2GF7A

Double tudor domain structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
total genus 21
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gf7A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gf7A02
3ME9A 4IUPA 3PMTA 2L8DA 3OYIA 3NTIA 2G3RA 2E5QA 4IKFA 4IURA 2RJFA 3EAEA 2K3YA 3DB3A 2GFUA 2RJDA 3DB4A 2RI3A 3ASKA 4Q5WA 4A4EA 2XK0A 2FHDA 3OYLA 3GOXA 2EQKA 4BDYA 3NTHA 2DAQA 2RHUA 3L2RA 1SSFA 2RI2A 3LGLA 1KHCA 3OA6A 4X34A 2BKDN 3P8HA 3LH0A 2R5MA 4Z02A 3FEOA 3OYHA 2HQXA 2LDMA 4QQGA 2BUDA 3OS1A 3UT1A 2JZ2A 2RJCA 3H6ZA 4N4GA 3OYDA 4NS5A 2RJEA 3Q1JA 3L2WA 2O4XB 4IUUA 2MWPA 3PMIA 3L2QA 3NTKA 3OB9A 3MP1A 4LD6A 4C5HA 3QBYA 2JTFA 4RG2A 3MEAA 2IG0A 3OYMA 3QIIA 4N4IA 3OYAA 3OYKA 2X4WA 3L2VA 2HQEA 5D6WA 2E6NA 4A4FA 4C5GA 2WACA 4C5IA 1OZ2A 4PLLA 4GY5A 5KCHA 4FL6A 3L42A 2EQUA 3QJ6A 4ZTFA 2RHZA 3FDRA 2DIGA 4QW2A 3OYCA 4E7LA 3LLRA 3OYBA 2CKKA 3P8DA 2M16A 1N27A 4QQDA 3MEVA 2YRVA 3M9QA 2NLUA 4A4HA 4ZTJA 5M9OA 3OQ5A 4UC4A 4N4HA 2M1HA 4E7IA 1H3ZA 2D9TA 3E9FA 3PFSA 3OYNA 3S3NA 4PLIA 2XDPA 4A4GA 4L59A 5C0MA 3BDLA 2EKOA 2O4XA 2LTOA 4QQ6A 3OYJA 3UWNA 5D6XA 2LVMA 1WJQA 3S6WA 5FRNA 2EQJA 2L89A 2LRQA 3MEUA 3DLMA 4FU6A 3SD4A 4BD3A 1WJSA 2BIVA 3OMCA 4IUQA 4IUVA 3FLGA 5IN1A 5CIUA 3QKJA 2GF7A 2RHIA 2RHXA 5KE3A 1WGSA 1RI0A 2R58A 5IAYA 2F5KA 4BE2A 2MWOA 3OYFA 3LX7A 1OI1A 1WJRA 5J26A 2DIQA 2RI5A 5KCOA 4E7HA 1OZ3A 2LCCA 2X35A 3ZEHA 4PL6A 3OYEA 5J39A 3OYGA 4BACA 3MEWA 3MO8A 4QVZA 4EDUA 3META 2EQMA 4BE0A 5KH6A 3OY9A 3O8VA 2M0OA 3E9GA 5FRMA 2L3RA 2X4YA 4II1A 3CEYA 2RHYA 1MHNA 4BE1A 4CRIA 5C6SA 2QQSA 2EFIA 5KE2A 2B8AA 2GFAA 3PNWC 3FC3A 3S3OA 3F70A 4E7KA 3MP6A 3OMGA 5D6YA 2X4XA 4E7JA 1G5VA 2RO0A 4B9WA 4IUTA 1OYXA 3OS0A 3LGFA 3LYIA 3MP8A 2P0KA 4B9XA 2R57A 3S3MA 4C5EA 2R5AA 3C4SA 3OS2A 3KUFA 2K3XA 2VYTA 3L2UA 2PQWA 3H8ZA 2QQRA 4BDZA 1XNIA 5FROA 4HCZA 4OVAA
chains in the Genus database with same CATH superfamily
2RQWA 3VS3A 4J9BA 2ZAEA 4XTVA 1PWTA 2RI3A 4AFSC 3ER0A 1BCMA 4XK8E 3CCRT 3HTRA 4F7UE 2C0OA 2KR3A 1VQPA 3HU3A 3OS1A 5KYNA 2D1XA 1WXUA 1VQ4T 1YJNT 2QA4T 4RG2A 3OYMA 1UHCA 1M1KU 3GBQA 2E10A 4A4FA 3QQ7A 4M78F 3AT1B 4C5IA 3QG1A 4GY5A 1G3WA 1CZ5A 4C92E 1VQ7A 1TUCA 1X01A 3M9QA 1VQ4A 3VU3C 2OTLA 2QXFA 2ENMA 2EYWA 2M1HA 1ZSGA 4C0ZA 3V8LA 2YXYA 4D8KA 1M9SA 1Q82R 4KODA 4HA8A 3REAB 5HCKA 1YJ9T 2DL5A 5B6CA 5FRNA 4DBQA 1E6GA 3EG9B 4HCKA 3T9NA 4L5GA 2MI6A 4BD3A 4EMKC 4IUVA 2GCXA 4Z89A 1VQKA 1YNZA 2E70A 2R58A 1B34B 1C6VX 4J9HA 2F2WA 1UTIA 2ED1A 1WJRA 4M77D 2D0NA 1N9SA 2Y4YA 4OMPA 4ANJA 4JDSA 4PJOE 3INZA 1VQ5T 1MUZA 4ZGEB 1UGSB 4EMKB 2L3RA 1U5SA 3MB5A 1WDXA 2MMPA 1UECA 2DEQA 2L3QA 1TXQA 1UG1A 2QEXT 3M57A 4J7IA 1UJ0A 1VYTA 2BTTA 3HHTB 1N6AA 1VQ9A 1VQMQ 2F1LA 3CPWA 4PJOD 2CS7A 3FJPA 3JCMf 1ABQA 2K5IA 1KG1A 3LGAA 2E41A 3CMAA 2FHDA 3EG9A 3L2RA 1U06A 2M0YA 2EKHA 1SSHA 3TSWA 4CC3A 3HRUA 3OSSC 5EG2A 1YJNQ 1BYMA 1QDNA 2QTXA 3VS2A 2DYIA 3VS0A 1S3SA 3G6EA 3OB9A 4ARCA 2COWA 4Z8AA 4DOWA 2VVKA 5J3BA 4XQ3A 5IXBA 4QVDA 2M02A 2P84A 2DF6A 2LT4A 2JNGA 4PJOC 2RHZA 2GBQA 1KD1U 1TH7A 3JCMb 2JS2A 4LE9A 1N8RU 4LN2A 2E3IA 2YUOA 1ZSZC 4NOYA 2NUPA 3GF5A 4J6YA 2EKOA 2PVGB 4QQ6A 3TU4K 2J6OA 2JS0A 3GP8A 1GXIE 2A28A 4JRQA 4JS5A 4C92D 1YHQQ 4XTUA 4J7FA 2HAXA 2DYBA 1I5OB 2JVVA 5FRMA 3OW2A 1VQOT 3EFOA 3CC7Q 3RKXA 2EJGA 4KH1B 5C18A 1D1CA 5KE2A 2B86A 1IHVA 5GAOl 3H0HA 1K0SA 3VS6A 3EGXA 2KAFA 5CKFA 1PSEA 4B9WA 1KQ1A 3CCJT 3OS0A 2FO0A 1PM3A 1SHFA 2SRCA 1Q81C 1M8VA 4R0KA 1H8KA 1K9MR 3SFMA 2XI9A 3ME9A 1VQOA 1YWOA 2DD5A 2QDYB 1B7TA 2DNUA 4C92B 2DTIA 1Y07A 1OPKA 1WX6A 2GFUA 4Q5WA 5GAOm 2XKOC 4ATOA 4RKUE 3M56A 2EVRA 4JS4A 2RI2A 1QCNA 1KHCA 1NLPC 1IREB 3P8HA 2EJFA 3LH0A 4OMQA 3EGXB 4C0DB 1QP3A 2HSPA 3V8KA 4E47A 5FTKA 1MV3A 3CCLA 2G6FX 1VQNA 2CH4W 2K2MA 4PNOA 1RABB 3ZJTA 3X20B 2NWMA 3TSZA 4RTYA 2X4WA 3I9QA 2D0QB 3BY7A 3MJXA 4XU3A 1M90U 4C5GA 1RI9A 1G2BA 4PJOB 2YT6A 2CKKA 4J9DA 1KJWA 4A4HA 2D8HA 1K8AU 2LQWA 4PLIA 1V29B 3CPWP 3CCSA 2LTOA 3ZBDA 3CC4A 1NE8A 2EQJA 1F1BB 5DYGA 2VUBA 3SD4A 2K5FA 3OMCA 5CR2A 1JJ2S 2FEIA 1M1KC 3G4SQ 3CCST 2GF7A 5KE3A 1JU5C 3RR6A 3V7CA 2RI5A 1Q86U 1OZ3A 3ZEHA 1LCKA 3OYGA 2RK2A 4M77C 2X4YA 4II1A 3KFVA 3LW5E 3ZJVA 5C6SA 4F7UG 3M59A 2Y4XA 4GLMA 3CXCA 4E7JA 1VQMT 1X75C 1D1BA 4X9CA 2ZPIB 2DL4A 5GMKh 3G1JA 3FRNA 3H8ZA 1WLFA 1D0YA 3ZL7C 4HCZA 4C8QB 2DKGA 1CZ4A 1AT1B 4D6WA 1Y57A 1ZHIA 3P8BB 1WHJA 4PK4A 1PD0A 3VYGA 3GPLA 2HSEB 2JM8A 3LGLA 4ESRA 1ZLMA 1ARKA 2BZYA 4PKCC 1QVGS 3OYHA 3VRZA 2HQXA 4N4GA 1Z9QA 4M7AD 5LJ5d 3Q1JA 1W2BS 2KQWA 2O4XB 3TQ7P 4OB1B 1QCSA 4DBHA 3QBYA 1M4ZA 9ATCB 1W2BA 1QVFP 3EG0A 5C1BA 2E6NA 3NFCA 2DRMA 4BI8B 4KGVB 1JQQA 3HFNA 1O75A 5GMKj 4HVWA 4J9GA 3CF2A 4KDIA 1H3ZA 1UGRB 2EPDA 1M1KR 2QA4A 2EGAA 5HY6A 2P0QA 2KRMA 2VASA 5CO7A 2DTHA 1WHMA 4J9CA 4J9EA 2I0NA 4FU6A 3DLMA 3VUZA 2JUFA 1SEMA 3I56T 1YJWT 4M78E 5IN1A 4J6WA 2F5KA 2Q1AX 2XICA 5CCBA 4CC4B 4BACA 2E5KA 3EFOB 1Y0MA 4BE0A 3OY9A 1KHIA 4M7AE 3M0QA 1WLPB 4ELYC 2HNIA 2RNAA 2MYSA 2EFIA 3A5ZB 4HCCA 4BY6B 5D6YA 5IHNA 2B25A 2DXUA 4MZTA 2K4YA 1WNLA 8AT1B 2DXCA 2P0PA 2KYBA 5AT1B 4HVUA 2L8DA 2MPXC 3VS7A 1YJNA 4C92F 5GANe 4RTWA 3OYLA 3FPUA 1I81A 3H0IA 4XU1A 2E64A 1ZSZA 4ZGDB 5I22A 4FCYA 3G71T 3QWZA 5FTNA 2KBTA 1YITQ 4NL2A 2VXEA 2L2PA 3URGA 1X43A 2W10A 1QQJA 1KK7A 5KYYA 2KVQG 2RPNA 4DBRA 4OB0B 2JTFA 4O5VA 3M5AA 1YJWA 5ECAA 3OYKA 1HK9A 3EFRA 1OZ2A 4M7AC 5FTMA 3RUXA 2CT3A 5LJ5h 1Q86C 4AT1B 1TOVA 4XU0A 1K73U 2RF0A 2QEXA 2CP2A 4JRKA 4LDYA 4N4HA 1AWJA 2AZSA 2KNBB 4IIOA 2L5QA 3ZFJA 1BIBA 1VYVA 3FPRA 3QC8A 2OTJA 1VQMA 3WVEB 5LJ5g 2WSCE 5LJ3g 2MAMA 1M8MA 3OBWA 4FYVB 3U23A 4M7AG 1VQLT 3G4ST 3CCSQ 2LJ3A 4KULA 4M75B 1KQSP 3V7SA 2NUTB 1UB4A 2EW3A 3M0TA 2YLCA 1G3SA 3GIBA 4RCCA 2EQMA 2XG8D 4JZ3A 2HEQA 1C0MA 3X24B 1P92A 1N5ZA 4CRIA 2XD0A 3I5RA 2HBPA 3QXEB 2XMFA 4HXJA 3BFMA 3CCVA 2AZVA 6AT1B 2R57A 4MMKA 4C5EA 3C4SA 1MMDA 3X25B 3GLXA 3UPUA 3CC2T 4DA4A 2V8IA 2L0AA 4OVAA 3WVDB 2MK5A 1M2OA 1QMCA 3HKSA 3QPHA 1WHLA 3I35A 1MMNA 2VGNA 1ZBJA 2ECZA 3ASKA 2OX7A 3GOXA 1QWFA 2DAQA 4FT2A 2E65A 2R5MA 1M2VB 2O9VA 4FW1A 2V1RA 4QQGA 2ATCB 3UT1A 5GAOq 3QWYA 2EQIA 4NS5A 3LWHA 4M77A 1E7OA 2MWPA 1I07A 2LC4A 4C5HA 3I56A 2YUPA 1SHGA 4XTYA 1MGQA 2HQEA 2KROA 4JRIA 4M77E 4OMNA 2PZ1A 4C8QF 2A3LA 3JV3A 5GAOr 5CQYA 1NG2A 3CBOA 4K11A 4ZTJA 4QVCA 2D9TA 3CCEQ 2VB6A 2W0ZA 3KBGA 4AMCA 2Q18X 1YJ9Q 1CKAA 