1ZC1A

Ufd1 exhibits the aaa-atpase fold with two distinct ubiquitin interaction sites
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
208
structure length
208
Chain Sequence
b'MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin fusion degradation protein 1
publication title Ufd1 Exhibits the AAA-ATPase Fold with Two Distinct Ubiquitin Interaction Sites
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein turnover
total genus 26
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03152 UFD1 Ubiquitin fusion degradation protein UFD1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1zc1A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1zc1A02
5FTMA 3QC8A 1R7RA 1S3SA 1WLFA 4KO8A 5FTLA 2PJHB 5DYGA 5FTKA 2JV2A 3HU2A 4KODA 4RV0A 1CZ4A 3TIWA 3CF2A 1ZC1A 5EPPA 3QQ7A 5B6CA 5C1BA 4KLNA 1CZ5A 4KDLA 4KDIA 5DYIA 1QDNA 3QQ8A 5FTNA 5C18A 2YUJA 3HU1A 3HU3A 5FTJA 1E32A 1QCSA 3QWZA 1CR5A 5GLFA
chains in the Genus database with same CATH superfamily
1PT0A 3SUKA 2R93A 1DMRA 1G8JA 1PQFA 3X2NA 5FTLA 1Y5IA 2PJHB 2B63A 5DYGA 5D6WA 2B25A 2PMZA 2JIRA 1YLEA 2V3VA 2JIOA 4KODA 2YU9A 3GTQA 1N10A 2A68D 3GTOA 1TWAA 3CF2A 1ZC1A 3ML1A 1UHDA 3TM7B 3X2GA 4CRYG 3GTJA 5EPPA 1Y1VA 2R7ZA 3QQ7A 1G8KA 1TMOA 3GTGA 3D30A 3ZGZA 1YNND 1SMYD 1PYUB 2NAPA 1FDIA 3GTKA 2JIPA 2VPYA 2KQAA 5DYIA 2Q1DX 2PNWA 4CS0A 3BQBA 3SULA 3FPTA 1AW8B 3HKZA 5FTNA 3X2JA 4JP6A 2MM0A 2BH0A 5GM9A 3FPRA 2KI8A 2E2HA 3LGAA 1E18A 3ENGA 3O5AA 2E2IA 1TWGA 5FTMA 3QC8A 1R7RA 5CD1A 2E7ZA 1VC3B 1WLFA 2C45A 4KO8A 4DMRA 4D7ZB 1E61A 5T5ID 2NVXA 5FTKA 1H5NA 4FG2A 2VPZA 2PICA 2VPXA 3SUMA 1Y1WA 4AS1A 4JS7A 4ZM7A 2QQRA 1H0HA 1Y4ZA 2QQSA 1K83A 5D6XA 2G5DA 1O54A 1EU1A 1PT1A 2AE0X 3ZJVA 2VPWA 2HCZX 1IW7D 4ARIA 4ENGA 1R9TA 1E5VA 2DMRA 4KDIA 4JP7A 4FFTA 4AYBA 2EEOB 4AOKB 3IR7A 2GAEA 4C2MA 5C18A 2YUJA 3HU1A 4QIWA 1HD5A 2A6HD 1QCSA 4AVRA 1I9GA 3FPUA 1CR5A 5GLXA 3MB5A 4GA6A 4CRZA 2R92A 1TWFA 2NVYA 2GF7A 2IV2X 5CCXA 1S3SA 4NOHA 3GTLA 4AONB 2MM2A 3LHDA 2JA7A 2JIQA 2LW6A 3ZJUA 2NYAA 4AZDA 3X2OA 4RV0A 2WAQA 3FKIA 5EQJB 4L48A 1BW4A 1L8FA 2CW0D 5T5MD 2ENGA 3GTPA 3ZJTA 5C1BA 2VUMA 5CCBA 1CZ5A 3IR6A 4KDLA 3X2LA 3QWZA 1KQFA 1ZYRD 1QDNA 3QQ8A 2Q1CX 4AQ7A 1PQHA 2A6ED 2PJJA 2WB1A 3CZBA 2Q18X 1OA7A 2Y0SA 3X2MA 1E32A 1AA6A 1SFOA 2O5JD 2GFAA 4UC4A 3H0GA 3M3GA 2KY9A 1PYQA 1BW3A 2XDPA 4JJOA 2JA5A 3IR5A 1I50A 2YVLA 1SIWA 1OGYA 1PPYA 1FDOA 1R27A 3OUGA 2JV2A 5ERGB 3PLXB 1YNJD 2BE5D 1TWHA 2JIMA 3HU2A 1CZ4A 3TIWA 1E60A 4GA5A 3SUJA 1PQEA 2G6GA 4CQNA 3X2IA 4FIBA 1Q16A 1UHEA 2V45A 5B6CA 1TWCA 3GTMA 2PWYA 5D6YA 4ARCA 3CQZA 5H4UA 2JA6A 3X2KA 4KLNA 2Q19X 4FG4A 2A69D 4AAYA 3X2PA 1WCMA 1WC2A 1I3QA 2Q1AX 4JCWA 3DMRA 1DMSA 3HU3A 5FTJA 5GLYA 2PI8A 3X2HA 1KQGA 1OA9A 4FERA 5GLFA
