2GF7A

Double tudor domain structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gf7A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gf7A02
2JTFA 4ZTJA 2EQUA 4L59A 5C6SA 3OYMA 5J26A 2BKDN 4E7JA 2LVMA 2EQJA 2EKOA 4IURA 3LYIA 3MEVA 2JZ2A 1N27A 2LCCA 2VYTA 2RHIA 2X4YA 3E9GA 4GY5A 5D6YA 3OA6A 3F70A 5KCOA 4A4HA 3UT1A 3DLMA 3OMGA 2DIQA 3OYFA 2QQSA 2R57A 4UC4A 3L2WA 3PFSA 4FL6A 3OB9A 3UWNA 2K3YA 4N4HA 3OYAA 4RG2A 3LGFA 2E6NA 5KCHA 3OYGA 2O4XA 3MO8A 3PMTA 3OYHA 3OYIA 3META 2LRQA 3MP6A 2DIGA 1OYXA 2CKKA 5FROA 4BE0A 4IKFA 3NTHA 2XDPA 4BACA 2RJEA 2LDMA 2R58A 3OS0A 3OS1A 3NTIA 4HCZA 4IUTA 3QIIA 2O4XB 4N4IA 4A4GA 4QVZA 3OQ5A 3OY9A 3CEYA 4E7KA 2HQEA 3MP1A 4PLIA 5IN1A 2RJFA 4PLLA 2L8DA 2LTOA 5M9OA 1H3ZA 4C5HA 3FEOA 3ASKA 2HQXA 1WJRA 3PNWC 3GOXA 5FRNA 3LH0A 2B8AA 3MP8A 2BIVA 2EQKA 3BDLA 4A4FA 4A4EA 2EFIA 3E9FA 3ZEHA 4QQGA 2RI2A 3MEWA 3QKJA 2RJDA 5D6WA 2DAQA 4E7HA 1G5VA 3DB3A 3FC3A 2M16A 3L2QA 3H8ZA 5C0MA 2K3XA 1OZ3A 1OI1A 3OYDA 2NLUA 2XK0A 2BUDA 2P0KA 3M9QA 3MEAA 3QJ6A 4II1A 4QW2A 2EQMA 1SSFA 4BDYA 3LLRA 4BD3A 4ZTFA 2FHDA 3H6ZA 2RHZA 4BE1A 4PL6A 2YRVA 5D6XA 2RHUA 4IUPA 3S3MA 3FDRA 3OMCA 2RHXA 3OYBA 2X35A 3OYKA 3S6WA 1WGSA 4C5EA 3L2UA 3EAEA 1WJSA 4N4GA 3FLGA 4IUQA 4NS5A 3OYNA 1MHNA 3OYEA 4Q5WA 5KE3A 3L2RA 5KH6A 3O8VA 2RI3A 4BE2A 4Z02A 2X4XA 2M1HA 4E7IA 4EDUA 2GF7A 2X4WA 2G3RA 2GFUA 3L42A 3S3OA 2IG0A 4B9XA 1KHCA 3OS2A 3C4SA 4QQDA 2RI5A 5KE2A 3OYCA 5J39A 2L89A 4C5IA 2R5AA 4IUUA 3SD4A 3QBYA 4FU6A 2E5QA 2F5KA 2MWPA 1XNIA 3LX7A 4IUVA 3OYLA 3OYJA 2RHYA 3Q1JA 4X34A 2R5MA 3ME9A 5FRMA 4LD6A 2M0OA 3KUFA 5CIUA 4E7LA 2QQRA 3P8DA 2RJCA 1WJQA 2MWOA 3MEUA 4OVAA 3NTKA 4C5GA 3L2VA 3S3NA 5IAYA 2D9TA 3PMIA 2PQWA 3DB4A 4BDZA 2GFAA 4QQ6A 2WACA 2RO0A 1OZ2A 4B9WA 4CRIA 3LGLA 3P8HA 2L3RA 1RI0A
chains in the Genus database with same CATH superfamily
2ENMA 4IURA 1GCPA 3E9GA 3T9NA 5GLFA 3ER0A 4LDYA 2R57A 1SHFA 1X2KA 2CS7A 4XTXA 5L8RE 1VQKQ 1IGUA 2YWWA 1QP3A 5CKFA 1I8FA 1JBMA 3CCMQ 4D8KA 3M0TA 2EAYA 5HK0A 3INZA 2W0ZA 4PLLA 1UGSB 2LTOA 4TVRA 2XICA 1IXDA 3CCVQ 2DVJA 5AYFA 3JAME 1PKTA 4VUBA 1Q82U 4CI0C 3LWHA 1KQSA 4M7AC 4MDXA 3CCQA 2FO0A 4OMPA 1OV3A 4PJOE 4OMFB 1WPYA 1O75A 3QJ6A 2ATCB 3CC7Q 2HQHA 1SHGA 3CXCA 1UECA 1WHHA 1E7OA 3JCMX 3C12A 1B34A 4M77B 1K4US 3OYNA 2BZXA 4C92E 5KE3A 3G71A 2X4XA 3JCMQ 2Y4XA 4E7IA 3S3OA 1KHCA 4RTYA 2D0NA 1AVZC 5GAOl 5GAN8 2DD4A 3MKDA 2JT4A 2OTLA 4C0ZA 2K5IA 1H8KA 3PVLA 1VQLT 4CC4B 3MEUA 1KC8U 4KH0B 2GTOA 3VJPA 4RTTA 2CUBA 2YHTA 1WXBA 1KSWA 4ZTJA 4QKUA 2GTJA 1YBYA 1YJ9A 1RAGB 4V2SA 2EKOA 2NUPB 5LJ3h 1X01A 2KE9A 5D6YA 5AT1B 4X9CA 4DBRA 4M77D 4AT1B 2MYSA 2D0QB 4DEXA 3N5BB 3KXTA 4RG2A 3LGFA 1B3QA 4DOWA 3QDRB 3CMEQ 3OYGA 1XJWB 3EGXB 4Z88A 3CC2T 1IGQA 1VOMA 1AWXA 5HKCA 1KJWA 4J9FA 2IPOB 2E5KA 3OQ5A 4C8QE 3QJYA 2KT8A 1G3SA 3GOXA 2B8AA 1HSQA 5I22A 3URGA 2A7YA 3FC3A 2LP5A 1YHQQ 1VQ8Q 2BTTA 2XHCA 2FZGB 1TTHB 3OYDA 2L5QA 2RF0A 2CREA 2BUDA 3MEAA 5IHIA 1TUCA 3WVEB 1QKWA 1JJ2P 2EWNA 3JB9F 1PHTA 1NYGA 3QSUA 2FRWA 3CBOA 4M77C 1TOVA 1R77A 2RD1A 3OYKA 2ESWA 3S6WA 4AFZC 3G6ET 2YLCA 4FIBA 4J6YA 3I56Q 2DEQA 2L3QA 2GQIA 1CKAA 4ZN1A 2G3RA 1VQNT 2IG0A 4PJNA 2KBTA 5LJ3j 3JCMb 4JDSA 2L89A 2Y4YA 2R5AA 3H0IA 3I55Q 2FVUA 2YT6A 4FW1A 2KEAA 4LDWA 1Q95G 2WSCE 3X26B 3NFCA 3M4YA 4KDLA 5IAYA 4BDZA 1TU0B 1Q86U 2DL4A 5LJ3d 1DJ7B 2KVQG 4PKCC 3P8HA 1V29B 5C6SA 2RPNA 2JTEA 3RIRA 1U1TA 3A5ZB 4J9DA 3HU2A 1LJOA 4A4HA 2YVLA 4OP0A 2MIOA 3OB9A 4N4HA 3M55A 4DA4A 3CCRT 2E6NA 1WHJA 3CCQT 3JCMh 2KQWA 2K2MA 2MM2A 4ANJA 2DNUA 3NTHA 3P8BB 4ZNXA 1VUBA 2PVOB 4JS5A 4OF1A 3ZJVA 2DZCA 1YJNQ 2E6ZA 2OAWA 5CQXA 2RJFA 3VUBA 3SDZA 2DLPA 5EG2A 2EYQA 2RH2A 2XKOC 4X9DA 1HK9A 2P0QA 5IXBA 2O9SA 1ABQA 2JM9A 1VQPQ 2K9GA 3ZGZA 1JXOA 1AWJA 1HJDA 3A8HB 2RJDA 3KFVA 1PRMC 3EGDB 1N8RR 4RTVA 2P84A 3UATA 3RERA 2HMAA 4OB3B 1H641 4O6JA 4M75A 4AFSC 2MAMA 4M77A 1VQ9Q 4RUGA 4M75F 5LJ5g 4RKUE 2PUKB 1JRIA 2AT1B 2ED0A 3S3MA 2B25A 4F14A 5FTLA 2J6KA 1AOJA 1IREB 1EFNA 3L2RA 3FRNA 3M54A 1ZC1A 1E6GA 7AT1B 4A63B 1ZSZA 3AT1B 1S72A 2DXCA 2COYA 1KFZA 3UA6A 2F1LA 1VQ4A 1M8MA 4N0AC 1UEBA 1YI2Q 3ME9A 3CPWP 2Q1AX 5KYWB 2HKQB 3CCSQ 1TUDA 2DL8A 2I2LA 2HBWA 1I9GA 3PIPA 3VS7A 2NUPA 1JJ2A 1SKUB 2XIDA 1AD5A 2ECZA 3E19A 1K73U 4C92G 4RV0A 2DBMA 2FYKA 4E7JA 2EW3A 4E6RA 2LCCA 2RN8A 1QVFP 1YFNA 3F70A 4KH1B 1JEGA 3M53A 3OMGA 2LMJA 5GAN2 4JJBA 1K9MR 2K3YA 3EGXA 1M90U 1VQ6A 1T3LA 1KHIA 2AZSA 4FSSA 2LNHB 4DBQA 1Q82C 1VA7A 1OU9A 2JMCA 4IUTA 4JRKA 2L2PA 3UDCA 1VQ8A 3RDVA 4LNPA 4XK8E 5FTMA 1UGVA 4A4EA 3JB9G 1HXDA 1YWPA 4JRIA 4KGXB 1M1KR 4DBFA 2HD0A 3DB3A 5HK3A 1PRLC 5FWBA 1OZ3A 1ZSGA 3I9QA 1OEBA 8AT1B 1Y71A 2M9UA 2B86A 4BD3A 1G2BA 3H6ZA 5FU7B 2YUPA 4KODA 3X24B 3L2UA 4IUQA 1I1JA 4BB7A 2QYZA 5IHNA 3NPFA 2JS0A 3HP9A 5A2QE 3CCUT 1KC8C 2BZ8A 2F2VA 3FJPA 2L0AA 3LHDA 5KE2A 1UUEA 3HRSA 2DL7A 3BW1A 1M2VB 4JRQA 4N0AA 4MMLA 1AT1B 2VVKA 3CCQQ 1BIBA 1IB8A 3P8DA 4C5GA 1S3SA 3BDUA 2L3SA 1GBRA 2HDAA 1OZ2A 1RI0A 1ZX6A 2CH4W 2DL5A 2JS2A 4M7DB 2VGNA 1M3AA 2QI2A 1PKSA 5KCOA 5GAMj 3A8LB 1WLPB 1K8AR 3G71Q 2QASA 2YXYA 3UF4A 3EFOA 2FG0A 3VS3A 3VRZA 2WSEE 3C94A 3OYIA 1RAAB 2LRQA 5CVIA 3HRTA 4BE0A 5GAMd 2OTLQ 2A08A 4E7KA 3ZJUA 1RACB 4C5HA 4IIMA 4LDVA 3CPWA 3TVTA 2GGRA 3OW2S 3EGDA 1MNEA 4F7UE 2PVGB 4M75G 1VQLA 4RTZA 2JXBA 1BBZA 5ECAA 2JTMA 4R55A 4M78E 1EX4A 4KGZB 1QVFA 4PJOB 3M0UA 2LCSA 5FU7C 3J7AF 4HT9A 4HVUA 1ARKA 2XMFA 1NEGA 3LW5E 4FT2A 1W4SA 4LUEA 1R0BG 2V8IA 1Y07A 3G1JA 1I5OB 2MMPA 2X35A 2MOXA 1BI3A 1UJYA 4DBHA 2LX7A 3QYHB 1MHNA 1RADB 1W2BP 5KH6A 2I0NA 4Z02A 1GFDA 3HFNA 4J9GA 3A1PA 1Q86C 2LCLA 1NJIR 2RI5A 3CC2A 3OYCA 2K57A 5CCAA 4AMCA 2NUTB 3MCAB 4FU6A 2MWPA 2LQNA 5KYWA 4ESRA 1OPLA 2F69A 3V7SA 5LJ5f 1BI0A 4F7UF 4LD6A 1ZUUA 1U5SA 3WXMB 1HD3A 3L2VA 3I5RA 2V1RA 3PMIA 2LX9A 4MZPA 5GAOq 1D3BB 1FYNA 4PJOD 2OX7A 2JJ9A 4MZMA 5J26A 3SEMA 3HTRA 1HYOA 3UT1A 1GCQC 4LUDA 2ZGWA 4UC4A 1YP5A 1MV3A 5GJWB 2CZ1B 1X6BA 3CC4T 1WI7A 4XQ3A 3G6EA 3DKMA 3OYHA 1K1ZA 2DILA 2FZKB 1VQ5T 3GIBA 2KRSA 1ZQ1A 1VQNA 2LJ1A 3LGAA 5M9OA 3M58A 5GAMe 4OGCA 4XTUA 3CCLT 5CQYA 1UHFA 2JOYA 5GANe 2RK1A 3MJXA 4JJCA 2LW6A 3EHQA 3CD6T 3QXEB 2CUDA 2DAQA 5CR2A 1VQOT 2J05A 2QDYB 4R56A 4PJOC 2LT4A 2OTJT 3H8ZA 2M02A 2QGGA 1WFWA 1BYMA 1RLPC 1BIAA 2DD5A 4YTLA 5FTKA 2FHDA 3REAB 4IUPA 2GBQA 2FPFA 4Q5WA 3VS2A 2DA9A 3QDFA 4HVVA 3FPTA 3CCRA 2KK4A 2DJZA 1M2VA 4KO8A 4C8QD 4KDIA 3SFMA 1UG1A 1K73C 1K76A 2H3EB 2HSEB 2QEXT 1ZA2B 3M0PA 1VYUA 4BI3A 3HFOA 2K5FA 2DL3A 3JCMg 2F2XA 4Y91A 2PTKA 2D9TA 1M90C 2PQWA 4KBMB 4M7DA 4CRIA 4M7DF 2KROA 2V1QA 4XU3A 2DVEA 1FMKA 2CP3A 2Z0WA 1NPPA 3RKYA 1F1BB 1GCQA 3UPUA 3OYFA 3PIOA 1AEYA 1W2BA 3G4ST 2DYIA 3UWNA 1ZHIA 4Z89A 3EG0A 3QWXX 1WYXA 1KQ1A 2C0OA 2LJ3A 3RR6A 2K3BA 3META 1S72Q 3MP6A 5GMKi 2JM8A 1PD1A 4C8QC 5ERGB 3VS1A 1KQSS 2ZCFB 3QZ9B 1Q81R 1VQ4Q 4J83A 3G7ZA 1WNLA 5FRNA 2YRCA 3MP8A 1FMVA 5GMKj 4FW2A 1M4ZA 3E9FA 2IIMA 2K2VA 1Q7YR 2CSQA 4PJOA 1C0MA 1H3HA 2DKGA 5C0MA 4FYYB 1QW1A 2RB6A 2LZ6B 