2KSSA 4JJNK 2HKQB 4EIKA 2HDAA 5CD1A 4M7AF 3EFSA 3M4YA 2JTMA 3FB9A 1FMKA 1T0HA 2K6DA 4M78A 4EPCA 2ZZDA 4JJDA 2EGCA 2LCCA 3X26B 3AHUA 5FLXE 1M2VA 3MEWA 3HRSA 5KH6A 1IRXA 1ZC1A 2NUTA 4A63B 1YN8A 2V26A 4C0DC 4R55A 3SEMA 1QLYA 3EHRA 3S3OA 1YJWQ 2DEUA 4PJLA 1HXDA 1QKWA 2XHCA 1N9RA 2LCLA 3M0UA 2JTEA 4LUEA 3LH5A 3RDVA 4MZPA 1PKSA 1VQKQ 2COZA 2J7IA 4DOVA 5EC7A 2KE9A 3CCJQ 2BE9B 2HMAA 2ROLA 1K9MC 3JB9H 2DM1A 1WQ7A 4O6JA 4KGZB 3DB4A 2O31A 4LNPA 1X6GA 2KRNA 4N0AA 2E12A 1W70A 1KQSA 5GAN8 1BBZA 5IHKA 1VIEA 2RJEA 2QGFB 4IUUA 2QG9B 2DX1A 3NTKA 5GAN6 5KYUA 1NJIC 2CSQA 2ROTA 3OYAA 4X1VA 1JEGA 2VV5A 4C92A 2DRKA 1B07A 2BZ8A 3SWNA 1KD1R 1RAAB 3V8JA 1AVZC 3CCMT 4M7DG 1Q81U 1FMWA 2AIRB 3I56Q 1VQPT 4DEYA 2V8KA 3OBYA 1EZZB 2ZPBB 2DMOA 4OF1A 1KSWA 1E32A 1M27C 3CMAQ 4OMOA 1D0ZA 4HVVA 3UDCA 2X4JA 2HL5C 3HFOA 1KC8U 4F17A 1OQKA 3OYFA 3LX7A 4KLNA 3JCMQ 3JCMe 1X2KA 1I0CA 1VIFA 2IVWA 4PL6A 4M78D 3I55A 2XDBA 5IH2A 2X3WD 4BUGA 2LW6A 3OS5A 2KK4A 5FU7C 3UA7A 1AD5A 3CMAT 3F70A 1IGUA 1KC8R 1J3TA 1EX4A 1WXBA 3JCMJ 5GANh 2WSEE 2ZPEB 2LT1A 1FYNA 2KT8A 3HP9A 3G4SA 1AZGB 5GAMd 4FSXA 1SF9A 2X9HA 1FWZA 1NLOC 4LDUA 1ABOA 1UUEA 1VQPQ 1BKBA 2JW4A 1K9AA 2KT1A 1VQ7T 3SDZA 5I21A 2G3RA 2CREA 4B6MA 3L1AA 4IURA 2MM2A 2KRSA 1Q81R 4HT8A 1M3CA 3DB3A 4OMLA 2DE0X 3SHWA 5I2SA 2HQHA 2RD1A 2F2XA 1WA7A 4M75C 4PFZA 1SSFA 2DVJA 4OMMA 3VS5A 3MPUB 4LDVA 3CXCS 2YLBA 3I55T 5GAMf 2JT4A 2ZPGB 4ZN1A 4EMHA 2CUBA 4PJNA 1X69A 1VQ8Q 4M7DE 2K9GA 3TVTA 3L2VA 3QZ5B 1X27A 3THKA 2EQUA 5FWCA 5KYUB 2DIGA 2V8JA 2M16A 4J8OA 1PNJA 3J7AF 1GFDA 2NLUA 2DZ9A 2FPDA 4EMGA 1D09B 5HK0A 3PFSA 2KDSA 2V1QA 2DXTA 4RTVA 3M0PA 2LVMA 1WJQA 5AYFA 1G3YA 2K2VA 1JBMA 1A0NB 4XTZA 1WGSA 1RI0A 5IAYA 1NEBA 3PVQA 3GNFB 2NUZA 2QI2A 2YUQA 3C12A 1QVGP 2WSFE 3FPTA 2LJ1A 3LHDA 2OI3A 2QQSA 4GLKA 1TUDA 2AK5A 2GFAA 1UDLA 5CCXA 2RO0A 4MMLA 4RCBA 3LGFA 4C8QA 1QVFS 1LPLA 5GMKl 2PTKA 3OS2A 5GAMe 4J6XA 4ELZC 2ESWA 1U1SA 2OTJT 2NUPB 1PRMC 1VQ6A 2RJFA 4A4KA 3JCMg 5LJ3j 4C0GA 3OA6A 5A0GA 3CCEA 2FZCB 4X34A 5KYXA 4YTLA 3OYDA 2H3EB 4QT7A 4J5YA 3CC7T 4VUBA 3PGGA 2X3XD 3L2ZA 1HSQA 1NBEB 2IG0A 2F69A 3ULRB 1K9MU 2K79A 2RQVA 1FMVA 2DL8A 4C8QG 5GMKm 3GNGA 5KCHA 4PJOG 5GMKi 2VGMA 2M51A 3CC2A 1OULA 2FPEA 1PKTA 1TS9A 1Q82C 1IO6A 2KY9A 4C8QD 1BI0A 2DL3A 4FYYB 1SKUB 3EH1A 3OYJA 3UWNA 5D6XA 3S6WA 4XTXA 3RIRA 1VYUA 2DBMA 3MEUA 5I2MA 2BIVA 1Q7YC 4FSSA 4DBFA 5I11A 3QKJA 3VS4A 2CZ7B 4HCBA 5J26A 3WXMB 2RQUA 3MO8A 1M90R 1N8RC 2X51A 2ZCFB 4CI0C 2LQ8A 1WQWA 1VQ9T 2AT1B 1ZUUA 1JB0E 4C92C 2RMOA 2B8AA 2D8JA 2J05A 3OMGA 1M5Q1 4A54A 2C0IA 1VQ7Q 4B9XA 3OW2P 1LNXA 1UHFA 2EYYA 2CZ6B 2LJ0A 3REBB 3TEEA 2PQWA 5FU7B 4RUGA 5IXFA 4ARIA 3M54A 4IUPA 4OGEA 1WHHA 3NTIA 1Y96A 5A0LA 5HKCA 4C92G 2GQVA 5CAIA 3OYYA 2XK0A 1NPRA 1BI2A 1K73R 2XDDA 5L23A 3J81E 3A1PA 3PE0A 2FYKA 3QO3A 5FW9A 1BCOA 1TSFA 1GFCA 4OB2B 2MCNA 2BUDA 2QEXQ 1X2QA 3L2WA 2CP3A 1YJ9A 1KQSS 5CKDA 3JB9D 1UGPB 3CPFA 4M77G 1GCQA 1RL2A 1MNDA 3RKWA 1ZUYA 5D6WA 5GJVB 2EYZA 4F14A 1WI7A 1LJOA 3QJ6A 2RK1A 1PC0A 3OYCA 4FIBA 3RERA 3JB9G 1EFNA 2DFUA 4QQDA 1HJDA 2JMAA 1NZ9A 1PHTA 2O88A 5M9OA 3OQ5A 1TUGB 4FYXB 2M9UA 3EGDA 2LZ6B 2C0TA 5GAN4 4KT0E 4DQ2A 2PWYA 5C0MA 4DEXA 1DJ7B 4Y92A 3N5BB 2MF2A 3PIOA 1K0XA 1U8RA 5DM7R 1PG5B 1N8RR 1YWPA 2ZPFB 1RAEB 1RAFB 2EBPA 1I5LA 1NJIR 4CC2A 3NHNA 2DIQA 4E7HA 4GBQA 3CBPA 3MCAB 3RESA 4QVZA 1GBQA 2PUKB 2COYA 1MV0B 5GAOn 5GAMh 4M75A 2PVDB 2RHYA 3QDFA 1RAIB 3EGDB 3C95A 1W6XA 3TIWA 4F7UB 5KYWB 2CP6A 3VJPA 1OX8A 2BZXA 4N0AC 1IGQA 3CCVQ 2Q1DX 2QDLA 2GTJA 2K3BA 3CCRA 1SRLA 4XAXB 4AFZC 3BQBA 3SWNC 2PNIA 2DETA 3FIFA 1NEGA 4M78B 1T3LA 3CCVT 4BB7A 3CMEA 4IKFA 1VQLA 3QDRB 2RQRA 2RN8A 3CD6A 3QQ8A 2RJDA 2YRCA 1I9GA 1S72Q 1Q95G 2RHUA 2RQTA 3QZ9B 2LCSA 1KC8C 2O9SA 2JJ9A 2BKDN 3FEOA 5FWBA 2LP5A 1YHQT 2KYMA 2RJCA 5LJ5e 1CSKA 5GAN7 1BK2A 4JJBA 2DK3A 2E4HA 5GAMj 3VKIA 4BI4A 4M77F 3QIIA 1KQ2A 1M30A 1JXOA 4RTZA 3CCET 4E7LA 3P8DA 4WCIA 2KXDA 2LQKA 3CC4T 4UC4A 3QUIA 5LJ3d 3JB9J 2YUNA 4EMKA 1YFNA 1B3QA 1XJWB 3BDLA 2Z0WA 1O9SA 2BE7D 1R0CB 4MZMA 2LX7A 4KH0B 4C8QC 1V76A 3FLGA 5GAMg 1JO8A 3CCJA 1T0JA 3A8LB 4TVRA 5DYIA 1KIKA 1YP5A 1JJ2A 3CMEQ 3M53A 2OAUA 4AFUC 3OYEA 3M4GA 1WHKA 2CYZB 2KI7A 1UJYA 4FM4B 2DL7A 2F2VA 4KUIA 1I8FA 1G8XA 1WPYA 3EG3A 1Q86R 2LQNA 3RBBB 3CCUT 3FC3A 2K7AA 2J6FA 1E6HA 3JCMW 1G5VA 2XU8A 2VWFA 4MDWA 4ZGJB 1UFFA 4LDXA 5GMKe 2DTOA 2MOXA 1RACB 1AHJB 3JSCA 1B34A 4M75E 2YVLA 3G71A 1VQ4Q 3UA6A 1JRIA 2O01E 1QCFA 1K8AR 1G3TA 4IIMA 2J06A 1VOMA 2FZKB 4LD9K 1VQ5Q 2A37A 3CBMA 2GGRA 3BW1A 3H41A 1M3BA 3R6NA 2EGEA 2JZ2A 2SEMA 1OOTA 3CCUQ 4FYWB 4RV0A 3C94A 3G6ET 2QTVA 2F5TX 4PJOA 1RLQC 1QVPA 4XTWA 3A8OB 4J83A 2FB7A 1S72T 2Y90A 2CP0A 4QW2A 4XU2A 2L3PA 1IXDA 1WXTA 1XQHA 2FG0A 4J9IA 4M7DF 2FPFA 2CGHA 2K57A 2FVUA 2ED0A 1IB8A 3C0CA 2CP5A 2RM4A 4L59A 1BIAA 2AHJB 5IT9E 2CDTA 1NM7A 4AG1C 1WJSA 4Y91A 3M0SA 4M7AB 4E7SA 4KUDK 1AWOA 2Q1CX 2YUJA 4RTTA 2QAZA 2XIDA 1YCSB 2KEAA 1ZX6A 3CCLQ 2L3SA 2DLPA 4M77B 4AFQC 3RNJA 4F7UA 5KYWA 1NPPA 2JN0A 5GAN3 2A7YA 1G83A 3M58A 4JPBW 1NYGA 3CEYA 3CXCP 1RAHB 4BE1A 2IPOB 2P4RA 2A0FB 3O5ZA 4F7UF 3JCMP 1BI3A 1S1NA 4AS1A 3E2UA 5LJ5j 2CZ0B 4IUTA 2YSQA 1WHGA 2EIFA 1YITA 1CKBA 2OJ2A 2E1HA 3KUFA 1YHQA 2QQRA 4E7ZA 2YHTA 1XNIA 2OTLT 5FROA 1TG0A 5CCAA 2FRWA 3ZGZA 5D7UA 3EG2A 5LJ3e 1OPLA 1TTHB 3I55Q 2EYQA 1X6OA 1ZBXA 4A4EA 3CD6T 4BDYA 5EPPA 5CKHA 3JCMV 5CK9A 1R8OB 4JJCA 3EH2A 4RG8A 4ME7A 2GTOA 2LDMA 4R56A 4M7DA 1MMAA 4Z88A 4X9DA 3HU1A 2JMCA 2QQBA 5HK3A 1PRLC 1VQ6T 1UGVA 1PCXA 1K73C 1Y96B 3RMQA 2CP7A 1AEYA 3FJ5A 1V1CA 2VC8A 3JAME 3G7ZA 2C06A 4PLLA 1AZEA 1RAGB 3L42A 5FU6C 3CC7A 1QP2A 3JB9F 1GBRA 4LXCA 3PIPA 2QGGA 3S3NA 3OYNA 5CKBA 3CCQA 1BB9A 1AOJA 4LDWA 4HT9A 2PJHB 1FXXA 2PU9B 1SRMA 2L89A 2LRQA 3UF4A 4BY6C 1GCPA 4C8QE 5CIUA 2NYSA 4M75F 4WTOB 2IIMA 2MWOA 4BE2A 2AKKA 3MHXA 1OV3A 2GNCA 3QYHB 4AG2C 2M0OA 5LJ3f 1PSFA 2RH2A 4NL3A 3E19A 1D0XA 1H3HA 3MP6A 2H8HA 3D7SB 5GAOp 2X4XA 4CQNA 3HU2A 1XTDA 1OYXA 2P0KA 1IZ6A 1U3OA 2K3XA 2VYTA 3JRZA 2ZGWA 1Q82U 3VYHB 4P5NA 1D3BB 4KBMB 1RLPC 1LVKA 3VS1A 1ZA2B 2HD0A 2H3JA 2K3YA 4RTXA 1Q7YU 3CC2Q 3A98A 5ERGB 3NTHA 3NPFA 3RKYA 4KO8A 1TU0B 1K4US 2HL3A 1YI2Q 4Z02A 1RUWA 1VQ6Q 3LWIA 1M90C 3PMIA 3RMSA 3MP1A 3HPWA 2DVEA 3MEAA 1VQKT 1WIEA 4JLGA 1TWBA 3QYGB 4ZTFA 5FU6B 1ZSZB 2OAWA 3DKMA 3LLRA 3OYBA 2LMJA 4MDXA 2DJQA 1R77A 3CCMQ 