chains in the Genus database with same CATH topology
1PT0A 2R93A 1DMRA 1G8JA 1PQFA 5FTLA 1Y5IA 2PJHB 2B63A 5DYGA 5D6WA 2B25A 2PMZA 2JIRA 1YLEA 2V3VA 2JIOA 4KODA 2YU9A 3GTQA 2A68D 3GTOA 1TWAA 3CF2A 1ZC1A 3ML1A 1UHDA 3TM7B 4CRYG 3GTJA 5EPPA 1Y1VA 2R7ZA 3QQ7A 1G8KA 1TMOA 3GTGA 3ZGZA 1YNND 1SMYD 1PYUB 2NAPA 1FDIA 3GTKA 2JIPA 2VPYA 5DYIA 2Q1DX 2PNWA 4CS0A 3BQBA 3FPTA 1AW8B 3HKZA 5FTNA 2MM0A 3FPRA 2KI8A 2E2HA 3LGAA 1E18A 3O5AA 2E2IA 1TWGA 5FTMA 3QC8A 1R7RA 5CD1A 2E7ZA 1VC3B 1WLFA 2C45A 4KO8A 4DMRA 4D7ZB 1E61A 5T5ID 2NVXA 5FTKA 1H5NA 2VPZA 2PICA 2VPXA 1Y1WA 4AS1A 2QQRA 1H0HA 1Y4ZA 2QQSA 1K83A 5D6XA 2G5DA 1O54A 1EU1A 1PT1A 2AE0X 3ZJVA 2VPWA 1IW7D 4ARIA 1R9TA 1E5VA 2DMRA 4KDIA 4AYBA 2EEOB 4AOKB 3IR7A 2GAEA 4C2MA 5C18A 2YUJA 3HU1A 4QIWA 2A6HD 1QCSA 1I9GA 3FPUA 1CR5A 3MB5A 4GA6A 4CRZA 2R92A 1TWFA 2NVYA 2GF7A 2IV2X 5CCXA 1S3SA 4NOHA 3GTLA 4AONB 2MM2A 3LHDA 2JA7A 2JIQA 2LW6A 3ZJUA 2NYAA 4AZDA 4RV0A 2WAQA 3FKIA 5EQJB 2CW0D 5T5MD 3GTPA 3ZJTA 5C1BA 2VUMA 5CCBA 1CZ5A 3IR6A 4KDLA 1KQFA 1ZYRD 1QDNA 3QQ8A 2Q1CX 4AQ7A 1PQHA 2A6ED 2PJJA 2WB1A 3CZBA 2Q18X 2Y0SA 1E32A 1AA6A 1SFOA 2O5JD 2GFAA 4UC4A 3H0GA 2KY9A 1PYQA 2XDPA 2JA5A 3IR5A 1I50A 2YVLA 1SIWA 1OGYA 1PPYA 1FDOA 1R27A 3OUGA 2JV2A 5ERGB 3PLXB 1YNJD 2BE5D 1TWHA 2JIMA 3HU2A 1CZ4A 3TIWA 1E60A 4GA5A 1PQEA 2G6GA 4CQNA 4FIBA 1Q16A 1UHEA 2V45A 5B6CA 1TWCA 3GTMA 2PWYA 5D6YA 4ARCA 3CQZA 2JA6A 4KLNA 2Q19X 2A69D 4AAYA 1WCMA 1I3QA 2Q1AX 3DMRA 1DMSA 3HU3A 5FTJA 1KQGA 2PI8A 3QWZA 5GLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTM A;  3QC8 A;  1R7R A;  1S3S A;  1WLF A;  4KO8 A;  5FTL A;  2PJH B;  5DYG A;  5FTK A;  2JV2 A;  3HU2 A;  4KOD A;  4RV0 A;  1CZ4 A;  3TIW A;  3CF2 A;  1ZC1 A;  5EPP A;  3QQ7 A;  5B6C A;  5C1B A;  4KLN A;  1CZ5 A;  4KDL A;  4KDI A;  5DYI A;  1QDN A;  3QQ8 A;  5FTN A;  5C18 A;  2YUJ A;  3HU1 A;  3HU3 A;  5FTJ A;  1E32 A;  1QCS A;  3QWZ A;  1CR5 A;  5GLF A; 
#chains in the Genus database with same CATH topology