1YNZA 1U06A 2EQIA 3I5SA 1IHWA 1VQ6Q 4JJDA 1WHGA 4AG2C 1O54A 4EIKA 5EQJB 3O8VA 4M7AA 2DK3A 4ZGDB 1T3SA 4M7AF 2CP6A 2J6OA 3L2ZA 3RBBB 1KD1R 4F7UG 2NUTA 3NHNA 2CZ6B 1K9AA 4WF2A 1C6VX 2E3HA 4ORZA 4M78G 3OYLA 2ABLA 4IUVA 5C1BA 3OSVA 2X3XD 1D3BA 2RM4A 2KI7A 2XDDA 2KT1A 2KXCA 1VQ7T 4MMKA 3RMQA 4JLIA 1D0YA 1M1KC 1D1BA 2EQUA 2H3JA 2ED1A 2RQUA 3PT9A 2LVMA 3VUZA 1H92A 1UGPB 2RHIA 2DXBA 5LJ3f 1PWTA 4EMKC 2DIQA 1N9SA 5CKEA 3FJ5A 4FL6A 4KT0E 2ZPHB 4BI8B 3OYAA 1UHCA 4XAXB 1VQOQ 1GRIA 1Q7YU 2OTJQ 3H9NA 5DYGA 4CC3A 2VXEA 3VV0A 1AWOA 1AWWA 2E3IA 3NTIA 2ZPFB 3JV3A 4D8DA 3CCUA 1QMCA 3QG1A 4M75E 4FSXA 4M77E 2HQXA 3O5ZA 3LH0A 1PM3A 3MPUB 4XTZA 5FW9A 1U3OA 1B7TA 5CKBA 1UJ0A 4NOYA 2MF2A 4QT7A 2M16A 2WSFE 2J6FA 2CGHA 5CO7A 4LD9K 2XK0A 3FPRA 2E65A 2E10A 3VYHB 2HL3A 5GMKe 4J7IA 2D8HA 1WGSA 5IH2A 3EAEA 4OMLA 2CDTA 3PTAA 2PU9B 4HT8A 1FWZA 4AQ7A 5IXFA 2EYZA 2HCKA 1UGRB 1FXXA 3OBYA 1IHVA 3H41A 1RAEB 4M7DG 4AFUC 2KY9A 4M77F 3OYJA 1I4K1 1VQLQ 3QUIA 2SEMA 5I11A 1WQWA 2V26A 5IHKA 3KUFA 1YIJT 3JCMW 4PFZA 4OVAA 4J9HA 2WACA 1TWBA 4B9WA 1XOVA 2ZAEA 2E1HA 2DMOA 1VQMT 3CCEA 1I07A 4GBQA 1N27A 3QPHA 1AZGB 2QQ9A 1TH7A 2FZCB 2O2OA 3TCJA 1LNXA 1PC0A 1QVGP 2DZ9A 2VKNA 2C0IA 1E6HA 4JZ4A 2FB7A 5KYUB 2YLBA 3CC2Q 4R0KA 2XDPA 4BACA 3SWNB 3JCMf 3JCMV 2DETA 1WHKA 2LT1A 4A53A 2PNIA 1N5ZA 1MMGA 2DTIA 3MP1A 2EYYA 1BCOA 2AIRB 4ATOA 1JQQA 2BE7D 1PD0A 1BKBA 5IT9E 2CSIA 1MMNA 2KNBB 2VUBA 5GMKl 2RMOA 1N8RU 2C0TA 4KRTA 2DEUA 2RQVA 1M2OA 3ULRB 5I21A 2EYWA 5KYXB 1O9SA 4M7AG 2IVWA 1BI2A 1FMWA 1OOTA 5GAMh 1XTDA 5CD1A 5J3BA 3G6EQ 1GBQA 1WJSA 2A0FB 5GANh 1VQ7Q 4Y28E 2RI3A 2KRMA 4OGEA 2M1HA 3CC4A 4EDUA 2RA2A 1VQNQ 4AG1C 2GFUA 5DYIA 3VYGA 5GAN4 2LC4A 2EVRA 2VXFA 3LH5A 2QA4T 2Q18X 3RMSA 1JJ2S 1VQ5A 3HU3A 1U1SA 4PJMA 2LQ8A 2RHYA 4X34A 2M0OA 3BQBA 3CCLA 4FYWB 1JO8A 5LL6S 4LDXA 3M0SA 1D1AA 3E1SA 3HKSA 3CD6A 3LGLA 2BE9B 1VQOA 3OS1A 2OTJA 1X43A 3ZL7C 1WA7A 1J3TA 5DLOA 5I2MA 3DLMA 1G8XA 4LXCA 3HRUA 2HAXA 3UA7A 1K9MU 2MM0A 2CT3A 2EBPA 2EGCA 1R0CB 2X51A 4KUIA 3CCRQ 5DM7R 2NUZA 1KQ2A 1BI1A 3SWNC 3QWYA 1VQKT 2DIGA 2CKKA 2RQRA 4HCZA 3QIIA 2QTXA 3CCMT 2HQEA 2MK5A 1NBEB 4PLIA 5IN1A 1H3ZA 2Y90A 4LN2A 1UGQB 2XD0A 3M0RA 4ELYC 2K5LA 3CCVT 2CH4A 4OMNA 5A0LA 4A4FA 2X3WD 5GANj 4QQGA 1U8RA 2QEXA 3QKJA 1M1KU 4Y92A 1CZ4A 1WX6A 2CYZB 3EHRA 4RCCA 3QHSA 3M9QA 3RKXA 4QW2A 4WCIA 4KGVB 1QQJA 4ZTFA 2C06A 1Y96B 1Z9QA 3CC7T 3VS5A 1QVGA 5GANd 2ZZDA 1FX7A 5D6XA 4PNOA 3ZFJA 2K7AA 3BE3A 2ZPGB 1QWFA 3TEEA 2HSPA 1VYTA 1MMAA 2AK5A 3G4SA 4M77G 1MMDA 1NEBA 1WIEA 1ZLMA 1QCNA 2OJ2A 1VQMQ 3CCET 1YITA 3D7SB 2X4WA 1D0XA 2KGTA 3CF2A 2JMAA 3PGGA 2HZYA 4JJNK 2O31A 3EFSA 4OB2B 2EGAA 2JVVA 1Q81C 3J80E 4L6V5 1VIEA 3SB2A 1WLFA 4KLNA 3JB9H 2PUOB 4E7SA 1VIFA 3EG2A 5CIUA 2HKNA 4BY6B 2QQRA 4M4ZA 2RJCA 3RNJA 4E7LA 3EH1A 3TQ7P 4C92B 1BB9A 1TXQA 1Q7YC 3CPFA 2DXTA 2NWMA 1WHLA 5LJ3g 2DF6A 2QGFB 3LYIA 3JRZA 2DXUA 2X4YA 4XU1A 1NE8A 3OA6A 4QVDA 5GAOp 2GCXA 1UFFA 1WHMA 1PCXA 5KYUA 3EG9B 1K8AU 2P4TA 3CBPA 2AKLA 2HNIA 3CPWS 3MO8A 2EPDA 4LE9A 3CMET 5GMKm 2PVDB 4A54A 1IZ6A 2Q1CX 1YCSB 4FT4A 4F17A 2SRCA 3HPWA 5GAN7 2DX1A 3TSWA 3AHUA 1UE9A 4OMOA 3V8KA 2EQKA 2A36A 4PFOA 3JSCA 2FPDA 2EFIA 1Q82R 1X6OA 1AZEA 3MEWA 3V7RA 4C92D 1G5VA 5KYXA 1YHQT 1NG2A 3CMAA 1SRLA 2DM1A 1M30A 1IRXA 2NLUA 1VQ7A 4KUDK 1S1NA 3MHXA 3R6NA 2EYXA 2CT4A 4CQNA 4C8QB 2EJFA 2E4HA 2E64A 4PL6A 5KYYB 2RHUA 4J7FA 4XU2A 1V76A 1RAFB 1CR5A 4N4GA 3FLGA 3J81E 1YCYA 5DLQE 1SPKA 2E41A 1YJWA 1P92A 1BK2A 3I56T 3OS5A 3CCUQ 1M3BA 2GF7A 4M7DE 1SRMA 1GXIE 1T0JA 5FTNA 1I81A 5KYNA 2MI6A 1ZUYA 1G3YA 2D1XA 1NJIU 2O01E 4DQ2A 3JB9D 3SD4A 2E5QA 4MZTA 4WTOB 4BY6C 3I55T 3GF5A 1W1FA 5GMKh 4C92C 2MWOA 3LWIA 2XG8D 1KC8R 3DB4A 2A37A 4HCKA 2RO0A 3QO3A 2CP7A 3OS2A 2JTFA 5CCBA 2EQJA 3MEVA 3VU3C 4PJLA 2L3PA 2QTVA 5CCXA 2DTOA 4J5YA 1PSEA 4XTVA 3L2WA 3GBQA 1Y7XA 3EGUA 1LVKA 2HL5C 5DY9A 4PK4A 2J7IA 4AS1A 3V8LA 1QP2A 3CCJT 2VGMA 1OPKA 2LQKA 2KXDA 1N8RC 2O4XB 1TUGB 3QQ7A 1YWOA 5FWCA 1YJNT 2L8DA 4GLKA 3JB9J 3ASKA 2KDSA 2COZA 2EIFA 4M75B 2PWYA 4XTYA 5GAOn 4OMQA 1VQPT 4EMKB 1NLOC 2D8JA 3X28B 4DEYA 1YITT 3CCEQ 1YIJA 4M7AE 4KULA 2M0YA 1Y96A 2NYSA 3FIFA 1ACMB 3IQLA 4J9IA 4EMHA 4F16A 2P4RA 2X4JA 1X75C 4II1A 4FCYA 1ZSZB 1VQMA 2QG9B 1VQ9T 5LJ5e 2RHZA 4A4KA 3VRYA 5FTJA 3FPUA 1OQKA 5I2SA 3CXCS 4J9EA 4FYXB 4PJOF 3PE0A 2BZYA 1OU8A 4PFPA 5L23A 2QXFA 4M75D 3QBYA 3JCMP 4ELZC 3M59A 2COWA 2DERA 1JB0E 2JNGA 4C92A 1N9RA 1YI2T 4C92F 4JLGA 1K9MC 3S3NA 2Q19X 1Q86R 3CCST 4LDUA 1W2BS 1WZOA 2YDLA 3DLLA 2L3RA 3EG3A 2DJQA 1E32A 2BKDN 1I0CA 1PSFA 2VC8A 3EG9A 1WDXA 4GY5A 1SF9A 1TG0A 1KG1A 2RQTA 3GNGA 2QQSA 4HCBA 2KSSA 5B6CA 1K0SA 4L5GA 3TREA 3CC4Q 3M56A 3NGPA 3WVDB 5CKHA 2YSQA 2JW4A 3A8GB 4C0FA 5FROA 3CMAT 2YUOA 2EJGA 4IKFA 2LDMA 3OYYA 3OS0A 1VQ5Q 4N4IA 1MGQA 1Q81U 1JU5C 4M75C 4RTXA 5GAMg 4JUVA 5EPPA 1Y57A 2A28A 4J6XA 4DOVA 3JCMJ 1WJRA 2KYBA 4EMGA 3CCLQ 3EFRA 2VASA 3V8JA 2QA4A 5GANg 3BDLA 4QVCA 1XQHA 1YJWT 3TSZA 1WQ7A 2HEQA 3ZBDA 1QLYA 3CD6Q 5FU6B 2XU8A 3L1AA 3QZ5B 4C0GA 4C8QA 1ZSZC 3R6OA 4C8QF 2P0KA 4FM4B 5KYYA 2YUNA 2EQMA 1YN8A 2E12A 4RTUA 2RHXA 1BCMA 2XDBA 1A0NB 1D1CA 2MCNA 4BE2A 2ROLA 5GAN5 1B07A 1KD1U 1VQKA 4HCCA 2YRDA 1G83A 4IIOA 1RLQC 3CCMA 4J9CA 4AFQC 2AHJB 4RMOA 2QEXQ 1EIFA 2F2WA 1G3TA 1NPRA 3RESA 3CCVA 2QAZA 4Z8AA 1K8AC 3NTKA 2FL7A 3CCJQ 3EFOB 5FLXE 3M5AA 1K73R 1M27C 4OB0B 2LNVA 1C1AA 1KIKA 4NL3A 4L59A 3HU1A 1G3WA 3OW2P 5D7UA 1RABB 2H8HA 2QQBA 3G4SQ 3QQ8A 1X6GA 3CC7A 3M57A 3JB9I 2EJ9A 1M90R 3G71T 5EC7A 1AHJB 1RAHB 1RAIB 1PNJA 1YITQ 1M3CA 3C95A 2M51A 2O4XA 3PMTA 2FRYA 4ARCA 1LCKA 1GFCA 2K6DA 4X1VA 2OTLT 3RKWA 3QC8A 2OI3A 3GP8A 1M1FA 2EKHA 4EMKA 3PNWC 2FPEA 5GAOm 5FU6C 4MDWA 4J8OA 3HSBA 1OX8A 4BUGA 2RI2A 5D6WA 3ZJTA 2DPPB 1I5LA 2DYBA 4D6WA 1MUZA 3L2QA 1YJ9T 1VYVA 4GLMA 4JZ3A 2J06A 1QDNA 5HY6A 4JS4A 1D09B 1SSFA 3A98A 3LLRA 2JUFA 3M4GA 4PJOG 1K0XA 4BE1A 4NL2A 1NJIC 1ZBJA 1LOJA 1CZ5A 3OSSC 1JXMA 2ZPIB 4F7UB 2VB6A 3QWZA 4E47A 1V1CA 2YUQA 4ME7A 4OMMA 5GAN3 3M0QA 3CMEA 2HBPA 5LJ3e 4M78B 4C5IA 4IUUA 2YUJA 5C18A 2DE0X 2F5KA 1UB4A 3JCMd 2DFUA 4XTWA 5FRMA 2KMTA 4CC7A 1X69A 2CP2A 3A8OB 3CMAQ 1WXUA 2GFAA 4QQ6A 4J6WA 4EPCA 1R7RA 1UTIA 2XI9A 3GLXA 1SSHA 2RQWA 1YHQA 5GJVB 4J9BA 1T0HA 5A0GA 1TSFA 2PZ1A 3HL8A 3KBGA 4RG8A 1QCSA 4PJJA 1YJWQ 3PFSA 2LJ0A 2RNAA 1NM7A 2V8KA 1OULA 3TU4K 5CKDA 1MV0B 2O88A 2AZVA 5CAIA 3GPLA 2G6FX 1ZBXA 1R8OB 1OYXA 1BU1A 1RUWA 3C0CA 4M78D 4A4GA 3I56A 4JPBW 1RI9A 2VWFA 3CEYA 3BFMA 5CK9A 9ATCB 1GL5A 2FEIA 3FEOA 2DTHA 4C8QG 2EGEA 2X9HA 3MB5A 1ABOA 3ZEHA 3I55A 2K3XA 3H0FA 1OI1A 4C0DB 2Q1DX 1X27A 3OW2A 1M5Q1 1RL2A 4ZGEB 3U23A 2E70A 4XU0A 2YRVA 2CZ0B 4ZN3A 3OYBA 1UDLA 4C5EA 1PG5B 4NS5A 5GAN6 5GAMf 3OYEA 6AT1B 1KK7A 1D0ZA 2QK0A 3REBB 1B34B 3THKA 5GANf 2CZ7B 1CSKA 2DRMA 4M78C 4BI4A 3L42A 2PJHB 3C4SA 8ATCB 5HCKA 2JN0A 3CCJA 1CKBA 3JCMc 5J39A 2OAUA 1N6AA 2F5TX 2ZPEB 3X20B 5LJ5h 4HKEA 2AKKA 1WXTA 1YJNA 1EZZB 1QWEA 1NLPC 2LQWA 3Q1JA 1YIJQ 4JRPA 1SEMA 3JCMe 3EH2A 2MPXC 3VKIA 3E2UA 1VQPA 4B6MA 1KQSP 1QKXA 3OYMA 1QVPA 2KR3A 2JZ2A 2VYTA 2ZPBB 2JV2A 1TS9A 1VQ9A 2QQAA 3CQTA 3CXCP 1M1GA 4HXJA 4O5VA 3OBWA 5KCHA 2D6FA 1QCOA 2VV5A 4F04B 2W10A 1YJ9Q 1ZUKA 1S72T 1SG5A 2RJEA 2R58A 4M7DD 2RK2A 2KYMA 4QVZA 2KAFA 3OY9A 3FB9A 1M8VA 1VQ4T 1MNDA 4HA8A 2ROTA 2GNCA 4HVWA 1ZA1B 2A3LA 2DO3A 1W70A 2CP0A 3SHWA 2BIVA 3H0HA 3TIWA 3GNFB 1QVGS 4RCBA 3SWNA 2KRNA 3I35A 1IO6A 4ZGJB 4E7HA 1Z9ZA 1X2QA 4C0DC 1YI2A 1Y0MA 4P5NA 2DRKA 3RUXA 3CCSA 2DBKA 4M7AB 4E2FB 3HHTB 1KD1C 2CP5A 4BDYA 2QDLA 5A0DA 4FYVB 1QCFA 5GAOr 5LJ5j 1VQ6T 3FDRA 2V8JA 1W6XA 3OMCA 3VS6A 4F7UA 1QVFS 3BY7A 3EG1A 1NZ9A 3PVQA 2GQVA 3VS4A 3QYGB 4M78A 4M7DC 4M78F 3A8MB 4OB1B 3X25B 1VQ8T 4B9XA 5LJ5d 4ARIA 4QQDA 3CBMA 1M9SA 2QA4Q 1OX9A 3LX7A 1XNIA 3NMZC 4CC2A 2R5MA 1NYFA 2O9VA 1LPLA 2K79A 3VS0A 2K4YA 1WJQA 4RTWA 4K11A 3V7CA 4M7AD 2P0PA 4E7ZA