4E2FB 2OTLQ 1CR5A 4ZN3A 3OW2S 2O4XA 4M75D 5FTLA 2FZGB 4V2SA 3TCJA 2JXBA 3HL8A 1UE9A 4IUQA 1ZA1B 4J9FA 3E1SA 1OU9A 2YWWA 1MNEA 3HSBA 2DJZA 1QWEA 4WF2A 3V7RA 1HYOA 4M75G 2CT4A 2J6KA 3EG1A 2HZYA 1VUBA 5KCOA 1YCYA 2DXBA 4JZ4A 1I4K1 2DERA 3META 3O8VA 3E9GA 4PJMA 4QKUA 3KXTA 1O54A 2DILA 3CCLT 1GL5A 5CKEA 1MHNA 4KDLA 1OEBA 4M7DD 2D6FA 2EYXA 1YITT 5KYXB 3JCMc 2VKNA 3CPWS 5DLOA 1W4SA 1K8AC 1VQ8A 2FRYA 1H641 1Q7YR 3QJYA 1JJ2P 2PUOB 2RB6A 4A53A 3OYIA 1M1FA 5GAN2 3A8GB 4M4ZA 2E5QA 3X28B 1U1TA 1YBYA 2DPPB 3CCUA 3CC4Q 4M7AA 3H9NA 1VQOQ 2LNHB 2EQKA 1YI2T 2KMTA 1K76A 3ZJUA 1X6BA 1AWXA 1NJIU 3VUBA 1HD3A 1VQ5A 5GANj 2HBWA 1WYXA 4C0FA 1W1FA 1ACMB 2DA9A 3H6ZA 3HRTA 5CQXA 1R0BG 5LL6S 1OX9A 2KXCA 4L6V5 1SPKA 2K5LA 3CQTA 4RTUA 4RMOA 4LD6A 2DBKA 3BE3A 1YI2A 1RADB 3DLLA 8ATCB 1BI1A 2ABLA 2HCKA 2DO3A 4FL6A 5CVIA 4ZNXA 1OU8A 3MEVA 2YRVA 3A8HB 1WZOA 1M1GA 1QCOA 2MIOA 3E9FA 4F04B 4A4GA 5GANg 7AT1B 2YDLA 2QK0A 4ORZA 1WFWA 3SWNB 1JXMA 1BU1A 3QSUA 4KRTA 1Z9ZA 5FTJA 4OB3B 1W2BP 1QVFA 1QW1A 1ZQ1A 2DZCA 3UATA 2RHIA 2RHXA 3M0RA 3MKDA 2VXFA 1OI1A 3JCMh 4JLIA 5GANf 5GAN5 1YIJT 1YIJQ 3R6OA 1QVGA 4AQ7A 5EQJB 1UEBA 3CMET 3H0FA 3BDUA 3CCQT 1H92A 2EJ9A 2YRDA 3G6EQ 5LJ3h 3VV0A 3CCMA 4OMFB 3EHQA 1EIFA 1R7RA 2JV2A 3LYIA 4PFPA 4LUDA 1S72A 3I5SA 2E3HA 1XOVA 3NGPA 1ZUKA 3VRYA 4BDZA 2QQ9A 1Y71A 3NMZC 2LX9A 1UGQB 2JM9A 1FX7A 3PMTA 3OSVA 5GLFA 3EAEA 4CC7A 2RA2A 1GRIA 4Y28E 1VQ9Q 3CCRQ 3G71Q 2QASA 4OGCA 1VA7A 1D3BA 2AKLA 2QQAA 1YIJA 1Y7XA 2FL7A 3TREA 3JCMX 1C1AA 2I2LA 3IQLA 2MM0A 1SG5A 3PTAA 1VQLQ 1K1ZA 3L2QA 3CCQQ 4KGXB 2EWNA 1VQNT 4FW2A 5DY9A 2GQIA 4N4IA 3PVLA 4M78G 2LNVA 2JOYA 2WACA 4PJJA 5KYYB 3FDRA 4PJOF 4E6RA 1NYFA 5A0DA 1MMGA 4JRPA 1N27A 1M3AA 5GANd 3QWXX 1T3SA 2EAYA 3M55A 2Q19X 2KGTA 4M7DB 1KFZA 2A08A 2HKNA 4E7IA 2CH4A 2XDPA 5GJWB 3EGUA 2ZPHB 2A36A 3QHSA 4BI3A 4M78C 2QA4Q 1GCQC 4F16A 1LOJA 1D1AA 4D8DA 2O2OA 2QYZA 1AWWA 2P4TA 3JCMd 2X35A 1KD1C 5J39A 4JUVA 3J80E 4EDUA 4FT4A 2PVOB 3JB9I 4PFOA 2CZ1B 4OP0A 1I1JA 2CUDA 5DLQE 3CD6Q 2E6ZA 3PNWC 4E7KA 3PT9A 3SB2A 2DD4A 2OTJQ 1IHWA 3MP8A 3A8MB 4M7DC 3S3MA 2R5AA 1QKXA 5A2QE 3L2UA 5LJ5f 1VQ8T 5L8RE 4HKEA 1VQNQ 1PD1A 2CSIA 5IHIA
chains in the Genus database with same CATH topology
1U1SA 2OTJT 2L8DA 5LJ3e 1YJNA 2RJFA 1VQ6A 4C92F 4A4KA 5GANe 4XTVA 2EYQA 3JCMg 2RI3A 1X6OA 1ZBXA 4A4EA 3CD6T 3OYLA 3FPUA 1I81A 3ER0A 4BDYA 5EPPA 5CKHA 4XU1A 4XK8E 5LJ3j 2E64A 3JCMV 4C0GA 4ZGDB 5CK9A 1R8OB 3OA6A 5A0GA 3G71T 4X34A 3CCEA 3CCRT 4F7UE 3QWZA 5FTNA 4RG8A 4ME7A 1Q82C 1VQPA 3HU3A 2LDMA 4M7DA 4NL2A 4R56A 2VXEA 3OS1A 4X9DA 4YTLA 3URGA 3OYDA 1VQ4T 3HU1A 4J5YA 5HK3A 2QQBA 1YJNT 1VQ6T 1K73C 3CC7T 2KVQG 1Y96B 3PGGA 4VUBA 3L2ZA 2QA4T 3RMQA 4OB0B 2JTFA 4O5VA 4RG2A 3M5AA 2IG0A 1YJWA 3OYMA 2F69A 3OYKA 1K9MU 1M1KU 1HK9A 2E10A 3EFRA 2VC8A 3JAME 4A4FA 3QQ7A 3G7ZA 4M78F 2C06A 4C5IA 4C8QG 5GMKm 1OZ2A 4PLLA 3GNGA 3QG1A 1G3WA 4GY5A 3L42A 3RUXA 5KCHA 4M7AC 5FU6C 3CC7A 1CZ5A 5LJ5h 1QP2A 4PJOG 4C92E 1Q86C 5GMKi 3JB9F 4XU0A 1K73U 1VQ7A 2QEXA 2VGMA 1X01A 3M9QA 1VQ4A 3VU3C 2OTLA 3CC2A 4JRKA 2QXFA 4LDYA 3PIPA 4N4HA 2M1HA 3S3NA 4C0ZA 2KY9A 2L5QA 5CKBA 3V8LA 3ZFJA 1M9SA 4C8QD 1BIBA 3OYNA 3CCQA 3FPRA 1BI0A 4LDWA 4HT9A 4KODA 3QC8A 4HA8A 2OTJA 1VQMA 3WVEB 5LJ5g 3OYJA 1YJ9T 2WSCE 5LJ3g 1FXXA 2MAMA 2PU9B 5D6XA 4XTXA 3RIRA 3S6WA 3T9NA 3UWNA 4L5GA 2MI6A 2L89A 2LRQA 3MEUA 5I2MA 3OBWA 4BD3A 2BIVA 4EMKC 4M7AG 4IUVA 2GCXA 4BY6C 1Q7YC 1VQKA 1VQLT 3G4ST 4C8QE 4KULA 5CIUA 2E70A 3QKJA 4M75B 2CZ7B 4M75F 2R58A 1B34B 3V7SA 4HCBA 4BE2A 2MWOA 1UB4A 1WJRA 4M77D 3QQ8A 5J26A 2Y4YA 1N9SA 3MHXA 3WXMB 4JDSA 2YLCA 1G3SA 3GIBA 3MO8A 4RCCA 4PJOE 3INZA 2EQMA 3QYHB 2XG8D 1VQ5T 1N8RC 2ZCFB 2M0OA 5LJ3f 4ZGEB 1UGSB 4EMKB 4CI0C 2L3RA 1PSFA 1WQWA 2LQ8A 3X24B 1VQ9T 1P92A 3MB5A 2RH2A 4NL3A 2MMPA 3E19A 4CRIA 1JB0E 2DEQA 4C92C 2XD0A 2HBPA 2B8AA 3QXEB 3MP6A 3OMGA 2QEXT 3BFMA 1M5Q1 5GAOp 2X4XA 4A54A 4CQNA 3HU2A 1XTDA 3M57A 1OYXA 3CCVA 4J7IA 2P0KA 4B9XA 1IZ6A 1LNXA 2R57A 4MMKA 4C5EA 2CZ6B 3C4SA 3TEEA 2K3XA 2VYTA 3JRZA 2PQWA 3X25B 5FU7B 3GLXA 3UPUA 3CC2T 2ZGWA 4ARIA 4DA4A 2V8IA 3HHTB 4OVAA 3WVDB 1N6AA 3M54A 4IUPA 4OGEA 3HKSA 1VQ9A 1Q82U 3VYHB 4P5NA 3NTIA 1Y96A 3CPWA 1D3BB 4KBMB 3QPHA 4PJOD 2CS7A 3FJPA 3JCMf 5A0LA 5HKCA 4C92G 2VGNA 2HD0A 2GQVA 2H3JA 2K3YA 2K5IA 5CAIA 1KG1A 3OYYA 2E41A 3ASKA 3CMAA 3LGAA 1Q7YU 2XK0A 1NPRA 1BI2A 2FHDA 3GOXA 2XDDA 5ERGB 3NTHA 2DAQA 4FT2A 3RKYA 3J81E 3L2RA 4KO8A 2E65A 2FYKA 3QO3A 2R5MA 4Z02A 4OB2B 3HRUA 3OSSC 4QQGA 2BUDA 5EG2A 1BYMA 3UT1A 5GAOq 1QDNA 2QTXA 4NS5A 3LWHA 3L2WA 4M77A 1YJ9A 3LWIA 2MWPA 1M90C 3PMIA 1S3SA 1KQSS 5CKDA 3G6EA 3OB9A 3RMSA 3JB9D 3MP1A 1UGPB 3HPWA 2LC4A 4C5HA 4ARCA 4DOWA 2DVEA 3CPFA 3I56A 3MEAA 4M77G 1VQKT 5FRNA 1RL2A 4JLGA 3RKWA 4XTYA 1MGQA 5J3BA 4XQ3A 2HQEA 3QYGB 5D6WA 4JRIA 4M77E 4QVDA 4C8QF 1LJOA 2LT4A 2A3LA 2JNGA 3QJ6A 2RK1A 2RHZA 5FU6B 4ZTFA 3DKMA 4FIBA 3OYCA 5GAOr 3LLRA 3OYBA 3JB9G 5CQYA 1KD1U 3RERA 4MDXA 1TH7A 4QQDA 3JCMb 3CBOA 4ZTJA 1NZ9A 5M9OA 1N8RU 3OQ5A 2M9UA 4QVCA 2D9TA 4NOYA 5GAN4 5FTMA 1CR5A 4KT0E 4DQ2A 2PWYA 4ZN3A 3GF5A 3KBGA 5C0MA 2Q18X 4J6YA 3OW2S 2EKOA 2KSSA 2O4XA 2PVGB 4M75D 4QQ6A 3TU4K 1DJ7B 5FTLA 3N5BB 2MF2A 4JJNK 3PIOA 4V2SA 3TCJA 3GP8A 1GXIE 1U8RA 3HL8A 5DM7R 4IUQA 4M7AF 5CD1A 4JRQA 4JS5A 3E1SA 3EFSA 3M4YA 2JTMA 2ZPFB 3HSBA 3FB9A 2DJZA 4WF2A 3V7RA 4M75G 1I5LA 4C92D 4M78A 4EPCA 2ZZDA 4XTUA 1VUBA 2DIQA 5KCOA 4E7HA 3X26B 2LCCA 1YCYA 2DXBA 3CBPA 4J7FA 3AHUA 3MCAB 1I4K1 2HAXA 5FLXE 3MEWA 4QVZA 3RESA 3HRSA 3META 5KH6A 2PUKB 3O8VA 1ZC1A 3E9GA 2JVVA 5GAOn 3KXTA 5GAMh 3OW2A 4M75A 5FRMA 1O54A 4C0DC 4R55A 3CCLT 2PVDB 2RHYA 5CKEA 1MHNA 3RKXA 1VQOT 4KDLA 2EJGA 3C95A 3TIWA 4F7UB 5C18A 5KE2A 4M7DD 5GAOl 3VJPA 3S3OA 2D6FA 2KAFA 4N0AC 5CKFA 1PSEA 2Q1DX 1HXDA 1YITT 4B9WA 1KQ1A 2XHCA 1N9RA 2LCLA 3CCJT 3OS0A 3JCMc 3CCRA 3CPWS 4XAXB 5DLOA 1Q81C 1W4SA 3BQBA 3SWNC 4MZPA 1K8AC 1M8VA 1VQ8A 3FIFA 1H641 4M78B 3SFMA 4DOVA 4PJOC 3QJYA 2XI9A 3ME9A 2PUOB 2RB6A 1VQOA 4A53A 2DD5A 3OYIA 1M1FA 4BB7A 5GAN2 3CCVT 3A8GB 2QDYB 3CMEA 1K9MC 2E5QA 3JB9H 4IKFA 3X28B 1VQLA 1U1TA 1WQ7A 3QDRB 4C92B 2DTIA 1Y07A 4O6JA 1YBYA 2DPPB 3CD6A 4ATOA 2GFUA 2RJDA 3DB4A 4Q5WA 2XKOC 5GAOm 3CCUA 4M7AA 1I9GA 2EQKA 3M56A 4RKUE 2KMTA 1YI2T 2RHUA 4JS4A 3ZJUA 2RI2A 3QZ9B 4N0AA 1KHCA 2E12A 1KC8C 1NJIU 1IREB 2BKDN 3P8HA 2EJFA 3LH0A 