 1PT0 A;  3SUK A;  2R93 A;  1DMR A;  1G8J A;  1PQF A;  3X2N A;  5FTL A;  1Y5I A;  2PJH B;  2B63 A;  5DYG A;  5D6W A;  2B25 A;  2PMZ A;  2JIR A;  1YLE A;  2V3V A;  2JIO A;  4KOD A;  2YU9 A;  3GTQ A;  1N10 A;  2A68 D;  3GTO A;  1TWA A;  3CF2 A;  1ZC1 A;  3ML1 A;  1UHD A;  3TM7 B;  3X2G A;  4CRY G;  3GTJ A;  5EPP A;  1Y1V A;  2R7Z A;  3QQ7 A;  1G8K A;  1TMO A;  3GTG A;  3D30 A;  3ZGZ A;  1YNN D;  1SMY D;  1PYU B;  2NAP A;  1FDI A;  3GTK A;  2JIP A;  2VPY A;  2KQA A;  5DYI A;  2Q1D X;  2PNW A;  4CS0 A;  3BQB A;  3SUL A;  3FPT A;  1AW8 B;  3HKZ A;  5FTN A;  3X2J A;  4JP6 A;  2MM0 A;  2BH0 A;  5GM9 A;  3FPR A;  2KI8 A;  2E2H A;  3LGA A;  1E18 A;  3ENG A;  3O5A A;  2E2I A;  1TWG A;  5FTM A;  3QC8 A;  1R7R A;  5CD1 A;  2E7Z A;  1VC3 B;  1WLF A;  2C45 A;  4KO8 A;  4DMR A;  4D7Z B;  1E61 A;  5T5I D;  2NVX A;  5FTK A;  1H5N A;  4FG2 A;  2VPZ A;  2PIC A;  2VPX A;  3SUM A;  1Y1W A;  4AS1 A;  4JS7 A;  4ZM7 A;  2QQR A;  1H0H A;  1Y4Z A;  2QQS A;  1K83 A;  5D6X A;  2G5D A;  1O54 A;  1EU1 A;  1PT1 A;  2AE0 X;  3ZJV A;  2VPW A;  2HCZ X;  1IW7 D;  4ARI A;  4ENG A;  1R9T A;  1E5V A;  2DMR A;  4KDI A;  4JP7 A;  4FFT A;  4AYB A;  2EEO B;  4AOK B;  3IR7 A;  2GAE A;  4C2M A;  5C18 A;  2YUJ A;  3HU1 A;  4QIW A;  1HD5 A;  2A6H D;  1QCS A;  4AVR A;  1I9G A;  3FPU A;  1CR5 A;  5GLX A;  3MB5 A;  4GA6 A;  4CRZ A;  2R92 A;  1TWF A;  2NVY A;  2GF7 A;  2IV2 X;  5CCX A;  1S3S A;  4NOH A;  3GTL A;  4AON B;  2MM2 A;  3LHD A;  2JA7 A;  2JIQ A;  2LW6 A;  3ZJU A;  2NYA A;  4AZD A;  3X2O A;  4RV0 A;  2WAQ A;  3FKI A;  5EQJ B;  4L48 A;  1BW4 A;  1L8F A;  2CW0 D;  5T5M D;  2ENG A;  3GTP A;  3ZJT A;  5C1B A;  2VUM A;  5CCB A;  1CZ5 A;  3IR6 A;  4KDL A;  3X2L A;  3QWZ A;  1KQF A;  1ZYR D;  1QDN A;  3QQ8 A;  2Q1C X;  4AQ7 A;  1PQH A;  2A6E D;  2PJJ A;  2WB1 A;  3CZB A;  2Q18 X;  1OA7 A;  2Y0S A;  3X2M A;  1E32 A;  1AA6 A;  1SFO A;  2O5J D;  2GFA A;  4UC4 A;  3H0G A;  3M3G A;  2KY9 A;  1PYQ A;  1BW3 A;  2XDP A;  4JJO A;  2JA5 A;  3IR5 A;  1I50 A;  2YVL A;  1SIW A;  1OGY A;  1PPY A;  1FDO A;  1R27 A;  3OUG A;  2JV2 A;  5ERG B;  3PLX B;  1YNJ D;  2BE5 D;  1TWH A;  2JIM A;  3HU2 A;  1CZ4 A;  3TIW A;  1E60 A;  4GA5 A;  3SUJ A;  1PQE A;  2G6G A;  4CQN A;  3X2I A;  4FIB A;  1Q16 A;  1UHE A;  2V45 A;  5B6C A;  1TWC A;  3GTM A;  2PWY A;  5D6Y A;  4ARC A;  3CQZ A;  5H4U A;  2JA6 A;  3X2K A;  4KLN A;  2Q19 X;  4FG4 A;  2A69 D;  4AAY A;  3X2P A;  1WCM A;  1WC2 A;  1I3Q A;  2Q1A X;  4JCW A;  3DMR A;  1DMS A;  3HU3 A;  5FTJ A;  5GLY A;  2PI8 A;  3X2H A;  1KQG A;  1OA9 A;  4FER A;  5GLF A; 