chains in the Genus database with same CATH topology
3CCEA 1E32A 2BKDN 4M7DB 2VGNA 4IURA 2QI2A 1PSFA 1N27A 2VC8A 3QPHA 3E9GA 4GY5A 3T9NA 1KG1A 5GLFA 5KCOA 2QQ9A 1TH7A 5GAMj 3A8LB 3ER0A 4LDYA 3GNGA 2QQSA 2R57A 3TCJA 4HCBA 1LNXA 2KSSA 5B6CA 2DZ9A 4L5GA 3TREA 3M56A 2CS7A 4XTXA 2WSEE 2FB7A 3C94A 2YLBA 5L8RE 5CKHA 3WVDB 3OYIA 3A8GB 1QP3A 2LRQA 5FROA 5CKFA 3HRTA 5CVIA 4C0FA 4BE0A 2EJGA 3CMAT 4IKFA 2XDPA 4BACA 3SWNB 2LDMA 1I8FA 3JCMf 3OYYA 3OS0A 5GAMd 4N4IA 1JBMA 3JCMV 1MGQA 4E7KA 2LT1A 4A53A 1Q81U 2EAYA 2DTIA 3MP1A 3INZA 4M75C 5HK0A 3ZJUA 4PLLA 1UGSB 2LTOA 4JUVA 5GAMg 5EPPA 4C5HA 4J6XA 4TVRA 4DOVA 3JCMJ 2XICA 1WJRA 4LDVA 4EMGA 3CPWA 3EFRA 4ATOA 5AYFA 3V8JA 2QA4A 3OW2S 3JAME 5GANg 3BDLA 4F7UE 4QVCA 1BKBA 1XQHA 1YJWT 1WQ7A 2PVGB 4M75G 3ZBDA 5IT9E 4VUBA 5FU6B 1Q82U 4CI0C 3LWHA 1VQLA 1KQSA 5GMKl 2VUBA 4M7AC 4MDXA 1N8RU 2JTMA 2XU8A 3L1AA 3QZ5B 3CCQA 4R55A 4C0GA 4PJOE 4M78E 4C8QA 3R6OA 4OMFB 1WPYA 4C8QF 1O75A 1QVFA 2P0KA 4PJOB 4FM4B 3QJ6A 5FU7C 2EQMA 3J7AF 4HT9A 5I21A 1O9SA 2E12A 3LW5E 4FT2A 4M7AG 1W4SA 3CXCA 2V8IA 1Y07A 3JCMX 2IVWA 1BI2A 3C12A 5GAMh 1B34A 1XTDA 2MMPA 2RHXA 2X35A 5J3BA 5CD1A 4M77B 1BI3A 1WJSA 2XDBA 3QYHB 1MHNA 3OYNA 5GANh 4C92E 5KE3A 5KH6A 3G71A 4Y28E 4BE2A 2RI3A 4Z02A 2X4XA 3JCMQ 2Y4XA 3HFNA 5GAN5 4OGEA 2M1HA 4E7IA 4EDUA 3CC4A 1KD1U 2RA2A 2GFUA 2LCLA 3S3OA 1Q86C 1VQKA 5DYIA 3VYGA 1KHCA 5GAN4 4HCCA 2LC4A 2RI5A 3CC2A 3OYCA 2VXFA 2K57A 5GAOl 5GAN8 5CCAA 2QA4T 3RMSA 1JJ2S 1VQ5A 2Q18X 2DD4A 3MCAB 3CCMA 4FU6A 2OTLA 3HU3A 2MWPA 3QSUA 1U1SA 2AHJB 4RMOA 2LQ8A 4C0ZA 2K5IA 2RHYA 1VQLT 4X34A 2F69A 3V7SA 1EIFA 1BI0A 4F7UF 5LJ5f 1G3TA 4LD6A 2M0OA 3BQBA 1NPRA 3RESA 3CCLA 3CCVA 5LL6S 3MEUA 3WXMB 1K8AC 3NTKA 3L2VA 4LDXA 3PMIA 1KC8U 2FL7A 2LX9A 4MZPA 5GAOq 1D3BB 3E1SA 3HKSA 3VJPA 5FLXE 3CD6A 3M5AA 2YHTA 3LGLA 4PJOD 1VQOA 4OB0B 3OS1A 2LNVA 4ZTJA 2OTJA 4NL3A 1YBYA 4L59A 4MZMA 5J26A 1YJ9A 4V2SA 2EKOA 5LJ3h 3HU1A 1X01A 1G3WA 5DLOA 5D6YA 5I2MA 4X9CA 3UT1A 3DLMA 4M77D 2QQBA 3HRUA 2HAXA 3QQ8A 3CC7A 2D0QB 3M57A 3JB9I 2EJ9A 2ZGWA 4UC4A 1K9MU 2MM0A 3G71T 1AHJB 3N5BB 3KXTA 4KUIA 2CZ1B 3LGFA 4RG2A 5DM7R 1KQ2A 1BI1A 3CC4T 4DOWA 4XQ3A 3SWNC 3G6EA 3QDRB 3C95A 3OYGA 2O4XA 3PMTA 3DKMA 3OYHA 1VQKT 2DIGA 2CKKA 3CC2T 4HCZA 5HKCA 4ARCA 3QIIA 1VQ5T 2QTXA 4C8QE 3OQ5A 3CCMT 3QJYA 2OTLT 3GIBA 2HQEA 3RKWA 3QC8A 1ZQ1A 1VQNA 4PLIA 5IN1A 3LGAA 3GP8A 1M1FA 5M9OA 2Y90A 1G3SA 3M58A 5GAMe 1H3ZA 1UGQB 4OGCA 3PNWC 4XTUA 4EMKA 2XD0A 3GOXA 4ELYC 2B8AA 5GAOm 3CCLT 2K5LA 5CQYA 5FU6C 3CCVT 5A0LA 2JOYA 4MDWA 2RK1A 4A4FA 5GANe 4J8OA 3HSBA 2LW6A 5GANj 4BUGA 4QQGA 3CD6T 2RI2A 3QXEB 3QKJA 3URGA 2QEXA 5D6WA 1U8RA 2DAQA 3ZJTA 2DPPB 5CR2A 2A7YA 1VQOT 1M1KU 1I5LA 4D6WA 2QDYB 4R56A 3FC3A 4PJOC 2LT4A 2OTJT 3L2QA 3H8ZA 1YJ9T 2XHCA 1CZ4A 2CYZB 3OYDA 4RCCA 2L5QA 3QHSA 1QDNA 2BUDA 3M9QA 3MEAA 5HY6A 3RKXA 4JS4A 4QW2A 3WVEB 1BYMA 1BIAA 2EWNA 1SSFA 2DD5A 3LLRA 2JUFA 1Y96B 4YTLA 3M4GA 2FHDA 4ZTFA 4PJOG 4M77C 3CBOA 1QVGA 3CC7T 5GANd 4BE1A 2ZZDA 1FX7A 4NL2A 5D6XA 4IUPA 4PNOA 1NJIC 3ZFJA 2RD1A 3OYKA 1LOJA 3S6WA 2ZPGB 3G6ET 2YLCA 3TEEA 1CZ5A 3OSSC 2ZPIB 4FIBA 4Q5WA 3G4SA 4F7UB 4M77G 3QWZA 4E47A 4J6YA 2DEQA 3FPTA 3CCRA 4ME7A 5GAN3 3CCET 1YITA 2KK4A 2X4WA 4ZN1A 2DJZA 2G3RA 1VQNT 4KO8A 3CMEA 2HBPA 2IG0A 5LJ3e 3PGGA 4C8QD 3CF2A 4KDIA 4M78B 3SFMA 4JJNK 5LJ3j 3JCMb 4JDSA 1K73C 2L89A 2Y4YA 3EFSA 2R5AA 4OB2B 2JVVA 4C5IA 4IUUA 1Q81C 2YUJA 5C18A 3J80E 2F5KA 4L6V5 1UB4A 1VIEA 3SB2A 1WLFA 3JCMd 4KLNA 3JB9H 2FVUA 2QEXT 4XTWA 2PUOB 5FRMA 4LDWA 4BI3A 1VIFA 2KMTA 2WSCE 5CIUA 2K5FA 3HFOA 4BY6B 2QQRA 3A8OB 2RJCA 3JCMg 3X26B 4E7LA 3NFCA 4Y91A 3M4YA 4KDLA 5IAYA 2D9TA 4BDZA 2PQWA 1Q86U 1M90C 2GFAA 4QQ6A 4KBMB 4C92B 4M7DA 4J6WA 1DJ7B 5LJ3d 4CRIA 2KVQG 4PKCC 4M7DF 4EPCA 1Q7YC 3CPFA 3P8HA 1R7RA 2XI9A 2DXTA 3GLXA 1V29B 4XU3A 5C6SA 5LJ3g 1YHQA 2DVEA 3LYIA 3RIRA 3JRZA 1U1TA 2DXUA 2X4YA 1NE8A 3A5ZB 1NPPA 4XU1A 3RKYA 5A0GA 4QVDA 2GCXA 3HL8A 1LJOA 3KBGA 4RG8A 4A4HA 5GAOp 1QCSA 4OP0A 2YVLA 3UPUA 3OYFA 3PIOA 1W2BA 3G4ST 1K8AU 3PFSA 3UWNA 3OB9A 1ZHIA 4N4HA 2V8KA 2P4TA 3M55A 4DA4A 3CBPA 2E6NA 3CCRT 1KQ1A 3TU4K 5CKDA 2HNIA 3CCQT 5CAIA 3GPLA 3CPWS 3MO8A 3JCMh 3META 3CMET 2KQWA 1ZBXA 1R8OB 3MP6A 1OYXA 2MM2A 3NTHA 3P8BB 5GMKi 4C8QC 5GMKm 4M78D 1VUBA 4A4GA 2PVDB 2PVOB 3I56A 4JS5A 4A54A 1KQSS 2ZCFB 1IZ6A 2Q1CX 3QZ9B 3CEYA 4OF1A 3ZJVA 4FT4A 2DZCA 3BFMA 5CK9A 2E6ZA 4J83A 3HPWA 5CQXA 2RJFA 3VUBA 5GAN7 3G7ZA 3SDZA 3AHUA 1WNLA 5EG2A 2EYQA 3FEOA 2RH2A 2XKOC 4X9DA 2DTHA 5FRNA 4C8QG 3MP8A 1HK9A 2P0QA 2EQKA 3V8KA 5GMKj 3MB5A 3JSCA 3ZGZA 2EFIA 1M4ZA 3E9FA 3ZEHA 3HU2A 1X6OA 3MEWA 3V7RA 3A8HB 2K2VA 2RJDA 3I55A 4C92D 4PJOA 1G5VA 5FTKA 2DKGA 3RERA 1YHQT 5C0MA 2K3XA 1QW1A 2RB6A 3CMAA 1OI1A 4C0DB 4OB3B 2Q1DX 2NLUA 1VQ7A 1H641 3OW2A 1M5Q1 1RL2A 4O6JA 4KUDK 4ZGEB 3MHXA 4M75A 2MAMA 4M77A 4CQNA 4C8QB 2EJFA 2E70A 4M75F 5LJ5g 4XU0A 4RKUE 2E64A 4PL6A 2PUKB 2YRVA 1JRIA 2B25A 2RHUA 3S3MA 2CZ0B 4J7FA 4XU2A 4ZN3A 3OYBA 4C5EA 3OA6A 1CR5A 4NS5A 5GAN6 4N4GA 3FLGA 5GAMf 3OYEA 3J81E 1O54A 5FTLA 1YCYA 5DLQE 1IREB 1B34B 2E41A 3L2RA 1YJWA 1P92A 3FRNA 3O8VA 3M54A 5GANf 2DK3A 2CZ7B 4ZGDB 4M7AA 1ZC1A 4M7AF 3I56T 3L2ZA 3OS5A 4M78C 4BI4A 2GF7A 4F7UG 4M7DE 3L42A 1GXIE 2PJHB 5FTNA 1I81A 2CZ6B 3C4SA 2MI6A 1S72A 1G3YA 2DXCA 2JN0A 3CCJA 1NJIU 4WF2A 2O01E 3JCMc 5J39A 4DQ2A 3JB9D 3SD4A 2E5QA 2OAUA 1N6AA 2F5TX 4M78G 2ZPEB 4IUVA 4MZTA 4HKEA 3X20B 5LJ5h 1VQ4A 1YJNA 5C1BA 4N0AC 4BY6C 1UEBA 3Q1JA 3OSVA 3I55T 3GF5A 5GMKh 1D3BA 3ME9A 2RM4A 2Q1AX 4C92C 2XDDA 4JRPA 3JCMe 2MWOA 3LWIA 2I2LA 2XG8D 3VKIA 1I9GA 3DB4A 1VQPA 3PIPA 2RO0A 1VQ7T 4MMKA 3QO3A 3RMQA 4JLIA 1JJ2A 2XIDA 3OS2A 1M1KC 3E19A 1K73U 2JTFA 4C92G 2EQUA 2H3JA 4RV0A 3OYMA 3PT9A 5CCBA 2FYKA 2LVMA 1QVPA 2EQJA 4E7JA 3MEVA 3VUZA 2C06A 2JZ2A 3VU3C 2LCCA 1UGPB 2RHIA 2VYTA 2ZPBB 5CCXA 3F70A 2JV2A 2DXBA 5LJ3f 3M53A 2DTOA 3OMGA 4J5YA 2DIQA 1N9SA 4EMKC 5GAN2 5CKEA 1PSEA 4XTVA 3L2WA 1VQ9A 2QQAA 4FL6A 1Y7XA 2K3YA 4KT0E 1M90U 1M1GA 2ZPHB 1VQ6A 4BI8B 3OYAA 1KHIA 4XAXB 4O5VA 3OBWA 5KCHA 1Q7YU 2D6FA 2VV5A 5DY9A 5DYGA 