3VUBA 1KQSA 1VQ5A 3FEOA 4C0DB 5GAN8 5GANj 4C0FA 1YHQT 1QP3A 3V8KA 2RJCA 3H6ZA 1VIEA 4E47A 5LJ5e 3HRTA 2RJEA 5CQXA 5LL6S 5FTKA 5GAN7 4L6V5 4IUUA 2K5LA 3CCLA 1VQNA 2DK3A 3NTKA 5GAN6 4RMOA 4PNOA 4LD6A 5GAMj 3X20B 3ZJTA 3VKIA 1NJIC 4BI4A 4M77F 1YI2A 3QIIA 3OYAA 3DLLA 2X4WA 2D0QB 2VV5A 1BI1A 3BY7A 4XU3A 1M90U 4C92A 1KQ2A 4C5GA 2DO3A 4FL6A 3CCET 4PJOB 4E7LA 5CVIA 3SWNA 2CKKA 3P8DA 3V8JA 3CCMT 2LQKA 2YRVA 3MEVA 4A4HA 4M7DG 1Q81U 4UC4A 3A8HB 1K8AU 3QUIA 1M1GA 3E9FA 5LJ3d 3JB9J 1VQPT 4PLIA 2V8KA 4A4GA 1V29B 5GANg 4EMKA 3BDLA 3OBYA 3SWNB 3CCSA 2LTOA 1O9SA 2ZPBB 3ZBDA 3CC4A 1NE8A 2EQJA 4MZMA 4OF1A 3QSUA 1E32A 4C8QC 2VUBA 3SD4A 5DYGA 2K5FA 3OMCA 5FTJA 5CR2A 4OB3B 1JJ2S 3FLGA 5GAMg 1M1KC 1QVFA 1QW1A 3UDCA 1ZQ1A 2DZCA 2X4JA 3CCST 3CCJA 2GF7A 3HFOA 2RHIA 2RHXA 3A8LB 4TVRA 5KE3A 1KC8U 5DYIA 4KLNA 3OYFA 3LX7A 1JJ2A 3M53A 2VXFA 1OI1A 2OAUA 3JCMe 3V7CA 3JCMQ 2RI5A 3JCMh 1OZ3A 1Q86U 1VIFA 2IVWA 3ZEHA 4PL6A 3OYEA 4JLIA 5GANf 3OYGA 3M4GA 4M78D 5GAN5 3I55A 3R6OA 1YIJT 2RK2A 2CYZB 1QVGA 2XDBA 5EQJB 4AQ7A 4FM4B 1UEBA 4KUIA 4M77C 1I8FA 4BUGA 3CMET 2X4YA 4II1A 5B6CA 3BDUA 3CCQT 2LW6A 2EJ9A 1WPYA 3LW5E 3OS5A 5C6SA 3ZJVA 2KK4A 5FU7C 4F7UG 3CCUT 3M59A 5LJ3h 3FC3A 2Y4XA 3CMAT 3F70A 3VV0A 3CXCA 3CCMA 4OMFB 3JCMW 4E7JA 3JCMJ 1VQMT 1EIFA 5GANh 1G5VA 1R7RA 2XU8A 1X75C 2WSEE 2JV2A 3LYIA 2ZPEB 4MDWA 2LT1A 4X9CA 2ZPIB 4ZGJB 3HP9A 3G4SA 1S72A 5GMKh 5GAMd 1XOVA 4FSXA 4LDXA 5GMKe 3FRNA 1FWZA 4LDUA 3H8ZA 4BDZA 1WLFA 2QQ9A 1Y71A 2DTOA 1BKBA 1AHJB 2LX9A 1UGQB 1B34A 3JSCA 4HCZA 4C8QB 4M75E 1VQ7T 3PMTA 1FX7A 2DKGA 1CZ4A 4D6WA 3SDZA 2YVLA 3OSVA 5I21A 3G71A 2G3RA 1ZHIA 3L1AA 4IURA 2MM2A 5GLFA 1JRIA 2O01E 3EAEA 3P8BB 2RA2A 4HT8A 3DB3A 5I2SA 1G3TA 3VYGA 4Y28E 2RD1A 4M75C 3GPLA 1SSFA 4LD9K 3LGLA 4OGCA 1D3BA 4PKCC 3CBMA 1QVGS 3OYHA 4LDVA 3CXCS 2YLBA 2HQXA 3BW1A 2QQAA 3I55T 1YIJA 1Y7XA 2FL7A 5GAMf 2JZ2A 4N4GA 3TREA 3JCMX 4M7AD 5LJ5d 3Q1JA 2I2LA 1W2BS 2KQWA 2O4XB 2ZPGB 4ZN1A 3PTAA 2MM0A 4RV0A 3C94A 4EMHA 3G6ET 4OB1B 3L2QA 1QCSA 2F5TX 2EWNA 1VQNT 4PJOA 3QBYA 1M4ZA 4M7DE 1W2BA 5DY9A 4N4IA 1QVPA 4XTWA 5C1BA 3L2VA 3QZ5B 3A8OB 2E6NA 3NFCA 4M78G 4J83A 2LNVA 2FB7A 2JOYA 2WACA 1S72T 2Y90A 4BI8B 2EQUA 3FDRA 2DIGA 4QW2A 4XU2A 4PJOF 5A0DA 4JRPA 2V8JA 2M16A 1XQHA 1N27A 4J8OA 5GANd 3J7AF 3HFNA 2EAYA 1O75A 3M55A 2NLUA 2Q19X 4M7DF 5GMKj 4M7DB 2CGHA 2DZ9A 2K57A 4EMGA 2FVUA 4KDIA 4E7IA 3CF2A 5HK0A 1H3ZA 3PFSA 1UGRB 2KDSA 2DXTA 2XDPA 2QA4A 2RM4A 4L59A 5HY6A 2P0QA 5CO7A 1BIAA 2ZPHB 2AHJB 3QHSA 5IT9E 2DTHA 4BI3A 2LVMA 1WJQA 4FU6A 3DLMA 5AYFA 2JUFA 4M78C 3VUZA 1WJSA 4Y91A 4M7AB 2Q1CX 1G3YA 4KUDK 3I56T 1LOJA 1YJWT 2YUJA 4M78E 5IN1A 2K2VA 1JBMA 2XIDA 2PJHB 4XTZA 4J6WA 1WGSA 1RI0A 5IAYA 2F5KA 2P4TA 3GNFB 2Q1AX 2XICA 5CCBA 4M77B 3JCMd 2X35A 2QI2A 4F7UA 5J39A 1KD1C 1NPPA 2JN0A 4JUVA 5GAN3 4EDUA 2A7YA 4FT4A 3J80E 4BACA 2PVOB 3M58A 3JB9I 3OY9A 4BE0A 1KHIA 4M7AE 3C12A 2CZ1B 4OP0A 4ELYC 2HNIA 2WSFE 3CEYA 5DLQE 3FPTA 3LHDA 4BE1A 2QQSA 2EFIA 4GLKA 3A5ZB 4F7UF 4HCCA 3JCMP 2GFAA 1BI3A 2E6ZA 3PNWC 5CCXA 4AS1A 4E7KA 4BY6B 3PT9A 5D6YA 3SB2A 2DD4A 5LJ5j 2CZ0B 2RO0A 4MMLA 4RCBA 4IUTA 2B25A 2DXUA 2EIFA 4MZTA 2K4YA 3LGFA 3MP8A 1YITA 3A8MB 1WNLA 4M7DC 4C8QA 3S3MA 1QVFS 2DXCA 5GMKl 2P0PA 2R5AA 2E1HA 3OS2A 3KUFA 5A2QE 5GAMe 3L2UA 5LJ5f 1YHQA 2QQRA 4J6XA 2YHTA 1XNIA 4ELZC 5L8RE 1VQ8T 4HKEA 5FROA 2OTLT 3CC4T 5CCAA 3ZGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ME9 A;  4IUP A;  3PMT A;  2L8D A;  3OYI A;  3NTI A;  2G3R A;  2E5Q A;  4IKF A;  4IUR A;  2RJF A;  3EAE A;  2K3Y A;  3DB3 A;  2GFU A;  2RJD A;  3DB4 A;  2RI3 A;  3ASK A;  4Q5W A;  4A4E A;  2XK0 A;  2FHD A;  3OYL A;  3GOX A;  2EQK A;  4BDY A;  3NTH A;  2DAQ A;  2RHU A;  3L2R A;  1SSF A;  2RI2 A;  3LGL A;  1KHC A;  3OA6 A;  4X34 A;  2BKD N;  3P8H A;  3LH0 A;  2R5M A;  4Z02 A;  3FEO A;  3OYH A;  2HQX A;  2LDM A;  4QQG A;  2BUD A;  3OS1 A;  3UT1 A;  2JZ2 A;  2RJC A;  3H6Z A;  4N4G A;  3OYD A;  4NS5 A;  2RJE A;  3Q1J A;  3L2W A;  2O4X B;  4IUU A;  2MWP A;  3PMI A;  3L2Q A;  3NTK A;  3OB9 A;  3MP1 A;  4LD6 A;  4C5H A;  3QBY A;  2JTF A;  4RG2 A;  3MEA A;  2IG0 A;  3OYM A;  3QII A;  4N4I A;  3OYA A;  3OYK A;  2X4W A;  3L2V A;  2HQE A;  5D6W A;  2E6N A;  4A4F A;  4C5G A;  2WAC A;  4C5I A;  1OZ2 A;  4PLL A;  4GY5 A;  5KCH A;  4FL6 A;  3L42 A;  2EQU A;  3QJ6 A;  4ZTF A;  2RHZ A;  3FDR A;  2DIG A;  4QW2 A;  3OYC A;  4E7L A;  3LLR A;  3OYB A;  2CKK A;  3P8D A;  2M16 A;  1N27 A;  4QQD A;  3MEV A;  2YRV A;  3M9Q A;  2NLU A;  4A4H A;  4ZTJ A;  5M9O A;  3OQ5 A;  4UC4 A;  4N4H A;  2M1H A;  4E7I A;  1H3Z A;  2D9T A;  3E9F A;  3PFS A;  3OYN A;  3S3N A;  4PLI A;  2XDP A;  4A4G A;  4L59 A;  5C0M A;  3BDL A;  2EKO A;  2O4X A;  2LTO A;  4QQ6 A;  3OYJ A;  3UWN A;  5D6X A;  2LVM A;  1WJQ A;  3S6W A;  5FRN A;  2EQJ A;  2L89 A;  2LRQ A;  3MEU A;  3DLM A;  4FU6 A;  3SD4 A;  4BD3 A;  1WJS A;  2BIV A;  3OMC A;  4IUQ A;  4IUV A;  3FLG A;  5IN1 A;  5CIU A;  3QKJ A;  2GF7 A;  2RHI A;  2RHX A;  5KE3 A;  1WGS A;  1RI0 A;  2R58 A;  5IAY A;  2F5K A;  4BE2 A;  2MWO A;  3OYF A;  3LX7 A;  1OI1 A;  1WJR A;  5J26 A;  2DIQ A;  2RI5 A;  5KCO A;  4E7H A;  1OZ3 A;  2LCC A;  2X35 A;  3ZEH A;  4PL6 A;  3OYE A;  5J39 A;  3OYG A;  4BAC A;  3MEW A;  3MO8 A;  4QVZ A;  4EDU A;  3MET A;  2EQM A;  4BE0 A;  5KH6 A;  3OY9 A;  3O8V A;  2M0O A;  3E9G A;  5FRM A;  2L3R A;  2X4Y A;  4II1 A;  3CEY A;  2RHY A;  1MHN A;  4BE1 A;  4CRI A;  5C6S A;  2QQS A;  2EFI A;  5KE2 A;  2B8A A;  2GFA A;  3PNW C;  3FC3 A;  3S3O A;  3F70 A;  4E7K A;  3MP6 A;  3OMG A;  5D6Y A;  2X4X A;  4E7J A;  1G5V A;  2RO0 A;  4B9W A;  4IUT A;  1OYX A;  3OS0 A;  3LGF A;  3LYI A;  3MP8 A;  2P0K A;  4B9X A;  2R57 A;  3S3M A;  4C5E A;  2R5A A;  3C4S A;  3OS2 A;  3KUF A;  2K3X A;  2VYT A;  3L2U A;  2PQW A;  3H8Z A;  2QQR A;  4BDZ A;  1XNI A;  5FRO A;  4HCZ A;  4OVA A; 
#chains in the Genus database with same CATH topology
