1ZC1A

Ufd1 exhibits the aaa-atpase fold with two distinct ubiquitin interaction sites
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
208
structure length
208
Chain Sequence
MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein turnover
molecule keywords Ubiquitin fusion degradation protein 1
publication title Ufd1 Exhibits the AAA-ATPase Fold with Two Distinct Ubiquitin Interaction Sites
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03152 UFD1 Ubiquitin fusion degradation protein UFD1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.50 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1zc1A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1zc1A02
1ZC1A 5C18A 1R7RA 2JV2A 3HU2A 5FTKA 5FTMA 1E32A 5FTJA 1S3SA 3HU3A 5EPPA 3TIWA 3CF2A 5FTNA 4KDIA 1QCSA 1CZ4A 5B6CA 2PJHB 3QWZA 5DYIA 1WLFA 3QC8A 4KO8A 2YUJA 3QQ7A 1CZ5A 5GLFA 3HU1A 3QQ8A 5FTLA 1CR5A 4KLNA 5C1BA 5DYGA 4KDLA 1QDNA 4RV0A 4KODA
chains in the Genus database with same CATH superfamily
3BQBA 5D6YA 1ZC1A 2NYAA 3GTLA 2V45A 1E18A 2XDPA 3ZJVA 2KY9A 5FTJA 4FFTA 1UHDA 1SFOA 4FERA 5EPPA 1YNND 3GTKA 3X2PA 1K83A 3GTQA 3TIWA 2R7ZA 2NVXA 1Y1WA 1R9TA 1G8KA 4D7ZB 1AA6A 3ZJUA 4ARCA 4CS0A 1E61A 2B25A 1FDIA 3GTJA 3X2OA 1DMSA 3QC8A 4ARIA 1OGYA 1PT0A 3GTMA 3H0GA 3X2GA 3X2NA 3X2IA 2EEOB 2JA6A 4AQ7A 1CR5A 1O54A 2BE5D 4KLNA 3SUMA 5DYGA 3CZBA 2KI8A 2PJJA 1E60A 4AZDA 1Y4ZA 4CRYG 1FDOA 2A6ED 4RV0A 3IR5A 1OA7A 3CQZA 3SULA 3GTPA 5GM9A 4AYBA 2VPXA 1TWAA 1KQFA 5C18A 3X2HA 2Q19X 2JIMA 1TWGA 5FTMA 2G6GA 2JIQA 4AVRA 2MM0A 1E32A 2QQSA 3ZJTA 3ZGZA 1G8JA 1S3SA 3SUJA 2O5JD 3IR7A 5CCXA 1PYUB 2HCZX 4GA6A 4FIBA 3TM7B 1EU1A 4KDIA 5CD1A 1OA9A 2IV2X 5B6CA 2PJHB 1WC2A 4AS1A 2WAQA 1TWFA 5DYIA 1CZ5A 5T5MD 1AW8B 1L8FA 1Q16A 5GLFA 2G5DA 3HU1A 1I9GA 3PLXB 2JA5A 1TWHA 2Q1CX 2Q1DX 2ENGA 2WB1A 1PQFA 3X2JA 4C2MA 5C1BA 4AONB 2Q1AX 2AE0X 4QIWA 5GLYA 5H4UA 1PPYA 1PYQA 1QDNA 2A6HD 4FG4A 2VUMA 3LGAA 1DMRA 4FG2A 3X2LA 3HKZA 4GA5A 1WCMA 1YNJD 1R7RA 4AAYA 2JV2A 5FTKA 2PWYA 5D6XA 2R93A 2JA7A 1Y1VA 2PNWA 2V3VA 5D6WA 2VPYA 4JP6A 3HU3A 1N10A 2MM2A 1Y5IA 1KQGA 3X2MA 1CZ4A 2PMZA 3QWZA 2YU9A 1H5NA 2GAEA 3FKIA 5ERGB 2BH0A 4KO8A 3X2KA 3QQ7A 1VC3B 1ZYRD 1TMOA 4CQNA 5GLXA 3FPUA 2CW0D 3LHDA 2NAPA 2E2IA 1SMYD 2C45A 1PT1A 2PI8A 5FTLA 2JIPA 3DMRA 2KQAA 4NOHA 3FPRA 2E7ZA 1UHEA 4JJOA 2PICA 3ENGA 2NVYA 4KODA 2JIRA 2GFAA 5EQJB 4DMRA 3GTOA 4JCWA 2GF7A 3IR6A 3HU2A 5T5ID 2E2HA 1BW3A 3MB5A 1TWCA 3FPTA 1I50A 1H0HA 1PQEA 2A69D 2DMRA 4ZM7A 4UC4A 2A68D 5CCBA 2R92A 4ENGA 3GTGA 3CF2A 4JS7A 2YVLA 1YLEA 5FTNA 1SIWA 1I3QA 1QCSA 4CRZA 3O5AA 1WLFA 1HD5A 2YUJA 3OUGA 2Q18X 3D30A 2QQRA 2VPZA 2JIOA 4AOKB 3QQ8A 4L48A 1BW4A 2VPWA 1PQHA 3M3GA 3SUKA 3ML1A 4KDLA 1R27A 1E5VA 2B63A 1IW7D 2LW6A 4JP7A 2Y0SA