3V8LA 2VXEA 1QP2A 1S72T 1Q82C 3CCJT 2VGMA 2RJEA 4AS1A 3VV0A 1VQMT 2R58A 4M7DD 2LQKA 2RK2A 3NTIA 4IUTA 1N8RC 2O4XB 2ZPFB 4JRKA 4QVZA 2KAFA 3OY9A 3UDCA 3QQ7A 3FB9A 1M8VA 1VQ4T 3CCUA 1VQ8A 1YJNT 4HA8A 2L8DA 3QG1A 4GLKA 4M75E 4FSXA 4M77E 3JB9J 3ASKA 2HQXA 2KDSA 2PWYA 2EIFA 2A3LA 4M75B 2DO3A 3LH0A 4XTYA 5GAOn 2BIVA 3OYLA 4XK8E 5FTMA 4A4EA 3JB9G 4EMKB 1HXDA 4XTZA 1VQPT 3TIWA 3GNFB 1QVGS 4JRIA 4RCBA 3X28B 5CKBA 3SWNA 4ZGJB 5ERGB 4E7HA 1YITT 4NOYA 4C0DC 1YI2A 1YIJA 2HD0A 2MF2A 3DB3A 4P5NA 2M16A 5HK3A 4M7AE 4KULA 2WSFE 3RUXA 1OZ3A 3CCSA 1Y96A 3FIFA 4M7AB 4EMHA 2CGHA 5CO7A 4LD9K 2XK0A 2X4JA 1X75C 3FPRA 3HHTB 4II1A 2E65A 1Y71A 2M9UA 1KD1C 4BDYA 4BD3A 1VQMA 2E10A 5A0DA 3VYHB 3H6ZA 5LJ5e 1VQ9T 2RHZA 5FU7B 4A4KA 5FTJA 4KODA 5GAOr 5LJ5j 1VQ6T 3FDRA 2V8JA 3X24B 3OMCA 4F7UA 5GMKe 4J7IA 1QVFS 3FPUA 5EQJB 1WGSA 3L2UA 3EAEA 4IUQA 3BY7A 1NZ9A 4BB7A 3PTAA 2GQVA 5I2SA 3CXCS 2PU9B 4HT8A 1FWZA 3QYGB 4AQ7A 3HP9A 4M78A 4M7DC 4PJOF 4M78F 3A8MB 1UGRB 1FXXA 3OBYA 4OB1B 3X25B 5A2QE 3CCUT 1KC8C 1VQ8T 4B9XA 3FJPA 5LJ5d 4ARIA 4QQDA 3LHDA 3CBMA 5KE2A 1M9SA 3JB9F 3HRSA 3BW1A 2QXFA 4M75D 4JRQA 4M7DG 3QBYA 3JCMP 2KY9A 3LX7A 4M77F 1XNIA 3OYJA 4N0AA 3M59A 4ELZC 1I4K1 4MMLA 3QUIA 1JB0E 2JNGA 2R5MA 4C92A 1N9RA 1WQWA 1YI2T 3KUFA 1YIJT 4C92F 4JLGA 3JCMW 1BIBA 2K4YA 3P8DA 1K9MC 1WJQA 4C5GA 3S3NA 4OVAA 3BDUA 3CCST 1S3SA 4LDUA 2Q19X 1W2BS 2WACA 1OZ2A 3V7CA 4B9WA 4M7AD 2P0PA 3DLLA 1XOVA 2L3RA 1RI0A 2E1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTF A;  4ZTJ A;  2EQU A;  4L59 A;  5C6S A;  3OYM A;  5J26 A;  2BKD N;  4E7J A;  2LVM A;  2EQJ A;  2EKO A;  4IUR A;  3LYI A;  3MEV A;  2JZ2 A;  1N27 A;  2LCC A;  2VYT A;  2RHI A;  2X4Y A;  3E9G A;  4GY5 A;  5D6Y A;  3OA6 A;  3F70 A;  5KCO A;  4A4H A;  3UT1 A;  3DLM A;  3OMG A;  2DIQ A;  3OYF A;  2QQS A;  2R57 A;  4UC4 A;  3L2W A;  3PFS A;  4FL6 A;  3OB9 A;  3UWN A;  2K3Y A;  4N4H A;  3OYA A;  4RG2 A;  3LGF A;  2E6N A;  5KCH A;  3OYG A;  2O4X A;  3MO8 A;  3PMT A;  3OYH A;  3OYI A;  3MET A;  2LRQ A;  3MP6 A;  2DIG A;  1OYX A;  2CKK A;  5FRO A;  4BE0 A;  4IKF A;  3NTH A;  2XDP A;  4BAC A;  2RJE A;  2LDM A;  2R58 A;  3OS0 A;  3OS1 A;  3NTI A;  4HCZ A;  4IUT A;  3QII A;  2O4X B;  4N4I A;  4A4G A;  4QVZ A;  3OQ5 A;  3OY9 A;  3CEY A;  4E7K A;  2HQE A;  3MP1 A;  4PLI A;  5IN1 A;  2RJF A;  4PLL A;  2L8D A;  2LTO A;  5M9O A;  1H3Z A;  4C5H A;  3FEO A;  3ASK A;  2HQX A;  1WJR A;  3PNW C;  3GOX A;  5FRN A;  3LH0 A;  2B8A A;  3MP8 A;  2BIV A;  2EQK A;  3BDL A;  4A4F A;  4A4E A;  2EFI A;  3E9F A;  3ZEH A;  4QQG A;  2RI2 A;  3MEW A;  3QKJ A;  2RJD A;  5D6W A;  2DAQ A;  4E7H A;  1G5V A;  3DB3 A;  3FC3 A;  2M16 A;  3L2Q A;  3H8Z A;  5C0M A;  2K3X A;  1OZ3 A;  1OI1 A;  3OYD A;  2NLU A;  2XK0 A;  2BUD A;  2P0K A;  3M9Q A;  3MEA A;  3QJ6 A;  4II1 A;  4QW2 A;  2EQM A;  1SSF A;  4BDY A;  3LLR A;  4BD3 A;  4ZTF A;  2FHD A;  3H6Z A;  2RHZ A;  4BE1 A;  4PL6 A;  2YRV A;  5D6X A;  2RHU A;  4IUP A;  3S3M A;  3FDR A;  3OMC A;  2RHX A;  3OYB A;  2X35 A;  3OYK A;  3S6W A;  1WGS A;  4C5E A;  3L2U A;  3EAE A;  1WJS A;  4N4G A;  3FLG A;  4IUQ A;  4NS5 A;  3OYN A;  1MHN A;  3OYE A;  4Q5W A;  5KE3 A;  3L2R A;  5KH6 A;  3O8V A;  2RI3 A;  4BE2 A;  4Z02 A;  2X4X A;  2M1H A;  4E7I A;  4EDU A;  2GF7 A;  2X4W A;  2G3R A;  2GFU A;  3L42 A;  3S3O A;  2IG0 A;  4B9X A;  1KHC A;  3OS2 A;  3C4S A;  4QQD A;  2RI5 A;  5KE2 A;  3OYC A;  5J39 A;  2L89 A;  4C5I A;  2R5A A;  4IUU A;  3SD4 A;  3QBY A;  4FU6 A;  2E5Q A;  2F5K A;  2MWP A;  1XNI A;  3LX7 A;  4IUV A;  3OYL A;  3OYJ A;  2RHY A;  3Q1J A;  4X34 A;  2R5M A;  3ME9 A;  5FRM A;  4LD6 A;  2M0O A;  3KUF A;  5CIU A;  4E7L A;  2QQR A;  3P8D A;  2RJC A;  1WJQ A;  2MWO A;  3MEU A;  4OVA A;  3NTK A;  4C5G A;  3L2V A;  3S3N A;  5IAY A;  2D9T A;  3PMI A;  2PQW A;  3DB4 A;  4BDZ A;  2GFA A;  4QQ6 A;  2WAC A;  2RO0 A;  1OZ2 A;  4B9W A;  4CRI A;  3LGL A;  3P8H A;  2L3R A;  1RI0 A; 
#chains in the Genus database with same CATH topology
 2ENM A;  4IUR A;  1GCP A;  3E9G A;  3T9N A;  5GLF A;  3ER0 A;  4LDY A;  2R57 A;  1SHF A;  1X2K A;  2CS7 A;  4XTX A;  5L8R E;  1VQK Q;  1IGU A;  2YWW A;  1QP3 A;  5CKF A;  1I8F A;  1JBM A;  3CCM Q;  4D8K A;  3M0T A;  2EAY A;  5HK0 A;  3INZ A;  2W0Z A;  4PLL A;  1UGS B;  2LTO A;  4TVR A;  2XIC A;  1IXD A;  3CCV Q;  2DVJ A;  5AYF A;  3JAM E;  1PKT A;  4VUB A;  1Q82 U;  4CI0 C;  3LWH A;  1KQS A;  4M7A C;  4MDX A;  3CCQ A;  2FO0 A;  4OMP A;  1OV3 A;  4PJO E;  4OMF B;  1WPY A;  1O75 A;  3QJ6 A;  2ATC B;  3CC7 Q;  2HQH A;  1SHG A;  3CXC A;  1UEC A;  1WHH A;  1E7O A;  3JCM X;  3C12 A;  1B34 A;  4M77 B;  1K4U S;  3OYN A;  2BZX A;  4C92 E;  5KE3 A;  3G71 A;  2X4X A;  3JCM Q;  2Y4X A;  4E7I A;  3S3O A;  1KHC A;  4RTY A;  2D0N A;  1AVZ C;  5GAO l;  5GAN 8;  2DD4 A;  3MKD A;  2JT4 A;  2OTL A;  4C0Z A;  2K5I A;  1H8K A;  3PVL A;  1VQL T;  4CC4 B;  3MEU A;  1KC8 U;  4KH0 B;  2GTO A;  3VJP A;  4RTT A;  2CUB A;  2YHT A;  1WXB A;  1KSW A;  4ZTJ A;  4QKU A;  2GTJ A;  1YBY A;  1YJ9 A;  1RAG B;  4V2S A;  2EKO A;  2NUP B;  5LJ3 h;  1X01 A;  2KE9 A;  5D6Y A;  5AT1 B;  4X9C A;  4DBR A;  4M77 D;  4AT1 B;  2MYS A;  2D0Q B;  4DEX A;  3N5B B;  3KXT A;  4RG2 A;  3LGF A;  1B3Q A;  4DOW A;  3QDR B;  3CME Q;  3OYG A;  1XJW B;  3EGX B;  4Z88 A;  3CC2 T;  1IGQ A;  1VOM A;  1AWX A;  5HKC A;  1KJW A;  4J9F A;  2IPO B;  2E5K A;  3OQ5 A;  4C8Q E;  3QJY A;  2KT8 A;  1G3S A;  3GOX A;  2B8A A;  1HSQ A;  5I22 A;  3URG A;  2A7Y A;  3FC3 A;  2LP5 A;  1YHQ Q;  1VQ8 Q;  2BTT A;  2XHC A;  2FZG B;  1TTH B;  3OYD A;  2L5Q A;  2RF0 A;  2CRE A;  2BUD A;  3MEA A;  5IHI A;  1TUC A;  3WVE B;  1QKW A;  1JJ2 P;  2EWN A;  3JB9 F;  1PHT A;  1NYG A;  3QSU A;  2FRW A;  3CBO A;  4M77 C;  1TOV A;  1R77 A;  2RD1 A;  3OYK A;  2ESW A;  3S6W A;  4AFZ C;  3G6E T;  2YLC A;  4FIB A;  4J6Y A;  3I56 Q;  2DEQ A;  2L3Q A;  2GQI A;  1CKA A;  4ZN1 A;  2G3R A;  1VQN T;  2IG0 A;  4PJN A;  2KBT A;  5LJ3 j;  3JCM b;  4JDS A;  2L89 A;  2Y4Y A;  2R5A A;  3H0I A;  3I55 Q;  2FVU A;  2YT6 A;  4FW1 A;  2KEA A;  4LDW A;  1Q95 G;  2WSC E;  3X26 B;  3NFC A;  3M4Y A;  4KDL A;  5IAY A;  4BDZ A;  1TU0 B;  1Q86 U;  2DL4 A;  5LJ3 d;  1DJ7 B;  2KVQ G;  4PKC C;  3P8H A;  1V29 B;  5C6S A;  2RPN A;  2JTE A;  3RIR A;  1U1T A;  3A5Z B;  4J9D A;  3HU2 A;  1LJO A;  4A4H A;  2YVL A;  4OP0 A;  2MIO A;  3OB9 A;  4N4H A;  3M55 A;  4DA4 A;  3CCR T;  2E6N A;  1WHJ A;  3CCQ T;  3JCM h;  2KQW A;  2K2M A;  2MM2 A;  4ANJ A;  2DNU A;  3NTH A;  3P8B B;  4ZNX A;  1VUB A;  2PVO B;  4JS5 A;  4OF1 A;  3ZJV A;  2DZC A;  1YJN Q;  2E6Z A;  2OAW A;  5CQX A;  2RJF A;  3VUB A;  3SDZ A;  2DLP A;  5EG2 A;  2EYQ A;  2RH2 A;  2XKO C;  4X9D A;  1HK9 A;  2P0Q A;  5IXB A;  2O9S A;  1ABQ A;  2JM9 A;  1VQP Q;  2K9G A;  3ZGZ A;  1JXO A;  1AWJ A;  1HJD A;  3A8H B;  2RJD A;  3KFV A;  1PRM C;  3EGD B;  1N8R R;  4RTV A;  2P84 