#chains in the Genus database with same CATH homology
 1PT0 A;  2R93 A;  1DMR A;  1G8J A;  1PQF A;  5FTL A;  1Y5I A;  2PJH B;  2B63 A;  5DYG A;  5D6W A;  2B25 A;  2PMZ A;  2JIR A;  1YLE A;  2V3V A;  2JIO A;  4KOD A;  2YU9 A;  3GTQ A;  2A68 D;  3GTO A;  1TWA A;  3CF2 A;  1ZC1 A;  3ML1 A;  1UHD A;  3TM7 B;  4CRY G;  3GTJ A;  5EPP A;  1Y1V A;  2R7Z A;  3QQ7 A;  1G8K A;  1TMO A;  3GTG A;  3ZGZ A;  1YNN D;  1SMY D;  1PYU B;  2NAP A;  1FDI A;  3GTK A;  2JIP A;  2VPY A;  5DYI A;  2Q1D X;  2PNW A;  4CS0 A;  3BQB A;  3FPT A;  1AW8 B;  3HKZ A;  5FTN A;  2MM0 A;  3FPR A;  2KI8 A;  2E2H A;  3LGA A;  1E18 A;  3O5A A;  2E2I A;  1TWG A;  5FTM A;  3QC8 A;  1R7R A;  5CD1 A;  2E7Z A;  1VC3 B;  1WLF A;  2C45 A;  4KO8 A;  4DMR A;  4D7Z B;  1E61 A;  5T5I D;  2NVX A;  5FTK A;  1H5N A;  2VPZ A;  2PIC A;  2VPX A;  1Y1W A;  4AS1 A;  2QQR A;  1H0H A;  1Y4Z A;  2QQS A;  1K83 A;  5D6X A;  2G5D A;  1O54 A;  1EU1 A;  1PT1 A;  2AE0 X;  3ZJV A;  2VPW A;  1IW7 D;  4ARI A;  1R9T A;  1E5V A;  2DMR A;  4KDI A;  4AYB A;  2EEO B;  4AOK B;  3IR7 A;  2GAE A;  4C2M A;  5C18 A;  2YUJ A;  3HU1 A;  4QIW A;  2A6H D;  1QCS A;  1I9G A;  3FPU A;  1CR5 A;  3MB5 A;  4GA6 A;  4CRZ A;  2R92 A;  1TWF A;  2NVY A;  2GF7 A;  2IV2 X;  5CCX A;  1S3S A;  4NOH A;  3GTL A;  4AON B;  2MM2 A;  3LHD A;  2JA7 A;  2JIQ A;  2LW6 A;  3ZJU A;  2NYA A;  4AZD A;  4RV0 A;  2WAQ A;  3FKI A;  5EQJ B;  2CW0 D;  5T5M D;  3GTP A;  3ZJT A;  5C1B A;  2VUM A;  5CCB A;  1CZ5 A;  3IR6 A;  4KDL A;  1KQF A;  1ZYR D;  1QDN A;  3QQ8 A;  2Q1C X;  4AQ7 A;  1PQH A;  2A6E D;  2PJJ A;  2WB1 A;  3CZB A;  2Q18 X;  2Y0S A;  1E32 A;  1AA6 A;  1SFO A;  2O5J D;  2GFA A;  4UC4 A;  3H0G A;  2KY9 A;  1PYQ A;  2XDP A;  2JA5 A;  3IR5 A;  1I50 A;  2YVL A;  1SIW A;  1OGY A;  1PPY A;  1FDO A;  1R27 A;  3OUG A;  2JV2 A;  5ERG B;  3PLX B;  1YNJ D;  2BE5 D;  1TWH A;  2JIM A;  3HU2 A;  1CZ4 A;  3TIW A;  1E60 A;  4GA5 A;  1PQE A;  2G6G A;  4CQN A;  4FIB A;  1Q16 A;  1UHE A;  2V45 A;  5B6C A;  1TWC A;  3GTM A;  2PWY A;  5D6Y A;  4ARC A;  3CQZ A;  2JA6 A;  4KLN A;  2Q19 X;  2A69 D;  4AAY A;  1WCM A;  1I3Q A;  2Q1A X;  3DMR A;  1DMS A;  3HU3 A;  5FTJ A;  1KQG A;  2PI8 A;  3QWZ A;  5GLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...