chains in the Genus database with same CATH topology
3BQBA 5D6YA 1ZC1A 2NYAA 3GTLA 2V45A 1E18A 2XDPA 3ZJVA 2KY9A 5FTJA 1UHDA 1SFOA 5EPPA 1YNND 3GTKA 1K83A 2NVXA 3GTQA 3TIWA 2R7ZA 1Y1WA 4ARCA 1R9TA 1G8KA 4D7ZB 1AA6A 3ZJUA 4CS0A 1E61A 2B25A 1FDIA 3GTJA 1DMSA 3QC8A 4ARIA 1OGYA 1PT0A 3GTMA 3H0GA 2EEOB 2JA6A 4AQ7A 1CR5A 1O54A 2BE5D 4KLNA 4AZDA 5DYGA 3CZBA 2KI8A 2PJJA 1E60A 4CRYG 1Y4ZA 1FDOA 2A6ED 4RV0A 3IR5A 3CQZA 3GTPA 4AYBA 2VPXA 1TWAA 1KQFA 5C18A 2Q19X 2JIMA 1TWGA 5FTMA 2G6GA 2JIQA 2MM0A 1E32A 2QQSA 3ZJTA 3ZGZA 1G8JA 1S3SA 2O5JD 3IR7A 5CCXA 1PYUB 4GA6A 4FIBA 3TM7B 1EU1A 4KDIA 5CD1A 2IV2X 5B6CA 2PJHB 4AS1A 2WAQA 1TWFA 5DYIA 1CZ5A 5T5MD 1AW8B 5GLFA 1Q16A 2Q1CX 2G5DA 3HU1A 1I9GA 3PLXB 2JA5A 1TWHA 2Q1DX 2WB1A 4C2MA 1PQFA 5C1BA 4AONB 2Q1AX 2AE0X 4QIWA 1PPYA 1PYQA 1QDNA 2A6HD 2VUMA 3LGAA 1DMRA 3HKZA 4GA5A 1WCMA 1YNJD 1R7RA 4AAYA 2JV2A 5FTKA 2PWYA 5D6XA 2R93A 2JA7A 1Y1VA 2PNWA 2V3VA 5D6WA 2VPYA 3HU3A 2MM2A 1Y5IA 1KQGA 1CZ4A 2PMZA 3QWZA 2YU9A 1H5NA 2GAEA 3FKIA 5ERGB 4KO8A 3QQ7A 1VC3B 1ZYRD 1TMOA 4CQNA 3FPUA 2CW0D 3LHDA 2NAPA 2E2IA 1SMYD 2C45A 1PT1A 2PI8A 5FTLA 2JIPA 3DMRA 4NOHA 3FPRA 2E7ZA 1UHEA 2PICA 2NVYA 4KODA 2JIRA 2GFAA 5EQJB 4DMRA 3GTOA 2GF7A 3IR6A 3HU2A 5T5ID 2E2HA 3MB5A 1TWCA 3FPTA 1I50A 1H0HA 1PQEA 2A69D 2DMRA 5CCBA 4UC4A 2A68D 2R92A 3GTGA 3CF2A 2YVLA 1YLEA 5FTNA 1SIWA 1I3QA 1QCSA 4CRZA 3O5AA 1WLFA 2YUJA 3OUGA 2Q18X 2QQRA 2VPZA 2JIOA 4AOKB 3QQ8A 2VPWA 1PQHA 3ML1A 4KDLA 1R27A 1E5VA 2B63A 1IW7D 2LW6A 2Y0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC1 A;  5C18 A;  1R7R A;  2JV2 A;  3HU2 A;  5FTK A;  5FTM A;  1E32 A;  5FTJ A;  1S3S A;  3HU3 A;  5EPP A;  3TIW A;  3CF2 A;  5FTN A;  4KDI A;  1QCS A;  1CZ4 A;  5B6C A;  2PJH B;  3QWZ A;  5DYI A;  1WLF A;  3QC8 A;  4KO8 A;  2YUJ A;  3QQ7 A;  1CZ5 A;  5GLF A;  3HU1 A;  3QQ8 A;  5FTL A;  1CR5 A;  4KLN A;  5C1B A;  5DYG A;  4KDL A;  1QDN A;  4RV0 A;  4KOD A; 
#chains in the Genus database with same CATH topology