 2RQW A;  3VS3 A;  4J9B A;  2ZAE A;  4XTV A;  1PWT A;  2RI3 A;  4AFS C;  3ER0 A;  1BCM A;  4XK8 E;  3CCR T;  3HTR A;  4F7U E;  2C0O A;  2KR3 A;  1VQP A;  3HU3 A;  3OS1 A;  5KYN A;  2D1X A;  1WXU A;  1VQ4 T;  1YJN T;  2QA4 T;  4RG2 A;  3OYM A;  1UHC A;  1M1K U;  3GBQ A;  2E10 A;  4A4F A;  3QQ7 A;  4M78 F;  3AT1 B;  4C5I A;  3QG1 A;  4GY5 A;  1G3W A;  1CZ5 A;  4C92 E;  1VQ7 A;  1TUC A;  1X01 A;  3M9Q A;  1VQ4 A;  3VU3 C;  2OTL A;  2QXF A;  2ENM A;  2EYW A;  2M1H A;  1ZSG A;  4C0Z A;  3V8L A;  2YXY A;  4D8K A;  1M9S A;  1Q82 R;  4KOD A;  4HA8 A;  3REA B;  5HCK A;  1YJ9 T;  2DL5 A;  5B6C A;  5FRN A;  4DBQ A;  1E6G A;  3EG9 B;  4HCK A;  3T9N A;  4L5G A;  2MI6 A;  4BD3 A;  4EMK C;  4IUV A;  2GCX A;  4Z89 A;  1VQK A;  1YNZ A;  2E70 A;  2R58 A;  1B34 B;  1C6V X;  4J9H A;  2F2W A;  1UTI A;  2ED1 A;  1WJR A;  4M77 D;  2D0N A;  1N9S A;  2Y4Y A;  4OMP A;  4ANJ A;  4JDS A;  4PJO E;  3INZ A;  1VQ5 T;  1MUZ A;  4ZGE B;  1UGS B;  4EMK B;  2L3R A;  1U5S A;  3MB5 A;  1WDX A;  2MMP A;  1UEC A;  2DEQ A;  2L3Q A;  1TXQ A;  1UG1 A;  2QEX T;  3M57 A;  4J7I A;  1UJ0 A;  1VYT A;  2BTT A;  3HHT B;  1N6A A;  1VQ9 A;  1VQM Q;  2F1L A;  3CPW A;  4PJO D;  2CS7 A;  3FJP A;  3JCM f;  1ABQ A;  2K5I A;  1KG1 A;  3LGA A;  2E41 A;  3CMA A;  2FHD A;  3EG9 A;  3L2R A;  1U06 A;  2M0Y A;  2EKH A;  1SSH A;  3TSW A;  4CC3 A;  3HRU A;  3OSS C;  5EG2 A;  1YJN Q;  1BYM A;  1QDN A;  2QTX A;  3VS2 A;  2DYI A;  3VS0 A;  1S3S A;  3G6E A;  3OB9 A;  4ARC A;  2COW A;  4Z8A A;  4DOW A;  2VVK A;  5J3B A;  4XQ3 A;  5IXB A;  4QVD A;  2M02 A;  2P84 A;  2DF6 A;  2LT4 A;  2JNG A;  4PJO C;  2RHZ A;  2GBQ A;  1KD1 U;  1TH7 A;  3JCM b;  2JS2 A;  4LE9 A;  1N8R U;  4LN2 A;  2E3I A;  2YUO A;  1ZSZ C;  4NOY A;  2NUP A;  3GF5 A;  4J6Y A;  2EKO A;  2PVG B;  4QQ6 A;  3TU4 K;  2J6O A;  2JS0 A;  3GP8 A;  1GXI E;  2A28 A;  4JRQ A;  4JS5 A;  4C92 D;  1YHQ Q;  4XTU A;  4J7F A;  2HAX A;  2DYB A;  1I5O B;  2JVV A;  5FRM A;  3OW2 A;  1VQO T;  3EFO A;  3CC7 Q;  3RKX A;  2EJG A;  4KH1 B;  5C18 A;  1D1C A;  5KE2 A;  2B86 A;  1IHV A;  5GAO l;  3H0H A;  1K0S A;  3VS6 A;  3EGX A;  2KAF A;  5CKF A;  1PSE A;  4B9W A;  1KQ1 A;  3CCJ T;  3OS0 A;  2FO0 A;  1PM3 A;  1SHF A;  2SRC A;  1Q81 C;  1M8V A;  4R0K A;  1H8K A;  1K9M R;  3SFM A;  2XI9 A;  3ME9 A;  1VQO A;  1YWO A;  2DD5 A;  2QDY B;  1B7T A;  2DNU A;  4C92 B;  2DTI A;  1Y07 A;  1OPK A;  1WX6 A;  2GFU A;  4Q5W A;  5GAO m;  2XKO C;  4ATO A;  4RKU E;  3M56 A;  2EVR A;  4JS4 A;  2RI2 A;  1QCN A;  1KHC A;  1NLP C;  1IRE B;  3P8H A;  2EJF A;  3LH0 A;  4OMQ A;  3EGX B;  4C0D B;  1QP3 A;  2HSP A;  3V8K A;  4E47 A;  5FTK A;  1MV3 A;  3CCL A;  2G6F X;  1VQN A;  2CH4 W;  2K2M A;  4PNO A;  1RAB B;  3ZJT A;  3X20 B;  2NWM A;  3TSZ A;  4RTY A;  2X4W A;  3I9Q A;  2D0Q B;  3BY7 A;  3MJX A;  4XU3 A;  1M90 U;  4C5G A;  1RI9 A;  1G2B A;  4PJO B;  2YT6 A;  2CKK A;  4J9D A;  1KJW A;  4A4H A;  2D8H A;  1K8A U;  2LQW A;  4PLI A;  1V29 B;  3CPW P;  3CCS A;  2LTO A;  3ZBD A;  3CC4 A;  1NE8 A;  2EQJ A;  1F1B B;  5DYG A;  2VUB A;  3SD4 A;  2K5F A;  3OMC A;  5CR2 A;  1JJ2 S;  2FEI A;  1M1K C;  3G4S Q;  3CCS T;  2GF7 A;  5KE3 A;  1JU5 C;  3RR6 A;  3V7C A;  2RI5 A;  1Q86 U;  1OZ3 A;  3ZEH A;  1LCK A;  3OYG A;  2RK2 A;  4M77 C;  2X4Y A;  4II1 A;  3KFV A;  3LW5 E;  3ZJV A;  5C6S A;  4F7U G;  3M59 A;  2Y4X A;  4GLM A;  3CXC A;  4E7J A;  1VQM T;  1X75 C;  1D1B A;  4X9C A;  2ZPI B;  2DL4 A;  5GMK h;  3G1J A;  3FRN A;  3H8Z A;  1WLF A;  1D0Y A;  3ZL7 C;  4HCZ A;  4C8Q B;  2DKG A;  1CZ4 A;  1AT1 B;  4D6W A;  1Y57 A;  1ZHI A;  3P8B B;  1WHJ A;  4PK4 A;  1PD0 A;  3VYG A;  3GPL A;  2HSE B;  2JM8 A;  3LGL A;  4ESR A;  1ZLM A;  1ARK A;  2BZY A;  4PKC C;  1QVG S;  3OYH A;  3VRZ A;  2HQX A;  4N4G A;  1Z9Q A;  4M7A D;  5LJ5 d;  3Q1J A;  1W2B S;  2KQW A;  2O4X B;  3TQ7 P;  4OB1 B;  1QCS A;  4DBH A;  3QBY A;  1M4Z A;  9ATC B;  1W2B A;  1QVF P;  3EG0 A;  5C1B A;  2E6N A;  3NFC A;  2DRM A;  4BI8 B;  4KGV B;  1JQQ A;  3HFN A;  1O75 A;  5GMK j;  4HVW A;  4J9G A;  3CF2 A;  4KDI A;  1H3Z A;  1UGR B;  2EPD A;  1M1K R;  2QA4 A;  2EGA A;  5HY6 A;  2P0Q A;  2KRM A;  2VAS A;  5CO7 A;  2DTH A;  1WHM A;  4J9C A;  4J9E A;  2I0N A;  4FU6 A;  3DLM A;  3VUZ A;  2JUF A;  1SEM A;  3I56 T;  1YJW T;  4M78 E;  5IN1 A;  4J6W A;  2F5K A;  2Q1A X;  2XIC A;  5CCB A;  4CC4 B;  4BAC A;  2E5K A;  3EFO B;  1Y0M A;  4BE0 A;  3OY9 A;  1KHI A;  4M7A E;  3M0Q A;  1WLP B;  4ELY C;  2HNI A;  2RNA A;  2MYS A;  2EFI A;  3A5Z B;  4HCC A;  4BY6 B;  5D6Y A;  5IHN A;  2B25 A;  2DXU A;  4MZT A;  2K4Y A;  1WNL A;  8AT1 B;  2DXC A;  2P0P A;  2KYB A;  5AT1 B;  4HVU A;  2L8D A;  2MPX C;  3VS7 A;  1YJN A;  4C92 F;  5GAN e;  4RTW A;  3OYL A;  3FPU A;  1I81 A;  3H0I A;  4XU1 A;  2E64 A;  1ZSZ A;  4ZGD B;  5I22 A;  4FCY A;  3G71 T;  3QWZ A;  5FTN A;  2KBT A;  1YIT Q;  4NL2 A;  2VXE A;  2L2P A;  3URG A;  1X43 A;  2W10 A;  1QQJ A;  1KK7 A;  5KYY A;  2KVQ G;  2RPN A;  4DBR A;  4OB0 B;  2JTF A;  4O5V A;  3M5A A;  1YJW A;  5ECA A;  3OYK A;  1HK9 A;  3EFR A;  1OZ2 A;  4M7A C;  5FTM A;  3RUX A;  2CT3 A;  5LJ5 h;  1Q86 C;  4AT1 B;  1TOV A;  4XU0 A;  1K73 U;  2RF0 A;  2QEX A;  2CP2 A;  4JRK A;  4LDY A;  4N4H A;  1AWJ A;  2AZS A;  2KNB B;  4IIO A;  2L5Q A;  3ZFJ A;  1BIB A;  1VYV A;  3FPR A;  3QC8 A;  2OTJ A;  1VQM A;  3WVE B;  5LJ5 g;  2WSC E;  5LJ3 g;  2MAM A;  1M8M A;  3OBW A;  4FYV B;  3U23 A;  4M7A G;  1VQL T;  3G4S T;  3CCS Q;  2LJ3 A;  4KUL A;  4M75 B;  1KQS P;  3V7S A;  2NUT B;  1UB4 A;  2EW3 A;  3M0T A;  2YLC A;  1G3S A;  3GIB A;  4RCC A;  2EQM A;  2XG8 D;  4JZ3 A;  2HEQ A;  1C0M A;  3X24 B;  1P92 A;  1N5Z A;  4CRI A;  2XD0 A;  3I5R A;  2HBP A;  3QXE B;  2XMF A;  4HXJ A;  3BFM A;  3CCV A;  2AZV A;  6AT1 B;  2R57 A;  4MMK A;  4C5E A;  3C4S A;  1MMD A;  3X25 B;  3GLX A;  3UPU A;  3CC2 T;  4DA4 A;  2V8I A;  2L0A A;  4OVA A;  3WVD B;  2MK5 A;  1M2O A;  1QMC A;  3HKS A;  3QPH A;  1WHL A;  3I35 A;  1MMN A;  2VGN A;  1ZBJ A;  2ECZ A;  3ASK A;  2OX7 A;  3GOX A;  1QWF A;  2DAQ A;  4FT2 A;  2E65 A;  2R5M A;  1M2V B;  2O9V A;  4FW1 A;  2V1R A;  4QQG A;  2ATC B;  3UT1 A;  5GAO q;  3QWY A;  2EQI A;  4NS5 A;  3LWH A;  4M77 A;  1E7O A;  2MWP A;  1I07 A;  2LC4 A;  4C5H A;  3I56 A;  2YUP A;  1SHG A;  4XTY A;  1MGQ A;  2HQE A;  2KRO A;  4JRI A;  4M77 E;  4OMN A;  2PZ1 A;  4C8Q F;  2A3L A;  3JV3 A;  5GAO r;  5CQY A;  1NG2 A;  3CBO A;  4K11 A;  4ZTJ A;  4QVC A;  2D9T A;  3CCE Q;  2VB6 A;  2W0Z A;  3KBG A;  4AMC A;  2Q18 X;  1YJ9 Q;  1CKA A;  2KSS A;  4JJN K;  2HKQ B;  4EIK A;  2HDA A;  5CD1 A;  4M7A F;  3EFS A;  3M4Y A;  2JTM A;  3FB9 A;  1FMK