A;  3UAT A;  3RER A;  2HMA A;  4OB3 B;  1H64 1;  4O6J A;  4M75 A;  4AFS C;  2MAM A;  4M77 A;  1VQ9 Q;  4RUG A;  4M75 F;  5LJ5 g;  4RKU E;  2PUK B;  1JRI A;  2AT1 B;  2ED0 A;  3S3M A;  2B25 A;  4F14 A;  5FTL A;  2J6K A;  1AOJ A;  1IRE B;  1EFN A;  3L2R A;  3FRN A;  3M54 A;  1ZC1 A;  1E6G A;  7AT1 B;  4A63 B;  1ZSZ A;  3AT1 B;  1S72 A;  2DXC A;  2COY A;  1KFZ A;  3UA6 A;  2F1L A;  1VQ4 A;  1M8M A;  4N0A C;  1UEB A;  1YI2 Q;  3ME9 A;  3CPW P;  2Q1A X;  5KYW B;  2HKQ B;  3CCS Q;  1TUD A;  2DL8 A;  2I2L A;  2HBW A;  1I9G A;  3PIP A;  3VS7 A;  2NUP A;  1JJ2 A;  1SKU B;  2XID A;  1AD5 A;  2ECZ A;  3E19 A;  1K73 U;  4C92 G;  4RV0 A;  2DBM A;  2FYK A;  4E7J A;  2EW3 A;  4E6R A;  2LCC A;  2RN8 A;  1QVF P;  1YFN A;  3F70 A;  4KH1 B;  1JEG A;  3M53 A;  3OMG A;  2LMJ A;  5GAN 2;  4JJB A;  1K9M R;  2K3Y A;  3EGX A;  1M90 U;  1VQ6 A;  1T3L A;  1KHI A;  2AZS A;  4FSS A;  2LNH B;  4DBQ A;  1Q82 C;  1VA7 A;  1OU9 A;  2JMC A;  4IUT A;  4JRK A;  2L2P A;  3UDC A;  1VQ8 A;  3RDV A;  4LNP A;  4XK8 E;  5FTM A;  1UGV A;  4A4E A;  3JB9 G;  1HXD A;  1YWP A;  4JRI A;  4KGX B;  1M1K R;  4DBF A;  2HD0 A;  3DB3 A;  5HK3 A;  1PRL C;  5FWB A;  1OZ3 A;  1ZSG A;  3I9Q A;  1OEB A;  8AT1 B;  1Y71 A;  2M9U A;  2B86 A;  4BD3 A;  1G2B A;  3H6Z A;  5FU7 B;  2YUP A;  4KOD A;  3X24 B;  3L2U A;  4IUQ A;  1I1J A;  4BB7 A;  2QYZ A;  5IHN A;  3NPF A;  2JS0 A;  3HP9 A;  5A2Q E;  3CCU T;  1KC8 C;  2BZ8 A;  2F2V A;  3FJP A;  2L0A A;  3LHD A;  5KE2 A;  1UUE A;  3HRS A;  2DL7 A;  3BW1 A;  1M2V B;  4JRQ A;  4N0A A;  4MML A;  1AT1 B;  2VVK A;  3CCQ Q;  1BIB A;  1IB8 A;  3P8D A;  4C5G A;  1S3S A;  3BDU A;  2L3S A;  1GBR A;  2HDA A;  1OZ2 A;  1RI0 A;  1ZX6 A;  2CH4 W;  2DL5 A;  2JS2 A;  4M7D B;  2VGN A;  1M3A A;  2QI2 A;  1PKS A;  5KCO A;  5GAM j;  3A8L B;  1WLP B;  1K8A R;  3G71 Q;  2QAS A;  2YXY A;  3UF4 A;  3EFO A;  2FG0 A;  3VS3 A;  3VRZ A;  2WSE E;  3C94 A;  3OYI A;  1RAA B;  2LRQ A;  5CVI A;  3HRT A;  4BE0 A;  5GAM d;  2OTL Q;  2A08 A;  4E7K A;  3ZJU A;  1RAC B;  4C5H A;  4IIM A;  4LDV A;  3CPW A;  3TVT A;  2GGR A;  3OW2 S;  3EGD A;  1MNE A;  4F7U E;  2PVG B;  4M75 G;  1VQL A;  4RTZ A;  2JXB A;  1BBZ A;  5ECA A;  2JTM A;  4R55 A;  4M78 E;  1EX4 A;  4KGZ B;  1QVF A;  4PJO B;  3M0U A;  2LCS A;  5FU7 C;  3J7A F;  4HT9 A;  4HVU A;  1ARK A;  2XMF A;  1NEG A;  3LW5 E;  4FT2 A;  1W4S A;  4LUE A;  1R0B G;  2V8I A;  1Y07 A;  3G1J A;  1I5O B;  2MMP A;  2X35 A;  2MOX A;  1BI3 A;  1UJY A;  4DBH A;  2LX7 A;  3QYH B;  1MHN A;  1RAD B;  1W2B P;  5KH6 A;  2I0N A;  4Z02 A;  1GFD A;  3HFN A;  4J9G A;  3A1P A;  1Q86 C;  2LCL A;  1NJI R;  2RI5 A;  3CC2 A;  3OYC A;  2K57 A;  5CCA A;  4AMC A;  2NUT B;  3MCA B;  4FU6 A;  2MWP A;  2LQN A;  5KYW A;  4ESR A;  1OPL A;  2F69 A;  3V7S A;  5LJ5 f;  1BI0 A;  4F7U F;  4LD6 A;  1ZUU A;  1U5S A;  3WXM B;  1HD3 A;  3L2V A;  3I5R A;  2V1R A;  3PMI A;  2LX9 A;  4MZP A;  5GAO q;  1D3B B;  1FYN A;  4PJO D;  2OX7 A;  2JJ9 A;  4MZM A;  5J26 A;  3SEM A;  3HTR A;  1HYO A;  3UT1 A;  1GCQ C;  4LUD A;  2ZGW A;  4UC4 A;  1YP5 A;  1MV3 A;  5GJW B;  2CZ1 B;  1X6B A;  3CC4 T;  1WI7 A;  4XQ3 A;  3G6E A;  3DKM A;  3OYH A;  1K1Z A;  2DIL A;  2FZK B;  1VQ5 T;  3GIB A;  2KRS A;  1ZQ1 A;  1VQN A;  2LJ1 A;  3LGA A;  5M9O A;  3M58 A;  5GAM e;  4OGC A;  4XTU A;  3CCL T;  5CQY A;  1UHF A;  2JOY A;  5GAN e;  2RK1 A;  3MJX A;  4JJC A;  2LW6 A;  3EHQ A;  3CD6 T;  3QXE B;  2CUD A;  2DAQ A;  5CR2 A;  1VQO T;  2J05 A;  2QDY B;  4R56 A;  4PJO C;  2LT4 A;  2OTJ T;  3H8Z A;  2M02 A;  2QGG A;  1WFW A;  1BYM A;  1RLP C;  1BIA A;  2DD5 A;  4YTL A;  5FTK A;  2FHD A;  3REA B;  4IUP A;  2GBQ A;  2FPF A;  4Q5W A;  3VS2 A;  2DA9 A;  3QDF A;  4HVV A;  3FPT A;  3CCR A;  2KK4 A;  2DJZ A;  1M2V A;  4KO8 A;  4C8Q D;  4KDI A;  3SFM A;  1UG1 A;  1K73 C;  1K76 A;  2H3E B;  2HSE B;  2QEX T;  1ZA2 B;  3M0P A;  1VYU A;  4BI3 A;  3HFO A;  2K5F A;  2DL3 A;  3JCM g;  2F2X A;  4Y91 A;  2PTK A;  2D9T A;  1M90 C;  2PQW A;  4KBM B;  4M7D A;  4CRI A;  4M7D F;  2KRO A;  2V1Q A;  4XU3 A;  2DVE A;  1FMK A;  2CP3 A;  2Z0W A;  1NPP A;  3RKY A;  1F1B B;  1GCQ A;  3UPU A;  3OYF A;  3PIO A;  1AEY A;  1W2B A;  3G4S T;  2DYI A;  3UWN A;  1ZHI A;  4Z89 A;  3EG0 A;  3QWX X;  1WYX A;  1KQ1 A;  2C0O A;  2LJ3 A;  3RR6 A;  2K3B A;  3MET A;  1S72 Q;  3MP6 A;  5GMK i;  2JM8 A;  1PD1 A;  4C8Q C;  5ERG B;  3VS1 A;  1KQS S;  2ZCF B;  3QZ9 B;  1Q81 R;  1VQ4 Q;  4J83 A;  3G7Z A;  1WNL A;  5FRN A;  2YRC A;  3MP8 A;  1FMV A;  5GMK j;  4FW2 A;  1M4Z A;  3E9F A;  2IIM A;  2K2V A;  1Q7Y R;  2CSQ A;  4PJO A;  1C0M A;  1H3H A;  2DKG A;  5C0M A;  4FYY B;  1QW1 A;  2RB6 A;  2LZ6 B;  1YNZ A;  1U06 A;  2EQI A;  3I5S A;  1IHW A;  1VQ6 Q;  4JJD A;  1WHG A;  4AG2 C;  1O54 A;  4EIK A;  5EQJ B;  3O8V A;  4M7A A;  2DK3 A;  4ZGD B;  1T3S A;  4M7A F;  2CP6 A;  2J6O A;  3L2Z A;  3RBB B;  1KD1 R;  4F7U G;  2NUT A;  3NHN A;  2CZ6 B;  1K9A A;  4WF2 A;  1C6V X;  2E3H A;  4ORZ A;  4M78 G;  3OYL A;  2ABL A;  4IUV A;  5C1B A;  3OSV A;  2X3X D;  1D3B A;  2RM4 A;  2KI7 A;  2XDD A;  2KT1 A;  2KXC A;  1VQ7 T;  4MMK A;  3RMQ A;  4JLI A;  1D0Y A;  1M1K C;  1D1B A;  2EQU A;  2H3J A;  2ED1 A;  2RQU A;  3PT9 A;  2LVM A;  3VUZ A;  1H92 A;  1UGP B;  2RHI A;  2DXB A;  5LJ3 f;  1PWT A;  4EMK C;  2DIQ A;  1N9S A;  5CKE A;  3FJ5 A;  4FL6 A;  4KT0 E;  2ZPH B;  4BI8 B;  3OYA A;  1UHC A;  4XAX B;  1VQO Q;  1GRI A;  1Q7Y U;  2OTJ Q;  3H9N A;  5DYG A;  4CC3 A;  2VXE A;  3VV0 A;  1AWO A;  1AWW A;  2E3I A;  3NTI A;  2ZPF B;  3JV3 A;  4D8D A;  3CCU A;  1QMC A;  3QG1 A;  4M75 E;  4FSX A;  4M77 E;  2HQX A;  3O5Z A;  3LH0 A;  1PM3 A;  3MPU B;  4XTZ A;  5FW9 A;  1U3O A;  1B7T A;  5CKB A;  1UJ0 A;  4NOY A;  2MF2 A;  4QT7 A;  2M16 A;  2WSF E;  2J6F A;  2CGH A;  5CO7 A;  4LD9 K;  2XK0 A;  3FPR A;  2E65 A;  2E10 A;  3VYH B;  2HL3 A;  5GMK e;  4J7I A;  2D8H A;  1WGS A;  5IH2 A;  3EAE A;  4OML A;  2CDT A;  3PTA A;  2PU9 B;  4HT8 A;  1FWZ A;  4AQ7 A;  5IXF A;  2EYZ A;  2HCK A;  1UGR B;  1FXX A;  3OBY A;  1IHV A;  3H41 A;  1RAE B;  4M7D G;  4AFU C;  2KY9 A;  4M77 F;  3OYJ A;  1I4K 1;  1VQL Q;  3QUI A;  2SEM A;  5I11 A;  1WQW A;  2V26 A;  5IHK A;  3KUF A;  1YIJ T;  3JCM W;  4PFZ A;  4OVA A;  4J9H A;  2WAC A;  1TWB A;  4B9W A;  1XOV A;  2ZAE A;  2E1H A;  2DMO A;  1VQM T;  3CCE A;  1I07 A;  4GBQ A;  1N27 A;  3QPH A;  1AZG B;  2QQ9 A;  1TH7 A;  2FZC B;  2O2O A;  3TCJ A;  1LNX A;  1PC0 A;  1QVG P;  2DZ9 A;  2VKN A;  2C0I A;  1E6H A;  4JZ4 A;  2FB7 A;  5KYU B;  2YLB A;  3CC2 Q;  4R0K A;  2XDP A;  4BAC A;  3SWN B;  3JCM f;  3JCM V;  2DET A;  1WHK A;  2LT1 A;  4A53 A;  2PNI A;  1N5Z A;  1MMG A;  2DTI A;  3MP1 A;  2EYY A;  1BCO A;  2AIR B;  4ATO A;  1JQQ A;  2BE7 D;  1PD0 A;  1BKB A;  5IT9 E;  2CSI A;  1MMN A;  2KNB B;  2VUB A;  5GMK l;  2RMO A;  1N8R U;  2C0T A;  4KRT A;  2DEU A;  2RQV A;  1M2O