 3BQB A;  5D6Y A;  1ZC1 A;  2NYA A;  3GTL A;  2V45 A;  1E18 A;  2XDP A;  3ZJV A;  2KY9 A;  5FTJ A;  4FFT A;  1UHD A;  1SFO A;  4FER A;  5EPP A;  1YNN D;  3GTK A;  3X2P A;  1K83 A;  3GTQ A;  3TIW A;  2R7Z A;  2NVX A;  1Y1W A;  1R9T A;  1G8K A;  4D7Z B;  1AA6 A;  3ZJU A;  4ARC A;  4CS0 A;  1E61 A;  2B25 A;  1FDI A;  3GTJ A;  3X2O A;  1DMS A;  3QC8 A;  4ARI A;  1OGY A;  1PT0 A;  3GTM A;  3H0G A;  3X2G A;  3X2N A;  3X2I A;  2EEO B;  2JA6 A;  4AQ7 A;  1CR5 A;  1O54 A;  2BE5 D;  4KLN A;  3SUM A;  5DYG A;  3CZB A;  2KI8 A;  2PJJ A;  1E60 A;  4AZD A;  1Y4Z A;  4CRY G;  1FDO A;  2A6E D;  4RV0 A;  3IR5 A;  1OA7 A;  3CQZ A;  3SUL A;  3GTP A;  5GM9 A;  4AYB A;  2VPX A;  1TWA A;  1KQF A;  5C18 A;  3X2H A;  2Q19 X;  2JIM A;  1TWG A;  5FTM A;  2G6G A;  2JIQ A;  4AVR A;  2MM0 A;  1E32 A;  2QQS A;  3ZJT A;  3ZGZ A;  1G8J A;  1S3S A;  3SUJ A;  2O5J D;  3IR7 A;  5CCX A;  1PYU B;  2HCZ X;  4GA6 A;  4FIB A;  3TM7 B;  1EU1 A;  4KDI A;  5CD1 A;  1OA9 A;  2IV2 X;  5B6C A;  2PJH B;  1WC2 A;  4AS1 A;  2WAQ A;  1TWF A;  5DYI A;  1CZ5 A;  5T5M D;  1AW8 B;  1L8F A;  1Q16 A;  5GLF A;  2G5D A;  3HU1 A;  1I9G A;  3PLX B;  2JA5 A;  1TWH A;  2Q1C X;  2Q1D X;  2ENG A;  2WB1 A;  1PQF A;  3X2J A;  4C2M A;  5C1B A;  4AON B;  2Q1A X;  2AE0 X;  4QIW A;  5GLY A;  5H4U A;  1PPY A;  1PYQ A;  1QDN A;  2A6H D;  4FG4 A;  2VUM A;  3LGA A;  1DMR A;  4FG2 A;  3X2L A;  3HKZ A;  4GA5 A;  1WCM A;  1YNJ D;  1R7R A;  4AAY A;  2JV2 A;  5FTK A;  2PWY A;  5D6X A;  2R93 A;  2JA7 A;  1Y1V A;  2PNW A;  2V3V A;  5D6W A;  2VPY A;  4JP6 A;  3HU3 A;  1N10 A;  2MM2 A;  1Y5I A;  1KQG A;  3X2M A;  1CZ4 A;  2PMZ A;  3QWZ A;  2YU9 A;  1H5N A;  2GAE A;  3FKI A;  5ERG B;  2BH0 A;  4KO8 A;  3X2K A;  3QQ7 A;  1VC3 B;  1ZYR D;  1TMO A;  4CQN A;  5GLX A;  3FPU A;  2CW0 D;  3LHD A;  2NAP A;  2E2I A;  1SMY D;  2C45 A;  1PT1 A;  2PI8 A;  5FTL A;  2JIP A;  3DMR A;  2KQA A;  4NOH A;  3FPR A;  2E7Z A;  1UHE A;  4JJO A;  2PIC A;  3ENG A;  2NVY A;  4KOD A;  2JIR A;  2GFA A;  5EQJ B;  4DMR A;  3GTO A;  4JCW A;  2GF7 A;  3IR6 A;  3HU2 A;  5T5I D;  2E2H A;  1BW3 A;  3MB5 A;  1TWC A;  3FPT A;  1I50 A;  1H0H A;  1PQE A;  2A69 D;  2DMR A;  4ZM7 A;  4UC4 A;  2A68 D;  5CCB A;  2R92 A;  4ENG A;  3GTG A;  3CF2 A;  4JS7 A;  2YVL A;  1YLE A;  5FTN A;  1SIW A;  1I3Q A;  1QCS A;  4CRZ A;  3O5A A;  1WLF A;  1HD5 A;  2YUJ A;  3OUG A;  2Q18 X;  3D30 A;  2QQR A;  2VPZ A;  2JIO A;  4AOK B;  3QQ8 A;  4L48 A;  1BW4 A;  2VPW A;  1PQH A;  3M3G A;  3SUK A;  3ML1 A;  4KDL A;  1R27 A;  1E5V A;  2B63 A;  1IW7 D;  2LW6 A;  4JP7 A;  2Y0S A; 
