C18 A;  4UC4 A;  2Y0S A;  3IR7 A;  5FTJ A;  4NOH A;  5CCB A;  3ZJV A;  2BE5 D;  1PYQ A;  1VC3 B;  2A69 D;  3LGA A;  3OUG A;  5EPP A;  4AOK B;  4AON B;  2PMZ A;  4CS0 A;  2EEO B;  4AZD A;  1EU1 A;  2NVX A;  5FTL A;  2NVY A;  1OGY A;  3ZJT A;  1PQH A;  2C45 A;  5ERG B;  2JIR A;  3BQB A;  4DMR A;  3GTP A;  2VPW A;  5DYI A;  2YVL A;  1S3S A;  5FTM A;  2JA5 A;  2G5D A;  2R93 A;  3QQ7 A;  4KOD A;  1PT0 A;  5GLF A;  3FPR A;  2JIO A;  4D7Z B;  1TWG A;  1WCM A;  2O5J D;  1E18 A;  1G8K A;  2GFA A;  5FTN A;  1CR5 A;  1ZC1 A;  1DMS A;  4KDL A;  1AA6 A;  5D6X A;  1R27 A;  3FPT A;  1QCS A;  1TWF A;  1TMO A;  4CRZ A;  3CZB A;  3FKI A;  2NAP A;  3QC8 A;  3ZGZ A;  1TWA A;  1YNN D;  2VPX A;  1O54 A;  3MB5 A;  3HU2 A;  2PNW A;  2Q18 X;  3HU3 A;  2WB1 A;  1R7R A;  4RV0 A;  2QQS A;  1G8J A;  2CW0 D;  2B25 A;  1H5N A;  2JIQ A;  2V3V A;  3GTQ A;  2E2H A;  2GF7 A;  4FIB A;  5C1B A;  1E61 A;  4KDI A;  1KQG A;  3GTJ A;  1SMY D;  2MM2 A;  2R92 A;  2IV2 X;  1SFO A;  1TWC A;  1Y5I A;  1PQF A;  2Q1D X;  1CZ4 A;  5B6C A;  5D6Y A;  4AS1 A;  2VPZ A;  3IR5 A;  3TIW A;  1E5V A;  1YLE A;  2VPY A;  3FPU A;  2NYA A;  5EQJ B;  5T5M D;  2PI8 A;  4KLN A;  4QIW A;  2JV2 A;  2R7Z A;  3HU1 A;  1TWH A;  2PWY A;  3ZJU A;  1I3Q A;  3LHD A;  4AQ7 A;  2DMR A;  2V45 A;  4CQN A;  1ZYR D;  5FTK A;  2E2I A;  2JA7 A;  2QQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...