A;  3ULR B;  5I21 A;  2EYW A;  5KYX B;  1O9S A;  4M7A G;  2IVW A;  1BI2 A;  1FMW A;  1OOT A;  5GAM h;  1XTD A;  5CD1 A;  5J3B A;  3G6E Q;  1GBQ A;  1WJS A;  2A0F B;  5GAN h;  1VQ7 Q;  4Y28 E;  2RI3 A;  2KRM A;  4OGE A;  2M1H A;  3CC4 A;  4EDU A;  2RA2 A;  1VQN Q;  4AG1 C;  2GFU A;  5DYI A;  3VYG A;  5GAN 4;  2LC4 A;  2EVR A;  2VXF A;  3LH5 A;  2QA4 T;  2Q18 X;  3RMS A;  1JJ2 S;  1VQ5 A;  3HU3 A;  1U1S A;  4PJM A;  2LQ8 A;  2RHY A;  4X34 A;  2M0O A;  3BQB A;  3CCL A;  4FYW B;  1JO8 A;  5LL6 S;  4LDX A;  3M0S A;  1D1A A;  3E1S A;  3HKS A;  3CD6 A;  3LGL A;  2BE9 B;  1VQO A;  3OS1 A;  2OTJ A;  1X43 A;  3ZL7 C;  1WA7 A;  1J3T A;  5DLO A;  5I2M A;  3DLM A;  1G8X A;  4LXC A;  3HRU A;  2HAX A;  3UA7 A;  1K9M U;  2MM0 A;  2CT3 A;  2EBP A;  2EGC A;  1R0C B;  2X51 A;  4KUI A;  3CCR Q;  5DM7 R;  2NUZ A;  1KQ2 A;  1BI1 A;  3SWN C;  3QWY A;  1VQK T;  2DIG A;  2CKK A;  2RQR A;  4HCZ A;  3QII A;  2QTX A;  3CCM T;  2HQE A;  2MK5 A;  1NBE B;  4PLI A;  5IN1 A;  1H3Z A;  2Y90 A;  4LN2 A;  1UGQ B;  2XD0 A;  3M0R A;  4ELY C;  2K5L A;  3CCV T;  2CH4 A;  4OMN A;  5A0L A;  4A4F A;  2X3W D;  5GAN j;  4QQG A;  1U8R A;  2QEX A;  3QKJ A;  1M1K U;  4Y92 A;  1CZ4 A;  1WX6 A;  2CYZ B;  3EHR A;  4RCC A;  3QHS A;  3M9Q A;  3RKX A;  4QW2 A;  4WCI A;  4KGV B;  1QQJ A;  4ZTF A;  2C06 A;  1Y96 B;  1Z9Q A;  3CC7 T;  3VS5 A;  1QVG A;  5GAN d;  2ZZD A;  1FX7 A;  5D6X A;  4PNO A;  3ZFJ A;  2K7A A;  3BE3 A;  2ZPG B;  1QWF A;  3TEE A;  2HSP A;  1VYT A;  1MMA A;  2AK5 A;  3G4S A;  4M77 G;  1MMD A;  1NEB A;  1WIE A;  1ZLM A;  1QCN A;  2OJ2 A;  1VQM Q;  3CCE T;  1YIT A;  3D7S B;  2X4W A;  1D0X A;  2KGT A;  3CF2 A;  2JMA A;  3PGG A;  2HZY A;  4JJN K;  2O31 A;  3EFS A;  4OB2 B;  2EGA A;  2JVV A;  1Q81 C;  3J80 E;  4L6V 5;  1VIE A;  3SB2 A;  1WLF A;  4KLN A;  3JB9 H;  2PUO B;  4E7S A;  1VIF A;  3EG2 A;  5CIU A;  2HKN A;  4BY6 B;  2QQR A;  4M4Z A;  2RJC A;  3RNJ A;  4E7L A;  3EH1 A;  3TQ7 P;  4C92 B;  1BB9 A;  1TXQ A;  1Q7Y C;  3CPF A;  2DXT A;  2NWM A;  1WHL A;  5LJ3 g;  2DF6 A;  2QGF B;  3LYI A;  3JRZ A;  2DXU A;  2X4Y A;  4XU1 A;  1NE8 A;  3OA6 A;  4QVD A;  5GAO p;  2GCX A;  1UFF A;  1WHM A;  1PCX A;  5KYU A;  3EG9 B;  1K8A U;  2P4T A;  3CBP A;  2AKL A;  2HNI A;  3CPW S;  3MO8 A;  2EPD A;  4LE9 A;  3CME T;  5GMK m;  2PVD B;  4A54 A;  1IZ6 A;  2Q1C X;  1YCS B;  4FT4 A;  4F17 A;  2SRC A;  3HPW A;  5GAN 7;  2DX1 A;  3TSW A;  3AHU A;  1UE9 A;  4OMO A;  3V8K A;  2EQK A;  2A36 A;  4PFO A;  3JSC A;  2FPD A;  2EFI A;  1Q82 R;  1X6O A;  1AZE A;  3MEW A;  3V7R A;  4C92 D;  1G5V A;  5KYX A;  1YHQ T;  1NG2 A;  3CMA A;  1SRL A;  2DM1 A;  1M30 A;  1IRX A;  2NLU A;  1VQ7 A;  4KUD K;  1S1N A;  3MHX A;  3R6N A;  2EYX A;  2CT4 A;  4CQN A;  4C8Q B;  2EJF A;  2E4H A;  2E64 A;  4PL6 A;  5KYY B;  2RHU A;  4J7F A;  4XU2 A;  1V76 A;  1RAF B;  1CR5 A;  4N4G A;  3FLG A;  3J81 E;  1YCY A;  5DLQ E;  1SPK A;  2E41 A;  1YJW A;  1P92 A;  1BK2 A;  3I56 T;  3OS5 A;  3CCU Q;  1M3B A;  2GF7 A;  4M7D E;  1SRM A;  1GXI E;  1T0J A;  5FTN A;  1I81 A;  5KYN A;  2MI6 A;  1ZUY A;  1G3Y A;  2D1X A;  1NJI U;  2O01 E;  4DQ2 A;  3JB9 D;  3SD4 A;  2E5Q A;  4MZT A;  4WTO B;  4BY6 C;  3I55 T;  3GF5 A;  1W1F A;  5GMK h;  4C92 C;  2MWO A;  3LWI A;  2XG8 D;  1KC8 R;  3DB4 A;  2A37 A;  4HCK A;  2RO0 A;  3QO3 A;  2CP7 A;  3OS2 A;  2JTF A;  5CCB A;  2EQJ A;  3MEV A;  3VU3 C;  4PJL A;  2L3P A;  2QTV A;  5CCX A;  2DTO A;  4J5Y A;  1PSE A;  4XTV A;  3L2W A;  3GBQ A;  1Y7X A;  3EGU A;  1LVK A;  2HL5 C;  5DY9 A;  4PK4 A;  2J7I A;  4AS1 A;  3V8L A;  1QP2 A;  3CCJ T;  2VGM A;  1OPK A;  2LQK A;  2KXD A;  1N8R C;  2O4X B;  1TUG B;  3QQ7 A;  1YWO A;  5FWC A;  1YJN T;  2L8D A;  4GLK A;  3JB9 J;  3ASK A;  2KDS A;  2COZ A;  2EIF A;  4M75 B;  2PWY A;  4XTY A;  5GAO n;  4OMQ A;  1VQP T;  4EMK B;  1NLO C;  2D8J A;  3X28 B;  4DEY A;  1YIT T;  3CCE Q;  1YIJ A;  4M7A E;  4KUL A;  2M0Y A;  1Y96 A;  2NYS A;  3FIF A;  1ACM B;  3IQL A;  4J9I A;  4EMH A;  4F16 A;  2P4R A;  2X4J A;  1X75 C;  4II1 A;  4FCY A;  1ZSZ B;  1VQM A;  2QG9 B;  1VQ9 T;  5LJ5 e;  2RHZ A;  4A4K A;  3VRY A;  5FTJ A;  3FPU A;  1OQK A;  5I2S A;  3CXC S;  4J9E A;  4FYX B;  4PJO F;  3PE0 A;  2BZY A;  1OU8 A;  4PFP A;  5L23 A;  2QXF A;  4M75 D;  3QBY A;  3JCM P;  4ELZ C;  3M59 A;  2COW A;  2DER A;  1JB0 E;  2JNG A;  4C92 A;  1N9R A;  1YI2 T;  4C92 F;  4JLG A;  1K9M C;  3S3N A;  2Q19 X;  1Q86 R;  3CCS T;  4LDU A;  1W2B S;  1WZO A;  2YDL A;  3DLL A;  2L3R A;  3EG3 A;  2DJQ A;  1E32 A;  2BKD N;  1I0C A;  1PSF A;  2VC8 A;  3EG9 A;  1WDX A;  4GY5 A;  1SF9 A;  1TG0 A;  1KG1 A;  2RQT A;  3GNG A;  2QQS A;  4HCB A;  2KSS A;  5B6C A;  1K0S A;  4L5G A;  3TRE A;  3CC4 Q;  3M56 A;  3NGP A;  3WVD B;  5CKH A;  2YSQ A;  2JW4 A;  3A8G B;  4C0F A;  5FRO A;  3CMA T;  2YUO A;  2EJG A;  4IKF A;  2LDM A;  3OYY A;  3OS0 A;  1VQ5 Q;  4N4I A;  1MGQ A;  1Q81 U;  1JU5 C;  4M75 C;  4RTX A;  5GAM g;  4JUV A;  5EPP A;  1Y57 A;  2A28 A;  4J6X A;  4DOV A;  3JCM J;  1WJR A;  2KYB A;  4EMG A;  3CCL Q;  3EFR A;  2VAS A;  3V8J A;  2QA4 A;  5GAN g;  3BDL A;  4QVC A;  1XQH A;  1YJW T;  3TSZ A;  1WQ7 A;  2HEQ A;  3ZBD A;  1QLY A;  3CD6 Q;  5FU6 B;  2XU8 A;  3L1A A;  3QZ5 B;  4C0G A;  4C8Q A;  1ZSZ C;  3R6O A;  4C8Q F;  2P0K A;  4FM4 B;  5KYY A;  2YUN A;  2EQM A;  1YN8 A;  2E12 A;  4RTU A;  2RHX A;  1BCM A;  2XDB A;  1A0N B;  1D1C A;  2MCN A;  4BE2 A;  2ROL A;  5GAN 5;  1B07 A;  1KD1 U;  1VQK A;  4HCC A;  2YRD A;  1G83 A;  4IIO A;  1RLQ C;  3CCM A;  4J9C A;  4AFQ C;  2AHJ B;  4RMO A;  2QEX Q;  1EIF A;  2F2W A;  1G3T A;  1NPR A;  3RES A;  3CCV A;  2QAZ A;  4Z8A A;  1K8A C;  3NTK A;  2FL7 A;  3CCJ Q;  3EFO B;  5FLX E;  3M5A A;  1K73 R;  1M27 C;  4OB0 B;  2LNV A;  1C1A A;  1KIK A;  4NL3 A;  4L59 A;  3HU1 A;  1G3W A;  3OW2 P;  5D7U A;  1RAB B;  2H8H A;  2QQB A;  3G4S Q;  3QQ8 A;  1X6G A;  3CC7 A;  3M57 A;  3JB9 I;  2EJ9 A;  1M90 R;  3G71 T;  5EC7 A;  1AHJ B;  1RAH B;  1RAI B;  1PNJ A;  1YIT Q;  1M3C A;  3C95 A;  2M51 A;  2O4X A;  3PMT A;  2FRY A;  4ARC A;  1LCK A;  1GFC A;  2K6D A;  4X1V A;  2OTL T;  3RKW A;  3QC8 A;  2OI3 A;  3GP8 A;  1M1F A;  2EKH A;  4EMK A;  3PNW C;  2FPE A;  5GAO m;  5FU6 C;  4MDW A;  4J8O A;  3HSB A;  1OX8 A;  4BUG A;  2RI2 A;  5D6W A;  3ZJT A;  2DPP B;  1I5L A;  2DYB A;  4D6W A;  1MUZ A;  3L2Q A;  1YJ9 T;  1VYV A;  4GLM A;  4JZ3 A;  2J06 A;  1QDN A;  5HY6 A;  4JS4 A;  1D09 B;  1SSF A;  3A98 A;  3LLR A;  2JUF A;  3M4G A;  4PJO G;  1K0X A;  4BE1 A;  4NL2 A;  1NJI C;  1ZBJ A;  1LOJ A;  1CZ5 A;  3OSS C;  1JXM A;  2ZPI B;  4F7U B;  2VB6 A;  3QWZ A;  4E47 A;  1V1C A;  2YUQ A;  4ME7 A;  4OMM A;  5GAN 3;  3M0Q A;  3CME A;  2HBP A;  5LJ3 e;  4M78 B;  4C5I A;  4IUU A;  2YUJ A;  5C18 A;  2DE0 X;  2F5K A;  1UB4 A;  3JCM d;  2DFU A;  4XTW A;  5FRM A;  2KMT A;  4CC7 A;  1X69 A;  2CP2 A;  3A8O B;  3CMA