A;  1T0H A;  2K6D A;  4M78 A;  4EPC A;  2ZZD A;  4JJD A;  2EGC A;  2LCC A;  3X26 B;  3AHU A;  5FLX E;  1M2V A;  3MEW A;  3HRS A;  5KH6 A;  1IRX A;  1ZC1 A;  2NUT A;  4A63 B;  1YN8 A;  2V26 A;  4C0D C;  4R55 A;  3SEM A;  1QLY A;  3EHR A;  3S3O A;  1YJW Q;  2DEU A;  4PJL A;  1HXD A;  1QKW A;  2XHC A;  1N9R A;  2LCL A;  3M0U A;  2JTE A;  4LUE A;  3LH5 A;  3RDV A;  4MZP A;  1PKS A;  1VQK Q;  2COZ A;  2J7I A;  4DOV A;  5EC7 A;  2KE9 A;  3CCJ Q;  2BE9 B;  2HMA A;  2ROL A;  1K9M C;  3JB9 H;  2DM1 A;  1WQ7 A;  4O6J A;  4KGZ B;  3DB4 A;  2O31 A;  4LNP A;  1X6G A;  2KRN A;  4N0A A;  2E12 A;  1W70 A;  1KQS A;  5GAN 8;  1BBZ A;  5IHK A;  1VIE A;  2RJE A;  2QGF B;  4IUU A;  2QG9 B;  2DX1 A;  3NTK A;  5GAN 6;  5KYU A;  1NJI C;  2CSQ A;  2ROT A;  3OYA A;  4X1V A;  1JEG A;  2VV5 A;  4C92 A;  2DRK A;  1B07 A;  2BZ8 A;  3SWN A;  1KD1 R;  1RAA B;  3V8J A;  1AVZ C;  3CCM T;  4M7D G;  1Q81 U;  1FMW A;  2AIR B;  3I56 Q;  1VQP T;  4DEY A;  2V8K A;  3OBY A;  1EZZ B;  2ZPB B;  2DMO A;  4OF1 A;  1KSW A;  1E32 A;  1M27 C;  3CMA Q;  4OMO A;  1D0Z A;  4HVV A;  3UDC A;  2X4J A;  2HL5 C;  3HFO A;  1KC8 U;  4F17 A;  1OQK A;  3OYF A;  3LX7 A;  4KLN A;  3JCM Q;  3JCM e;  1X2K A;  1I0C A;  1VIF A;  2IVW A;  4PL6 A;  4M78 D;  3I55 A;  2XDB A;  5IH2 A;  2X3W D;  4BUG A;  2LW6 A;  3OS5 A;  2KK4 A;  5FU7 C;  3UA7 A;  1AD5 A;  3CMA T;  3F70 A;  1IGU A;  1KC8 R;  1J3T A;  1EX4 A;  1WXB A;  3JCM J;  5GAN h;  2WSE E;  2ZPE B;  2LT1 A;  1FYN A;  2KT8 A;  3HP9 A;  3G4S A;  1AZG B;  5GAM d;  4FSX A;  1SF9 A;  2X9H A;  1FWZ A;  1NLO C;  4LDU A;  1ABO A;  1UUE A;  1VQP Q;  1BKB A;  2JW4 A;  1K9A A;  2KT1 A;  1VQ7 T;  3SDZ A;  5I21 A;  2G3R A;  2CRE A;  4B6M A;  3L1A A;  4IUR A;  2MM2 A;  2KRS A;  1Q81 R;  4HT8 A;  1M3C A;  3DB3 A;  4OML A;  2DE0 X;  3SHW A;  5I2S A;  2HQH A;  2RD1 A;  2F2X A;  1WA7 A;  4M75 C;  4PFZ A;  1SSF A;  2DVJ A;  4OMM A;  3VS5 A;  3MPU B;  4LDV A;  3CXC S;  2YLB A;  3I55 T;  5GAM f;  2JT4 A;  2ZPG B;  4ZN1 A;  4EMH A;  2CUB A;  4PJN A;  1X69 A;  1VQ8 Q;  4M7D E;  2K9G A;  3TVT A;  3L2V A;  3QZ5 B;  1X27 A;  3THK A;  2EQU A;  5FWC A;  5KYU B;  2DIG A;  2V8J A;  2M16 A;  4J8O A;  1PNJ A;  3J7A F;  1GFD A;  2NLU A;  2DZ9 A;  2FPD A;  4EMG A;  1D09 B;  5HK0 A;  3PFS A;  2KDS A;  2V1Q A;  2DXT A;  4RTV A;  3M0P A;  2LVM A;  1WJQ A;  5AYF A;  1G3Y A;  2K2V A;  1JBM A;  1A0N B;  4XTZ A;  1WGS A;  1RI0 A;  5IAY A;  1NEB A;  3PVQ A;  3GNF B;  2NUZ A;  2QI2 A;  2YUQ A;  3C12 A;  1QVG P;  2WSF E;  3FPT A;  2LJ1 A;  3LHD A;  2OI3 A;  2QQS A;  4GLK A;  1TUD A;  2AK5 A;  2GFA A;  1UDL A;  5CCX A;  2RO0 A;  4MML A;  4RCB A;  3LGF A;  4C8Q A;  1QVF S;  1LPL A;  5GMK l;  2PTK A;  3OS2 A;  5GAM e;  4J6X A;  4ELZ C;  2ESW A;  1U1S A;  2OTJ T;  2NUP B;  1PRM C;  1VQ6 A;  2RJF A;  4A4K A;  3JCM g;  5LJ3 j;  4C0G A;  3OA6 A;  5A0G A;  3CCE A;  2FZC B;  4X34 A;  5KYX A;  4YTL A;  3OYD A;  2H3E B;  4QT7 A;  4J5Y A;  3CC7 T;  4VUB A;  3PGG A;  2X3X D;  3L2Z A;  1HSQ A;  1NBE B;  2IG0 A;  2F69 A;  3ULR B;  1K9M U;  2K79 A;  2RQV A;  1FMV A;  2DL8 A;  4C8Q G;  5GMK m;  3GNG A;  5KCH A;  4PJO G;  5GMK i;  2VGM A;  2M51 A;  3CC2 A;  1OUL A;  2FPE A;  1PKT A;  1TS9 A;  1Q82 C;  1IO6 A;  2KY9 A;  4C8Q D;  1BI0 A;  2DL3 A;  4FYY B;  1SKU B;  3EH1 A;  3OYJ A;  3UWN A;  5D6X A;  3S6W A;  4XTX A;  3RIR A;  1VYU A;  2DBM A;  3MEU A;  5I2M A;  2BIV A;  1Q7Y C;  4FSS A;  4DBF A;  5I11 A;  3QKJ A;  3VS4 A;  2CZ7 B;  4HCB A;  5J26 A;  3WXM B;  2RQU A;  3MO8 A;  1M90 R;  1N8R C;  2X51 A;  2ZCF B;  4CI0 C;  2LQ8 A;  1WQW A;  1VQ9 T;  2AT1 B;  1ZUU A;  1JB0 E;  4C92 C;  2RMO A;  2B8A A;  2D8J A;  2J05 A;  3OMG A;  1M5Q 1;  4A54 A;  2C0I A;  1VQ7 Q;  4B9X A;  3OW2 P;  1LNX A;  1UHF A;  2EYY A;  2CZ6 B;  2LJ0 A;  3REB B;  3TEE A;  2PQW A;  5FU7 B;  4RUG A;  5IXF A;  4ARI A;  3M54 A;  4IUP A;  4OGE A;  1WHH A;  3NTI A;  1Y96 A;  5A0L A;  5HKC A;  4C92 G;  2GQV A;  5CAI A;  3OYY A;  2XK0 A;  1NPR A;  1BI2 A;  1K73 R;  2XDD A;  5L23 A;  3J81 E;  3A1P A;  3PE0 A;  2FYK A;  3QO3 A;  5FW9 A;  1BCO A;  1TSF A;  1GFC A;  4OB2 B;  2MCN A;  2BUD A;  2QEX Q;  1X2Q A;  3L2W A;  2CP3 A;  1YJ9 A;  1KQS S;  5CKD A;  3JB9 D;  1UGP B;  3CPF A;  4M77 G;  1GCQ A;  1RL2 A;  1MND A;  3RKW A;  1ZUY A;  5D6W A;  5GJV B;  2EYZ A;  4F14 A;  1WI7 A;  1LJO A;  3QJ6 A;  2RK1 A;  1PC0 A;  3OYC A;  4FIB A;  3RER A;  3JB9 G;  1EFN A;  2DFU A;  4QQD A;  1HJD A;  2JMA A;  1NZ9 A;  1PHT A;  2O88 A;  5M9O A;  3OQ5 A;  1TUG B;  4FYX B;  2M9U A;  3EGD A;  2LZ6 B;  2C0T A;  5GAN 4;  4KT0 E;  4DQ2 A;  2PWY A;  5C0M A;  4DEX A;  1DJ7 B;  4Y92 A;  3N5B B;  2MF2 A;  3PIO A;  1K0X A;  1U8R A;  5DM7 R;  1PG5 B;  1N8R R;  1YWP A;  2ZPF B;  1RAE B;  1RAF B;  2EBP A;  1I5L A;  1NJI R;  4CC2 A;  3NHN A;  2DIQ A;  4E7H A;  4GBQ A;  3CBP A;  3MCA B;  3RES A;  4QVZ A;  1GBQ A;  2PUK B;  2COY A;  1MV0 B;  5GAO n;  5GAM h;  4M75 A;  2PVD B;  2RHY A;  3QDF A;  1RAI B;  3EGD B;  3C95 A;  1W6X A;  3TIW A;  4F7U B;  5KYW B;  2CP6 A;  3VJP A;  1OX8 A;  2BZX A;  4N0A C;  1IGQ A;  3CCV Q;  2Q1D X;  2QDL A;  2GTJ A;  2K3B A;  3CCR A;  1SRL A;  4XAX B;  4AFZ C;  3BQB A;  3SWN C;  2PNI A;  2DET A;  3FIF A;  1NEG A;  4M78 B;  1T3L A;  3CCV T;  4BB7 A;  3CME A;  4IKF A;  1VQL A;  3QDR B;  2RQR A;  2RN8 A;  3CD6 A;  3QQ8 A;  2RJD A;  2YRC A;  1I9G A;  1S72 Q;  1Q95 G;  2RHU A;  2RQT A;  3QZ9 B;  2LCS A;  1KC8 C;  2O9S A;  2JJ9 A;  2BKD N;  3FEO A;  5FWB A;  2LP5 A;  1YHQ T;  2KYM A;  2RJC A;  5LJ5 e;  1CSK A;  5GAN 7;  1BK2 A;  4JJB A;  2DK3 A;  2E4H A;  5GAM j;  3VKI A;  4BI4 A;  4M77 F;  3QII A;  1KQ2 A;  1M30 A;  1JXO A;  4RTZ A;  3CCE T;  4E7L A;  3P8D A;  4WCI A;  2KXD A;  2LQK A;  3CC4 T;  4UC4 A;  3QUI A;  5LJ3 d;  3JB9 J;  2YUN A;  4EMK A;  1YFN A;  1B3Q A;  1XJW B;  3BDL A;  2Z0W A;  1O9S A;  2BE7 D;  1R0C B;  4MZM A;  2LX7 A;  4KH0 B;  4C8Q C;  1V76 A;  3FLG A;  5GAM g;  1JO8 A;  3CCJ A;  1T0J A;  3A8L B;  4TVR A;  5DYI A;  1KIK A;  1YP5 A;  1JJ2 A;  3CME Q;  3M53 A;  2OAU A;  4AFU C;  3OYE A;  3M4G A;  1WHK A;  2CYZ B;  2KI7 A;  1UJY A;  4FM4 B;  2DL7 A;  2F2V A;  4KUI A;  1I8F A;  1G8X A;  1WPY A;  3EG3 A;  1Q86 R;  2LQN A;  3RBB B;  3CCU T;  3FC3 A;  2K7A A;  2J6F