#chains in the Genus database with same CATH homology
 3BQB A;  5D6Y A;  1ZC1 A;  2NYA A;  3GTL A;  2V45 A;  1E18 A;  2XDP A;  3ZJV A;  2KY9 A;  5FTJ A;  1UHD A;  1SFO A;  5EPP A;  1YNN D;  3GTK A;  1K83 A;  2NVX A;  3GTQ A;  3TIW A;  2R7Z A;  1Y1W A;  4ARC A;  1R9T A;  1G8K A;  4D7Z B;  1AA6 A;  3ZJU A;  4CS0 A;  1E61 A;  2B25 A;  1FDI A;  3GTJ A;  1DMS A;  3QC8 A;  4ARI A;  1OGY A;  1PT0 A;  3GTM A;  3H0G A;  2EEO B;  2JA6 A;  4AQ7 A;  1CR5 A;  1O54 A;  2BE5 D;  4KLN A;  4AZD A;  5DYG A;  3CZB A;  2KI8 A;  2PJJ A;  1E60 A;  4CRY G;  1Y4Z A;  1FDO A;  2A6E D;  4RV0 A;  3IR5 A;  3CQZ A;  3GTP A;  4AYB A;  2VPX A;  1TWA A;  1KQF A;  5C18 A;  2Q19 X;  2JIM A;  1TWG A;  5FTM A;  2G6G A;  2JIQ A;  2MM0 A;  1E32 A;  2QQS A;  3ZJT A;  3ZGZ A;  1G8J A;  1S3S A;  2O5J D;  3IR7 A;  5CCX A;  1PYU B;  4GA6 A;  4FIB A;  3TM7 B;  1EU1 A;  4KDI A;  5CD1 A;  2IV2 X;  5B6C A;  2PJH B;  4AS1 A;  2WAQ A;  1TWF A;  5DYI A;  1CZ5 A;  5T5M D;  1AW8 B;  5GLF A;  1Q16 A;  2Q1C X;  2G5D A;  3HU1 A;  1I9G A;  3PLX B;  2JA5 A;  1TWH A;  2Q1D X;  2WB1 A;  4C2M A;  1PQF A;  5C1B A;  4AON B;  2Q1A X;  2AE0 X;  4QIW A;  1PPY A;  1PYQ A;  1QDN A;  2A6H D;  2VUM A;  3LGA A;  1DMR A;  3HKZ A;  4GA5 A;  1WCM A;  1YNJ D;  1R7R A;  4AAY A;  2JV2 A;  5FTK A;  2PWY A;  5D6X A;  2R93 A;  2JA7 A;  1Y1V A;  2PNW A;  2V3V A;  5D6W A;  2VPY A;  3HU3 A;  2MM2 A;  1Y5I A;  1KQG A;  1CZ4 A;  2PMZ A;  3QWZ A;  2YU9 A;  1H5N A;  2GAE A;  3FKI A;  5ERG B;  4KO8 A;  3QQ7 A;  1VC3 B;  1ZYR D;  1TMO A;  4CQN A;  3FPU A;  2CW0 D;  3LHD A;  2NAP A;  2E2I A;  1SMY D;  2C45 A;  1PT1 A;  2PI8 A;  5FTL A;  2JIP A;  3DMR A;  4NOH A;  3FPR A;  2E7Z A;  1UHE A;  2PIC A;  2NVY A;  4KOD A;  2JIR A;  2GFA A;  5EQJ B;  4DMR A;  3GTO A;  2GF7 A;  3IR6 A;  3HU2 A;  5T5I D;  2E2H A;  3MB5 A;  1TWC A;  3FPT A;  1I50 A;  1H0H A;  1PQE A;  2A69 D;  2DMR A;  5CCB A;  4UC4 A;  2A68 D;  2R92 A;  3GTG A;  3CF2 A;  2YVL A;  1YLE A;  5FTN A;  1SIW A;  1I3Q A;  1QCS A;  4CRZ A;  3O5A A;  1WLF A;  2YUJ A;  3OUG A;  2Q18 X;  2QQR A;  2VPZ A;  2JIO A;  4AOK B;  3QQ8 A;  2VPW A;  1PQH A;  3ML1 A;  4KDL A;  1R27 A;  1E5V A;  2B63 A;  1IW7 D;  2LW6 A;  2Y0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...