Q;  1WXU A;  2GFA A;  4QQ6 A;  4J6W A;  4EPC A;  1R7R A;  1UTI A;  2XI9 A;  3GLX A;  1SSH A;  2RQW A;  1YHQ A;  5GJV B;  4J9B A;  1T0H A;  5A0G A;  1TSF A;  2PZ1 A;  3HL8 A;  3KBG A;  4RG8 A;  1QCS A;  4PJJ A;  1YJW Q;  3PFS A;  2LJ0 A;  2RNA A;  1NM7 A;  2V8K A;  1OUL A;  3TU4 K;  5CKD A;  1MV0 B;  2O88 A;  2AZV A;  5CAI A;  3GPL A;  2G6F X;  1ZBX A;  1R8O B;  1OYX A;  1BU1 A;  1RUW A;  3C0C A;  4M78 D;  4A4G A;  3I56 A;  4JPB W;  1RI9 A;  2VWF A;  3CEY A;  3BFM A;  5CK9 A;  9ATC B;  1GL5 A;  2FEI A;  3FEO A;  2DTH A;  4C8Q G;  2EGE A;  2X9H A;  3MB5 A;  1ABO A;  3ZEH A;  3I55 A;  2K3X A;  3H0F A;  1OI1 A;  4C0D B;  2Q1D X;  1X27 A;  3OW2 A;  1M5Q 1;  1RL2 A;  4ZGE B;  3U23 A;  2E70 A;  4XU0 A;  2YRV A;  2CZ0 B;  4ZN3 A;  3OYB A;  1UDL A;  4C5E A;  1PG5 B;  4NS5 A;  5GAN 6;  5GAM f;  3OYE A;  6AT1 B;  1KK7 A;  1D0Z A;  2QK0 A;  3REB B;  1B34 B;  3THK A;  5GAN f;  2CZ7 B;  1CSK A;  2DRM A;  4M78 C;  4BI4 A;  3L42 A;  2PJH B;  3C4S A;  8ATC B;  5HCK A;  2JN0 A;  3CCJ A;  1CKB A;  3JCM c;  5J39 A;  2OAU A;  1N6A A;  2F5T X;  2ZPE B;  3X20 B;  5LJ5 h;  4HKE A;  2AKK A;  1WXT A;  1YJN A;  1EZZ B;  1QWE A;  1NLP C;  2LQW A;  3Q1J A;  1YIJ Q;  4JRP A;  1SEM A;  3JCM e;  3EH2 A;  2MPX C;  3VKI A;  3E2U A;  1VQP A;  4B6M A;  1KQS P;  1QKX A;  3OYM A;  1QVP A;  2KR3 A;  2JZ2 A;  2VYT A;  2ZPB B;  2JV2 A;  1TS9 A;  1VQ9 A;  2QQA A;  3CQT A;  3CXC P;  1M1G A;  4HXJ A;  4O5V A;  3OBW A;  5KCH A;  2D6F A;  1QCO A;  2VV5 A;  4F04 B;  2W10 A;  1YJ9 Q;  1ZUK A;  1S72 T;  1SG5 A;  2RJE A;  2R58 A;  4M7D D;  2RK2 A;  2KYM A;  4QVZ A;  2KAF A;  3OY9 A;  3FB9 A;  1M8V A;  1VQ4 T;  1MND A;  4HA8 A;  2ROT A;  2GNC A;  4HVW A;  1ZA1 B;  2A3L A;  2DO3 A;  1W70 A;  2CP0 A;  3SHW A;  2BIV A;  3H0H A;  3TIW A;  3GNF B;  1QVG S;  4RCB A;  3SWN A;  2KRN A;  3I35 A;  1IO6 A;  4ZGJ B;  4E7H A;  1Z9Z A;  1X2Q A;  4C0D C;  1YI2 A;  1Y0M A;  4P5N A;  2DRK A;  3RUX A;  3CCS A;  2DBK A;  4M7A B;  4E2F B;  3HHT B;  1KD1 C;  2CP5 A;  4BDY A;  2QDL A;  5A0D A;  4FYV B;  1QCF A;  5GAO r;  5LJ5 j;  1VQ6 T;  3FDR A;  2V8J A;  1W6X A;  3OMC A;  3VS6 A;  4F7U A;  1QVF S;  3BY7 A;  3EG1 A;  1NZ9 A;  3PVQ A;  2GQV A;  3VS4 A;  3QYG B;  4M78 A;  4M7D C;  4M78 F;  3A8M B;  4OB1 B;  3X25 B;  1VQ8 T;  4B9X A;  5LJ5 d;  4ARI A;  4QQD A;  3CBM A;  1M9S A;  2QA4 Q;  1OX9 A;  3LX7 A;  1XNI A;  3NMZ C;  4CC2 A;  2R5M A;  1NYF A;  2O9V A;  1LPL A;  2K79 A;  3VS0 A;  2K4Y A;  1WJQ A;  4RTW A;  4K11 A;  3V7C A;  4M7A D;  2P0P A;  4E7Z A; 
#chains in the Genus database with same CATH homology
 3CCE A;  1E32 A;  2BKD N;  4M7D B;  2VGN A;  4IUR A;  2QI2 A;  1PSF A;  1N27 A;  2VC8 A;  3QPH A;  3E9G A;  4GY5 A;  3T9N A;  1KG1 A;  5GLF A;  5KCO A;  2QQ9 A;  1TH7 A;  5GAM j;  3A8L B;  3ER0 A;  4LDY A;  3GNG A;  2QQS A;  2R57 A;  3TCJ A;  4HCB A;  1LNX A;  2KSS A;  5B6C A;  2DZ9 A;  4L5G A;  3TRE A;  3M56 A;  2CS7 A;  4XTX A;  2WSE E;  2FB7 A;  3C94 A;  2YLB A;  5L8R E;  5CKH A;  3WVD B;  3OYI A;  3A8G B;  1QP3 A;  2LRQ A;  5FRO A;  5CKF A;  3HRT A;  5CVI A;  4C0F A;  4BE0 A;  2EJG A;  3CMA T;  4IKF A;  2XDP A;  4BAC A;  3SWN B;  2LDM A;  1I8F A;  3JCM f;  3OYY A;  3OS0 A;  5GAM d;  4N4I A;  1JBM A;  3JCM V;  1MGQ A;  4E7K A;  2LT1 A;  4A53 A;  1Q81 U;  2EAY A;  2DTI A;  3MP1 A;  3INZ A;  4M75 C;  5HK0 A;  3ZJU A;  4PLL A;  1UGS B;  2LTO A;  4JUV A;  5GAM g;  5EPP A;  4C5H A;  4J6X A;  4TVR A;  4DOV A;  3JCM J;  2XIC A;  1WJR A;  4LDV A;  4EMG A;  3CPW A;  3EFR A;  4ATO A;  5AYF A;  3V8J A;  2QA4 A;  3OW2 S;  3JAM E;  5GAN g;  3BDL A;  4F7U E;  4QVC A;  1BKB A;  1XQH A;  1YJW T;  1WQ7 A;  2PVG B;  4M75 G;  3ZBD A;  5IT9 E;  4VUB A;  5FU6 B;  1Q82 U;  4CI0 C;  3LWH A;  1VQL A;  1KQS A;  5GMK l;  2VUB A;  4M7A C;  4MDX A;  1N8R U;  2JTM A;  2XU8 A;  3L1A A;  3QZ5 B;  3CCQ A;  4R55 A;  4C0G A;  4PJO E;  4M78 E;  4C8Q A;  3R6O A;  4OMF B;  1WPY A;  4C8Q F;  1O75 A;  1QVF A;  2P0K A;  4PJO B;  4FM4 B;  3QJ6 A;  5FU7 C;  2EQM A;  3J7A F;  4HT9 A;  5I21 A;  1O9S A;  2E12 A;  3LW5 E;  4FT2 A;  4M7A G;  1W4S A;  3CXC A;  2V8I A;  1Y07 A;  3JCM X;  2IVW A;  1BI2 A;  3C12 A;  5GAM h;  1B34 A;  1XTD A;  2MMP A;  2RHX A;  2X35 A;  5J3B A;  5CD1 A;  4M77 B;  1BI3 A;  1WJS A;  2XDB A;  3QYH B;  1MHN A;  3OYN A;  5GAN h;  4C92 E;  5KE3 A;  5KH6 A;  3G71 A;  4Y28 E;  4BE2 A;  2RI3 A;  4Z02 A;  2X4X A;  3JCM Q;  2Y4X A;  3HFN A;  5GAN 5;  4OGE A;  2M1H A;  4E7I A;  4EDU A;  3CC4 A;  1KD1 U;  2RA2 A;  2GFU A;  2LCL A;  3S3O A;  1Q86 C;  1VQK A;  5DYI A;  3VYG A;  1KHC A;  5GAN 4;  4HCC A;  2LC4 A;  2RI5 A;  3CC2 A;  3OYC A;  2VXF A;  2K57 A;  5GAO l;  5GAN 8;  5CCA A;  2QA4 T;  3RMS A;  1JJ2 S;  1VQ5 A;  2Q18 X;  2DD4 A;  3MCA B;  3CCM A;  4FU6 A;  2OTL A;  3HU3 A;  2MWP A;  3QSU A;  1U1S A;  2AHJ B;  4RMO A;  2LQ8 A;  4C0Z A;  2K5I A;  2RHY A;  1VQL T;  4X34 A;  2F69 A;  3V7S A;  1EIF A;  1BI0 A;  4F7U F;  5LJ5 f;  1G3T A;  4LD6 A;  2M0O A;  3BQB A;  1NPR A;  3RES A;  3CCL A;  3CCV A;  5LL6 S;  3MEU A;  3WXM B;  1K8A C;  3NTK A;  3L2V A;  4LDX A;  3PMI A;  1KC8 U;  2FL7 A;  2LX9 A;  4MZP A;  5GAO q;  1D3B B;  3E1S A;  3HKS A;  3VJP A;  5FLX E;  3CD6 A;  3M5A A;  2YHT A;  3LGL A;  4PJO D;  1VQO A;  4OB0 B;  3OS1 A;  2LNV A;  4ZTJ A;  2OTJ A;  4NL3 A;  1YBY A;  4L59 A;  4MZM A;  5J26 A;  1YJ9 A;  4V2S A;  2EKO A;  5LJ3 h;  3HU1 A;  1X01 A;  1G3W A;  5DLO A;  5D6Y A;  5I2M A;  4X9C A;  3UT1 A;  3DLM A;  4M77 D;  2QQB A;  3HRU A;  2HAX A;  3QQ8 A;  3CC7 A;  2D0Q B;  3M57 A;  3JB9 I;  2EJ9 A;  2ZGW A;  4UC4 A;  1K9M U;  2MM0 A;  3G71 T;  1AHJ B;  3N5B B;  3KXT A;  4KUI A;  2CZ1 B;  3LGF A;  4RG2 A;  5DM7 R;  1KQ2 A;  1BI1 A;  3CC4 T;  4DOW A;  4XQ3 A;  3SWN C;  3G6E A;  3QDR B;  3C95 A;  3OYG A;  2O4X A;  3PMT A;  3DKM A;  3OYH A;  1VQK T;  2DIG A;  2CKK A;  3CC2 T;  4HCZ A;  5HKC A;  4ARC A;  3QII A;  1VQ5 T;  2QTX A;  4C8Q E;  3OQ5 A;  3CCM T;  3QJY A;  2OTL T;  3GIB A;  2HQE A;  3RKW A;  3QC8 A;  1ZQ1 A;  1VQN A;  4PLI A;  5IN1 A;  3LGA A;  3GP8 A;  1M1F A;  5M9O A;  2Y90 A;  1G3S A;  3M58 A;  5GAM e;  1H3Z A;  1UGQ B;  4OGC A;  3PNW C;  4XTU A;  4EMK A;  2XD0 A;  3GOX A;  4ELY C;  2B8A A;  5GAO m;  3CCL T;  2K5L A;  5CQY A;  5FU6 C;  3CCV T;  5A0L A;  2JOY A;  4MDW A;  2RK1 A;  4A4F A;  5GAN e;  4J8O A;  3HSB A;  2LW6 A;  5GAN j;  4BUG A;  4QQG A;  3CD6 T;  2RI2 A;  3QXE B;  3QKJ A;  3URG A;  2QEX A;  5D6W A;  1U8R A;  2DAQ A;  3ZJT A;  2DPP B;  5CR2 A;  2A7Y A;  1VQO T;  1M1K U;  1I5L A;  4D6W A;  2QDY B;  4R56 A;  3FC3 A;  4PJO C;  2LT4 A;  2OTJ T;  3L2Q A;  3H8Z A;  1YJ9 T;  2XHC A;  1CZ4 A;  2CYZ B;  3OYD A;  4RCC A;  2L5Q A;  3QHS A;  1QDN A;  2BUD A;  3M9Q A;  3MEA A;  5HY6 A;  3RKX A;  4JS4 A;  4QW2 A;  3WVE B;  1BYM A;  1BIA A;  2EWN A;  1SSF A;  2DD5 A;  3LLR A;  2JUF A;  1Y96 B;  4YTL