A;  1E6H A;  3JCM W;  1G5V A;  2XU8 A;  2VWF A;  4MDW A;  4ZGJ B;  1UFF A;  4LDX A;  5GMK e;  2DTO A;  2MOX A;  1RAC B;  1AHJ B;  3JSC A;  1B34 A;  4M75 E;  2YVL A;  3G71 A;  1VQ4 Q;  3UA6 A;  1JRI A;  2O01 E;  1QCF A;  1K8A R;  1G3T A;  4IIM A;  2J06 A;  1VOM A;  2FZK B;  4LD9 K;  1VQ5 Q;  2A37 A;  3CBM A;  2GGR A;  3BW1 A;  3H41 A;  1M3B A;  3R6N A;  2EGE A;  2JZ2 A;  2SEM A;  1OOT A;  3CCU Q;  4FYW B;  4RV0 A;  3C94 A;  3G6E T;  2QTV A;  2F5T X;  4PJO A;  1RLQ C;  1QVP A;  4XTW A;  3A8O B;  4J83 A;  2FB7 A;  1S72 T;  2Y90 A;  2CP0 A;  4QW2 A;  4XU2 A;  2L3P A;  1IXD A;  1WXT A;  1XQH A;  2FG0 A;  4J9I A;  4M7D F;  2FPF A;  2CGH A;  2K57 A;  2FVU A;  2ED0 A;  1IB8 A;  3C0C A;  2CP5 A;  2RM4 A;  4L59 A;  1BIA A;  2AHJ B;  5IT9 E;  2CDT A;  1NM7 A;  4AG1 C;  1WJS A;  4Y91 A;  3M0S A;  4M7A B;  4E7S A;  4KUD K;  1AWO A;  2Q1C X;  2YUJ A;  4RTT A;  2QAZ A;  2XID A;  1YCS B;  2KEA A;  1ZX6 A;  3CCL Q;  2L3S A;  2DLP A;  4M77 B;  4AFQ C;  3RNJ A;  4F7U A;  5KYW A;  1NPP A;  2JN0 A;  5GAN 3;  2A7Y A;  1G83 A;  3M58 A;  4JPB W;  1NYG A;  3CEY A;  3CXC P;  1RAH B;  4BE1 A;  2IPO B;  2P4R A;  2A0F B;  3O5Z A;  4F7U F;  3JCM P;  1BI3 A;  1S1N A;  4AS1 A;  3E2U A;  5LJ5 j;  2CZ0 B;  4IUT A;  2YSQ A;  1WHG A;  2EIF A;  1YIT A;  1CKB A;  2OJ2 A;  2E1H A;  3KUF A;  1YHQ A;  2QQR A;  4E7Z A;  2YHT A;  1XNI A;  2OTL T;  5FRO A;  1TG0 A;  5CCA A;  2FRW A;  3ZGZ A;  5D7U A;  3EG2 A;  5LJ3 e;  1OPL A;  1TTH B;  3I55 Q;  2EYQ A;  1X6O A;  1ZBX A;  4A4E A;  3CD6 T;  4BDY A;  5EPP A;  5CKH A;  3JCM V;  5CK9 A;  1R8O B;  4JJC A;  3EH2 A;  4RG8 A;  4ME7 A;  2GTO A;  2LDM A;  4R56 A;  4M7D A;  1MMA A;  4Z88 A;  4X9D A;  3HU1 A;  2JMC A;  2QQB A;  5HK3 A;  1PRL C;  1VQ6 T;  1UGV A;  1PCX A;  1K73 C;  1Y96 B;  3RMQ A;  2CP7 A;  1AEY A;  3FJ5 A;  1V1C A;  2VC8 A;  3JAM E;  3G7Z A;  2C06 A;  4PLL A;  1AZE A;  1RAG B;  3L42 A;  5FU6 C;  3CC7 A;  1QP2 A;  3JB9 F;  1GBR A;  4LXC A;  3PIP A;  2QGG A;  3S3N A;  3OYN A;  5CKB A;  3CCQ A;  1BB9 A;  1AOJ A;  4LDW A;  4HT9 A;  2PJH B;  1FXX A;  2PU9 B;  1SRM A;  2L89 A;  2LRQ A;  3UF4 A;  4BY6 C;  1GCP A;  4C8Q E;  5CIU A;  2NYS A;  4M75 F;  4WTO B;  2IIM A;  2MWO A;  4BE2 A;  2AKK A;  3MHX A;  1OV3 A;  2GNC A;  3QYH B;  4AG2 C;  2M0O A;  5LJ3 f;  1PSF A;  2RH2 A;  4NL3 A;  3E19 A;  1D0X A;  1H3H A;  3MP6 A;  2H8H A;  3D7S B;  5GAO p;  2X4X A;  4CQN A;  3HU2 A;  1XTD A;  1OYX A;  2P0K A;  1IZ6 A;  1U3O A;  2K3X A;  2VYT A;  3JRZ A;  2ZGW A;  1Q82 U;  3VYH B;  4P5N A;  1D3B B;  4KBM B;  1RLP C;  1LVK A;  3VS1 A;  1ZA2 B;  2HD0 A;  2H3J A;  2K3Y A;  4RTX A;  1Q7Y U;  3CC2 Q;  3A98 A;  5ERG B;  3NTH A;  3NPF A;  3RKY A;  4KO8 A;  1TU0 B;  1K4U S;  2HL3 A;  1YI2 Q;  4Z02 A;  1RUW A;  1VQ6 Q;  3LWI A;  1M90 C;  3PMI A;  3RMS A;  3MP1 A;  3HPW A;  2DVE A;  3MEA A;  1VQK T;  1WIE A;  4JLG A;  1TWB A;  3QYG B;  4ZTF A;  5FU6 B;  1ZSZ B;  2OAW A;  3DKM A;  3LLR A;  3OYB A;  2LMJ A;  4MDX A;  2DJQ A;  1R77 A;  3CCM Q;  4E2F B;  2OTL Q;  1CR5 A;  4ZN3 A;  3OW2 S;  2O4X A;  4M75 D;  5FTL A;  2FZG B;  4V2S A;  3TCJ A;  2JXB A;  3HL8 A;  1UE9 A;  4IUQ A;  1ZA1 B;  4J9F A;  3E1S A;  1OU9 A;  2YWW A;  1MNE A;  3HSB A;  2DJZ A;  1QWE A;  4WF2 A;  3V7R A;  1HYO A;  4M75 G;  2CT4 A;  2J6K A;  3EG1 A;  2HZY A;  1VUB A;  5KCO A;  1YCY A;  2DXB A;  4JZ4 A;  1I4K 1;  2DER A;  3MET A;  3O8V A;  3E9G A;  4PJM A;  4QKU A;  3KXT A;  1O54 A;  2DIL A;  3CCL T;  1GL5 A;  5CKE A;  1MHN A;  4KDL A;  1OEB A;  4M7D D;  2D6F A;  2EYX A;  1YIT T;  5KYX B;  3JCM c;  2VKN A;  3CPW S;  5DLO A;  1W4S A;  1K8A C;  1VQ8 A;  2FRY A;  1H64 1;  1Q7Y R;  3QJY A;  1JJ2 P;  2PUO B;  2RB6 A;  4A53 A;  3OYI A;  1M1F A;  5GAN 2;  3A8G B;  4M4Z A;  2E5Q A;  3X28 B;  1U1T A;  1YBY A;  2DPP B;  3CCU A;  3CC4 Q;  4M7A A;  3H9N A;  1VQO Q;  2LNH B;  2EQK A;  1YI2 T;  2KMT A;  1K76 A;  3ZJU A;  1X6B A;  1AWX A;  1NJI U;  3VUB A;  1HD3 A;  1VQ5 A;  5GAN j;  2HBW A;  1WYX A;  4C0F A;  1W1F A;  1ACM B;  2DA9 A;  3H6Z A;  3HRT A;  5CQX A;  1R0B G;  5LL6 S;  1OX9 A;  2KXC A;  4L6V 5;  1SPK A;  2K5L A;  3CQT A;  4RTU A;  4RMO A;  4LD6 A;  2DBK A;  3BE3 A;  1YI2 A;  1RAD B;  3DLL A;  8ATC B;  1BI1 A;  2ABL A;  2HCK A;  2DO3 A;  4FL6 A;  5CVI A;  4ZNX A;  1OU8 A;  3MEV A;  2YRV A;  3A8H B;  1WZO A;  1M1G A;  1QCO A;  2MIO A;  3E9F A;  4F04 B;  4A4G A;  5GAN g;  7AT1 B;  2YDL A;  2QK0 A;  4ORZ A;  1WFW A;  3SWN B;  1JXM A;  1BU1 A;  3QSU A;  4KRT A;  1Z9Z A;  5FTJ A;  4OB3 B;  1W2B P;  1QVF A;  1QW1 A;  1ZQ1 A;  2DZC A;  3UAT A;  2RHI A;  2RHX A;  3M0R A;  3MKD A;  2VXF A;  1OI1 A;  3JCM h;  4JLI A;  5GAN f;  5GAN 5;  1YIJ T;  1YIJ Q;  3R6O A;  1QVG A;  4AQ7 A;  5EQJ B;  1UEB A;  3CME T;  3H0F A;  3BDU A;  3CCQ T;  1H92 A;  2EJ9 A;  2YRD A;  3G6E Q;  5LJ3 h;  3VV0 A;  3CCM A;  4OMF B;  3EHQ A;  1EIF A;  1R7R A;  2JV2 A;  3LYI A;  4PFP A;  4LUD A;  1S72 A;  3I5S A;  2E3H A;  1XOV A;  3NGP A;  1ZUK A;  3VRY A;  4BDZ A;  2QQ9 A;  1Y71 A;  3NMZ C;  2LX9 A;  1UGQ B;  2JM9 A;  1FX7 A;  3PMT A;  3OSV A;  5GLF A;  3EAE A;  4CC7 A;  2RA2 A;  1GRI A;  4Y28 E;  1VQ9 Q;  3CCR Q;  3G71 Q;  2QAS A;  4OGC A;  1VA7 A;  1D3B A;  2AKL A;  2QQA A;  1YIJ A;  1Y7X A;  2FL7 A;  3TRE A;  3JCM X;  1C1A A;  2I2L A;  3IQL A;  2MM0 A;  1SG5 A;  3PTA A;  1VQL Q;  1K1Z A;  3L2Q A;  3CCQ Q;  4KGX B;  2EWN A;  1VQN T;  4FW2 A;  5DY9 A;  2GQI A;  4N4I A;  3PVL A;  4M78 G;  2LNV A;  2JOY A;  2WAC A;  4PJJ A;  5KYY B;  3FDR A;  4PJO F;  4E6R A;  1NYF A;  5A0D A;  1MMG A;  4JRP A;  1N27 A;  1M3A A;  5GAN d;  3QWX X;  1T3S A;  2EAY A;  3M55 A;  2Q19 X;  2KGT A;  4M7D B;  1KFZ A;  2A08 A;  2HKN A;  4E7I A;  2CH4 A;  2XDP A;  5GJW B;  3EGU A;  2ZPH B;  2A36 A;  3QHS A;  4BI3 A;  4M78 C;  2QA4 Q;  1GCQ C;  4F16 A;  1LOJ A;  1D1A A;  4D8D A;  2O2O A;  2QYZ A;  1AWW A;  2P4T A;  3JCM d;  2X35 A;  1KD1 C;  5J39 A;  4JUV A;  3J80 E;  4EDU A;  4FT4 A;  2PVO B;  3JB9 I;  4PFO A;  2CZ1 B;  4OP0 A;  1I1J A;  2CUD A;  5DLQ E;  3CD6 Q;  2E6Z A;  3PNW C;  4E7K A;  3PT9 A;  3SB2 A;  2DD4 A;  2OTJ Q;  1IHW A;  3MP8 A;  3A8M B;  4M7D C;  3S3M A;  2R5A A;  1QKX A;  5A2Q E;  3L2U A;  5LJ5 f;  1VQ8 T;  5L8R E;  4HKE A;  1VQN Q;  1PD1 A;  2CSI A;  5IHI A; 