A;  3M4G A;  2FHD A;  4ZTF A;  4PJO G;  4M77 C;  3CBO A;  1QVG A;  3CC7 T;  5GAN d;  4BE1 A;  2ZZD A;  1FX7 A;  4NL2 A;  5D6X A;  4IUP A;  4PNO A;  1NJI C;  3ZFJ A;  2RD1 A;  3OYK A;  1LOJ A;  3S6W A;  2ZPG B;  3G6E T;  2YLC A;  3TEE A;  1CZ5 A;  3OSS C;  2ZPI B;  4FIB A;  4Q5W A;  3G4S A;  4F7U B;  4M77 G;  3QWZ A;  4E47 A;  4J6Y A;  2DEQ A;  3FPT A;  3CCR A;  4ME7 A;  5GAN 3;  3CCE T;  1YIT A;  2KK4 A;  2X4W A;  4ZN1 A;  2DJZ A;  2G3R A;  1VQN T;  4KO8 A;  3CME A;  2HBP A;  2IG0 A;  5LJ3 e;  3PGG A;  4C8Q D;  3CF2 A;  4KDI A;  4M78 B;  3SFM A;  4JJN K;  5LJ3 j;  3JCM b;  4JDS A;  1K73 C;  2L89 A;  2Y4Y A;  3EFS A;  2R5A A;  4OB2 B;  2JVV A;  4C5I A;  4IUU A;  1Q81 C;  2YUJ A;  5C18 A;  3J80 E;  2F5K A;  4L6V 5;  1UB4 A;  1VIE A;  3SB2 A;  1WLF A;  3JCM d;  4KLN A;  3JB9 H;  2FVU A;  2QEX T;  4XTW A;  2PUO B;  5FRM A;  4LDW A;  4BI3 A;  1VIF A;  2KMT A;  2WSC E;  5CIU A;  2K5F A;  3HFO A;  4BY6 B;  2QQR A;  3A8O B;  2RJC A;  3JCM g;  3X26 B;  4E7L A;  3NFC A;  4Y91 A;  3M4Y A;  4KDL A;  5IAY A;  2D9T A;  4BDZ A;  2PQW A;  1Q86 U;  1M90 C;  2GFA A;  4QQ6 A;  4KBM B;  4C92 B;  4M7D A;  4J6W A;  1DJ7 B;  5LJ3 d;  4CRI A;  2KVQ G;  4PKC C;  4M7D F;  4EPC A;  1Q7Y C;  3CPF A;  3P8H A;  1R7R A;  2XI9 A;  2DXT A;  3GLX A;  1V29 B;  4XU3 A;  5C6S A;  5LJ3 g;  1YHQ A;  2DVE A;  3LYI A;  3RIR A;  3JRZ A;  1U1T A;  2DXU A;  2X4Y A;  1NE8 A;  3A5Z B;  1NPP A;  4XU1 A;  3RKY A;  5A0G A;  4QVD A;  2GCX A;  3HL8 A;  1LJO A;  3KBG A;  4RG8 A;  4A4H A;  5GAO p;  1QCS A;  4OP0 A;  2YVL A;  3UPU A;  3OYF A;  3PIO A;  1W2B A;  3G4S T;  1K8A U;  3PFS A;  3UWN A;  3OB9 A;  1ZHI A;  4N4H A;  2V8K A;  2P4T A;  3M55 A;  4DA4 A;  3CBP A;  2E6N A;  3CCR T;  1KQ1 A;  3TU4 K;  5CKD A;  2HNI A;  3CCQ T;  5CAI A;  3GPL A;  3CPW S;  3MO8 A;  3JCM h;  3MET A;  3CME T;  2KQW A;  1ZBX A;  1R8O B;  3MP6 A;  1OYX A;  2MM2 A;  3NTH A;  3P8B B;  5GMK i;  4C8Q C;  5GMK m;  4M78 D;  1VUB A;  4A4G A;  2PVD B;  2PVO B;  3I56 A;  4JS5 A;  4A54 A;  1KQS S;  2ZCF B;  1IZ6 A;  2Q1C X;  3QZ9 B;  3CEY A;  4OF1 A;  3ZJV A;  4FT4 A;  2DZC A;  3BFM A;  5CK9 A;  2E6Z A;  4J83 A;  3HPW A;  5CQX A;  2RJF A;  3VUB A;  5GAN 7;  3G7Z A;  3SDZ A;  3AHU A;  1WNL A;  5EG2 A;  2EYQ A;  3FEO A;  2RH2 A;  2XKO C;  4X9D A;  2DTH A;  5FRN A;  4C8Q G;  3MP8 A;  1HK9 A;  2P0Q A;  2EQK A;  3V8K A;  5GMK j;  3MB5 A;  3JSC A;  3ZGZ A;  2EFI A;  1M4Z A;  3E9F A;  3ZEH A;  3HU2 A;  1X6O A;  3MEW A;  3V7R A;  3A8H B;  2K2V A;  2RJD A;  3I55 A;  4C92 D;  4PJO A;  1G5V A;  5FTK A;  2DKG A;  3RER A;  1YHQ T;  5C0M A;  2K3X A;  1QW1 A;  2RB6 A;  3CMA A;  1OI1 A;  4C0D B;  4OB3 B;  2Q1D X;  2NLU A;  1VQ7 A;  1H64 1;  3OW2 A;  1M5Q 1;  1RL2 A;  4O6J A;  4KUD K;  4ZGE B;  3MHX A;  4M75 A;  2MAM A;  4M77 A;  4CQN A;  4C8Q B;  2EJF A;  2E70 A;  4M75 F;  5LJ5 g;  4XU0 A;  4RKU E;  2E64 A;  4PL6 A;  2PUK B;  2YRV A;  1JRI A;  2B25 A;  2RHU A;  3S3M A;  2CZ0 B;  4J7F A;  4XU2 A;  4ZN3 A;  3OYB A;  4C5E A;  3OA6 A;  1CR5 A;  4NS5 A;  5GAN 6;  4N4G A;  3FLG A;  5GAM f;  3OYE A;  3J81 E;  1O54 A;  5FTL A;  1YCY A;  5DLQ E;  1IRE B;  1B34 B;  2E41 A;  3L2R A;  1YJW A;  1P92 A;  3FRN A;  3O8V A;  3M54 A;  5GAN f;  2DK3 A;  2CZ7 B;  4ZGD B;  4M7A A;  1ZC1 A;  4M7A F;  3I56 T;  3L2Z A;  3OS5 A;  4M78 C;  4BI4 A;  2GF7 A;  4F7U G;  4M7D E;  3L42 A;  1GXI E;  2PJH B;  5FTN A;  1I81 A;  2CZ6 B;  3C4S A;  2MI6 A;  1S72 A;  1G3Y A;  2DXC A;  2JN0 A;  3CCJ A;  1NJI U;  4WF2 A;  2O01 E;  3JCM c;  5J39 A;  4DQ2 A;  3JB9 D;  3SD4 A;  2E5Q A;  2OAU A;  1N6A A;  2F5T X;  4M78 G;  2ZPE B;  4IUV A;  4MZT A;  4HKE A;  3X20 B;  5LJ5 h;  1VQ4 A;  1YJN A;  5C1B A;  4N0A C;  4BY6 C;  1UEB A;  3Q1J A;  3OSV A;  3I55 T;  3GF5 A;  5GMK h;  1D3B A;  3ME9 A;  2RM4 A;  2Q1A X;  4C92 C;  2XDD A;  4JRP A;  3JCM e;  2MWO A;  3LWI A;  2I2L A;  2XG8 D;  3VKI A;  1I9G A;  3DB4 A;  1VQP A;  3PIP A;  2RO0 A;  1VQ7 T;  4MMK A;  3QO3 A;  3RMQ A;  4JLI A;  1JJ2 A;  2XID A;  3OS2 A;  1M1K C;  3E19 A;  1K73 U;  2JTF A;  4C92 G;  2EQU A;  2H3J A;  4RV0 A;  3OYM A;  3PT9 A;  5CCB A;  2FYK A;  2LVM A;  1QVP A;  2EQJ A;  4E7J A;  3MEV A;  3VUZ A;  2C06 A;  2JZ2 A;  3VU3 C;  2LCC A;  1UGP B;  2RHI A;  2VYT A;  2ZPB B;  5CCX A;  3F70 A;  2JV2 A;  2DXB A;  5LJ3 f;  3M53 A;  2DTO A;  3OMG A;  4J5Y A;  2DIQ A;  1N9S A;  4EMK C;  5GAN 2;  5CKE A;  1PSE A;  4XTV A;  3L2W A;  1VQ9 A;  2QQA A;  4FL6 A;  1Y7X A;  2K3Y A;  4KT0 E;  1M90 U;  1M1G A;  2ZPH B;  1VQ6 A;  4BI8 B;  3OYA A;  1KHI A;  4XAX B;  4O5V A;  3OBW A;  5KCH A;  1Q7Y U;  2D6F A;  2VV5 A;  5DY9 A;  5DYG A;  3V8L A;  2VXE A;  1QP2 A;  1S72 T;  1Q82 C;  3CCJ T;  2VGM A;  2RJE A;  4AS1 A;  3VV0 A;  1VQM T;  2R58 A;  4M7D D;  2LQK A;  2RK2 A;  3NTI A;  4IUT A;  1N8R C;  2O4X B;  2ZPF B;  4JRK A;  4QVZ A;  2KAF A;  3OY9 A;  3UDC A;  3QQ7 A;  3FB9 A;  1M8V A;  1VQ4 T;  3CCU A;  1VQ8 A;  1YJN T;  4HA8 A;  2L8D A;  3QG1 A;  4GLK A;  4M75 E;  4FSX A;  4M77 E;  3JB9 J;  3ASK A;  2HQX A;  2KDS A;  2PWY A;  2EIF A;  2A3L A;  4M75 B;  2DO3 A;  3LH0 A;  4XTY A;  5GAO n;  2BIV A;  3OYL A;  4XK8 E;  5FTM A;  4A4E A;  3JB9 G;  4EMK B;  1HXD A;  4XTZ A;  1VQP T;  3TIW A;  3GNF B;  1QVG S;  4JRI A;  4RCB A;  3X28 B;  5CKB A;  3SWN A;  4ZGJ B;  5ERG B;  4E7H A;  1YIT T;  4NOY A;  4C0D C;  1YI2 A;  1YIJ A;  2HD0 A;  2MF2 A;  3DB3 A;  4P5N A;  2M16 A;  5HK3 A;  4M7A E;  4KUL A;  2WSF E;  3RUX A;  1OZ3 A;  3CCS A;  1Y96 A;  3FIF A;  4M7A B;  4EMH A;  2CGH A;  5CO7 A;  4LD9 K;  2XK0 A;  2X4J A;  1X75 C;  3FPR A;  3HHT B;  4II1 A;  2E65 A;  1Y71 A;  2M9U A;  1KD1 C;  4BDY A;  4BD3 A;  1VQM A;  2E10 A;  5A0D A;  3VYH B;  3H6Z A;  5LJ5 e;  1VQ9 T;  2RHZ A;  5FU7 B;  4A4K A;  5FTJ A;  4KOD A;  5GAO r;  5LJ5 j;  1VQ6 T;  3FDR A;  2V8J A;  3X24 B;  3OMC A;  4F7U A;  5GMK e;  4J7I A;  1QVF S;  3FPU A;  5EQJ B;  1WGS A;  3L2U A;  3EAE A;  4IUQ A;  3BY7 A;  1NZ9 A;  4BB7 A;  3PTA A;  2GQV A;  5I2S A;  3CXC S;  2PU9 B;  4HT8 A;  1FWZ A;  3QYG B;  4AQ7 A;  3HP9 A;  4M78 A;  4M7D C;  4PJO F;  4M78 F;  3A8M B;  1UGR B;  1FXX A;  3OBY A;  4OB1 B;  3X25 B;  5A2Q E;  3CCU T;  1KC8 C;  1VQ8 T;  4B9X A;  3FJP A;  5LJ5 d;  4ARI A;  4QQD A;  3LHD A;  3CBM A;  5KE2 A;  1M9S A;  3JB9 F;  3HRS A;  3BW1 A;  2QXF A;  4M75 D;  4JRQ A;  4M7D G;  3QBY A;  3JCM P;  2KY9 A;  3LX7 A;  4M77 F;  1XNI A;  3OYJ A;  4N0A A;  3M59 A;  4ELZ C;  1I4K 1;  4MML A;  3QUI A;  1JB0 E;  2JNG A;  2R5M A;  4C92 A;  1N9R A;  1WQW A;  1YI2 T;  3KUF A;  1YIJ T;  4C92 F;  4JLG A;  3JCM W;  1BIB A;  2K4Y A;  3P8D A;  1K9M C;  1WJQ A;  4C5G A;  3S3N A;  4OVA A;  3BDU A;  3CCS T;  1S3S A;  4LDU A;  2Q19 X;  1W2B S;  2WAC A;  1OZ2 A;  3V7C A;  4B9W A;  4M7A D;  2P0P A;  3DLL A;  1XOV A;  2L3R A;  1RI0 A;  2E1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...