#chains in the Genus database with same CATH homology
 1U1S A;  2OTJ T;  2L8D A;  5LJ3 e;  1YJN A;  2RJF A;  1VQ6 A;  4C92 F;  4A4K A;  5GAN e;  4XTV A;  2EYQ A;  3JCM g;  2RI3 A;  1X6O A;  1ZBX A;  4A4E A;  3CD6 T;  3OYL A;  3FPU A;  1I81 A;  3ER0 A;  4BDY A;  5EPP A;  5CKH A;  4XU1 A;  4XK8 E;  5LJ3 j;  2E64 A;  3JCM V;  4C0G A;  4ZGD B;  5CK9 A;  1R8O B;  3OA6 A;  5A0G A;  3G71 T;  4X34 A;  3CCE A;  3CCR T;  4F7U E;  3QWZ A;  5FTN A;  4RG8 A;  4ME7 A;  1Q82 C;  1VQP A;  3HU3 A;  2LDM A;  4M7D A;  4NL2 A;  4R56 A;  2VXE A;  3OS1 A;  4X9D A;  4YTL A;  3URG A;  3OYD A;  1VQ4 T;  3HU1 A;  4J5Y A;  5HK3 A;  2QQB A;  1YJN T;  1VQ6 T;  1K73 C;  3CC7 T;  2KVQ G;  1Y96 B;  3PGG A;  4VUB A;  3L2Z A;  2QA4 T;  3RMQ A;  4OB0 B;  2JTF A;  4O5V A;  4RG2 A;  3M5A A;  2IG0 A;  1YJW A;  3OYM A;  2F69 A;  3OYK A;  1K9M U;  1M1K U;  1HK9 A;  2E10 A;  3EFR A;  2VC8 A;  3JAM E;  4A4F A;  3QQ7 A;  3G7Z A;  4M78 F;  2C06 A;  4C5I A;  4C8Q G;  5GMK m;  1OZ2 A;  4PLL A;  3GNG A;  3QG1 A;  1G3W A;  4GY5 A;  3L42 A;  3RUX A;  5KCH A;  4M7A C;  5FU6 C;  3CC7 A;  1CZ5 A;  5LJ5 h;  1QP2 A;  4PJO G;  4C92 E;  1Q86 C;  5GMK i;  3JB9 F;  4XU0 A;  1K73 U;  1VQ7 A;  2QEX A;  2VGM A;  1X01 A;  3M9Q A;  1VQ4 A;  3VU3 C;  2OTL A;  3CC2 A;  4JRK A;  2QXF A;  4LDY A;  3PIP A;  4N4H A;  2M1H A;  3S3N A;  4C0Z A;  2KY9 A;  2L5Q A;  5CKB A;  3V8L A;  3ZFJ A;  1M9S A;  4C8Q D;  1BIB A;  3OYN A;  3CCQ A;  3FPR A;  1BI0 A;  4LDW A;  4HT9 A;  4KOD A;  3QC8 A;  4HA8 A;  2OTJ A;  1VQM A;  3WVE B;  5LJ5 g;  3OYJ A;  1YJ9 T;  2WSC E;  5LJ3 g;  1FXX A;  2MAM A;  2PU9 B;  5D6X A;  4XTX A;  3RIR A;  3S6W A;  3T9N A;  3UWN A;  4L5G A;  2MI6 A;  2L89 A;  2LRQ A;  3MEU A;  5I2M A;  3OBW A;  4BD3 A;  2BIV A;  4EMK C;  4M7A G;  4IUV A;  2GCX A;  4BY6 C;  1Q7Y C;  1VQK A;  1VQL T;  3G4S T;  4C8Q E;  4KUL A;  5CIU A;  2E70 A;  3QKJ A;  4M75 B;  2CZ7 B;  4M75 F;  2R58 A;  1B34 B;  3V7S A;  4HCB A;  4BE2 A;  2MWO A;  1UB4 A;  1WJR A;  4M77 D;  3QQ8 A;  5J26 A;  2Y4Y A;  1N9S A;  3MHX A;  3WXM B;  4JDS A;  2YLC A;  1G3S A;  3GIB A;  3MO8 A;  4RCC A;  4PJO E;  3INZ A;  2EQM A;  3QYH B;  2XG8 D;  1VQ5 T;  1N8R C;  2ZCF B;  2M0O A;  5LJ3 f;  4ZGE B;  1UGS B;  4EMK B;  4CI0 C;  2L3R A;  1PSF A;  1WQW A;  2LQ8 A;  3X24 B;  1VQ9 T;  1P92 A;  3MB5 A;  2RH2 A;  4NL3 A;  2MMP A;  3E19 A;  4CRI A;  1JB0 E;  2DEQ A;  4C92 C;  2XD0 A;  2HBP A;  2B8A A;  3QXE B;  3MP6 A;  3OMG A;  2QEX T;  3BFM A;  1M5Q 1;  5GAO p;  2X4X A;  4A54 A;  4CQN A;  3HU2 A;  1XTD A;  3M57 A;  1OYX A;  3CCV A;  4J7I A;  2P0K A;  4B9X A;  1IZ6 A;  1LNX A;  2R57 A;  4MMK A;  4C5E A;  2CZ6 B;  3C4S A;  3TEE A;  2K3X A;  2VYT A;  3JRZ A;  2PQW A;  3X25 B;  5FU7 B;  3GLX A;  3UPU A;  3CC2 T;  2ZGW A;  4ARI A;  4DA4 A;  2V8I A;  3HHT B;  4OVA A;  3WVD B;  1N6A A;  3M54 A;  4IUP A;  4OGE A;  3HKS A;  1VQ9 A;  1Q82 U;  3VYH B;  4P5N A;  3NTI A;  1Y96 A;  3CPW A;  1D3B B;  4KBM B;  3QPH A;  4PJO D;  2CS7 A;  3FJP A;  3JCM f;  5A0L A;  5HKC A;  4C92 G;  2VGN A;  2HD0 A;  2GQV A;  2H3J A;  2K3Y A;  2K5I A;  5CAI A;  1KG1 A;  3OYY A;  2E41 A;  3ASK A;  3CMA A;  3LGA A;  1Q7Y U;  2XK0 A;  1NPR A;  1BI2 A;  2FHD A;  3GOX A;  2XDD A;  5ERG B;  3NTH A;  2DAQ A;  4FT2 A;  3RKY A;  3J81 E;  3L2R A;  4KO8 A;  2E65 A;  2FYK A;  3QO3 A;  2R5M A;  4Z02 A;  4OB2 B;  3HRU A;  3OSS C;  4QQG A;  2BUD A;  5EG2 A;  1BYM A;  3UT1 A;  5GAO q;  1QDN A;  2QTX A;  4NS5 A;  3LWH A;  3L2W A;  4M77 A;  1YJ9 A;  3LWI A;  2MWP A;  1M90 C;  3PMI A;  1S3S A;  1KQS S;  5CKD A;  3G6E A;  3OB9 A;  3RMS A;  3JB9 D;  3MP1 A;  1UGP B;  3HPW A;  2LC4 A;  4C5H A;  4ARC A;  4DOW A;  2DVE A;  3CPF A;  3I56 A;  3MEA A;  4M77 G;  1VQK T;  5FRN A;  1RL2 A;  4JLG A;  3RKW A;  4XTY A;  1MGQ A;  5J3B A;  4XQ3 A;  2HQE A;  3QYG B;  5D6W A;  4JRI A;  4M77 E;  4QVD A;  4C8Q F;  1LJO A;  2LT4 A;  2A3L A;  2JNG A;  3QJ6 A;  2RK1 A;  2RHZ A;  5FU6 B;  4ZTF A;  3DKM A;  4FIB A;  3OYC A;  5GAO r;  3LLR A;  3OYB A;  3JB9 G;  5CQY A;  1KD1 U;  3RER A;  4MDX A;  1TH7 A;  4QQD A;  3JCM b;  3CBO A;  4ZTJ A;  1NZ9 A;  5M9O A;  1N8R U;  3OQ5 A;  2M9U A;  4QVC A;  2D9T A;  4NOY A;  5GAN 4;  5FTM A;  1CR5 A;  4KT0 E;  4DQ2 A;  2PWY A;  4ZN3 A;  3GF5 A;  3KBG A;  5C0M A;  2Q18 X;  4J6Y A;  3OW2 S;  2EKO A;  2KSS A;  2O4X A;  2PVG B;  4M75 D;  4QQ6 A;  3TU4 K;  1DJ7 B;  5FTL A;  3N5B B;  2MF2 A;  4JJN K;  3PIO A;  4V2S A;  3TCJ A;  3GP8 A;  1GXI E;  1U8R A;  3HL8 A;  5DM7 R;  4IUQ A;  4M7A F;  5CD1 A;  4JRQ A;  4JS5 A;  3E1S A;  3EFS A;  3M4Y A;  2JTM A;  2ZPF B;  3HSB A;  3FB9 A;  2DJZ A;  4WF2 A;  3V7R A;  4M75 G;  1I5L A;  4C92 D;  4M78 A;  4EPC A;  2ZZD A;  4XTU A;  1VUB A;  2DIQ A;  5KCO A;  4E7H A;  3X26 B;  2LCC A;  1YCY A;  2DXB A;  3CBP A;  4J7F A;  3AHU A;  3MCA B;  1I4K 1;  2HAX A;  5FLX E;  3MEW A;  4QVZ A;  3RES A;  3HRS A;  3MET A;  5KH6 A;  2PUK B;  3O8V A;  1ZC1 A;  3E9G A;  2JVV A;  5GAO n;  3KXT A;  5GAM h;  3OW2 A;  4M75 A;  5FRM A;  1O54 A;  4C0D C;  4R55 A;  3CCL T;  2PVD B;  2RHY A;  5CKE A;  1MHN A;  3RKX A;  1VQO T;  4KDL A;  2EJG A;  3C95 A;  3TIW A;  4F7U B;  5C18 A;  5KE2 A;  4M7D D;  5GAO l;  3VJP A;  3S3O A;  2D6F A;  2KAF A;  4N0A C;  5CKF A;  1PSE A;  2Q1D X;  1HXD A;  1YIT T;  4B9W A;  1KQ1 A;  2XHC A;  1N9R A;  2LCL A;  3CCJ T;  3OS0 A;  3JCM c;  3CCR A;  3CPW S;  4XAX B;  5DLO A;  1Q81 C;  1W4S A;  3BQB A;  3SWN C;  4MZP A;  1K8A C;  1M8V A;  1VQ8 A;  3FIF A;  1H64 1;  4M78 B;  3SFM A;  4DOV A;  4PJO C;  3QJY A;  2XI9 A;  3ME9 A;  2PUO B;  2RB6 A;  1VQO A;  4A53 A;  2DD5 A;  3OYI A;  1M1F A;  4BB7 A;  5GAN 2;  3CCV T;  3A8G B;  2QDY B;  3CME A;  1K9M C;  2E5Q A;  3JB9 H;  4IKF A;  3X28 B;  1VQL A;  1U1T A;  1WQ7 A;  3QDR B;  4C92 B;  2DTI A;  1Y07 A;  4O6J A;  1YBY A;  2DPP B;  3CD6 A;  4ATO A;  2GFU A;  2RJD A;  3DB4 A;  4Q5W A;  2XKO C;  5GAO m;  3CCU A;  4M7A A;  1I9G A;  2EQK A;  3M56 A;  4RKU E;  2KMT A;  1YI2 T;  2RHU A;  4JS4 A;  3ZJU A;  2RI2 A;  3QZ9 B;  4N0A A;  1KHC A;  2E12 A;  1KC8 C;  1NJI U;  1IRE B;  2BKD N;  3P8H A;  2EJF A;  3LH0 A;  3VUB A;  1KQS A;  1VQ5 A;  3FEO A;  4C0D B;  5GAN 8;  5GAN j;  4C0F A;  1YHQ T;  1QP3 A;  3V8K A;  2RJC A;  3H6Z A;  1VIE A;  4E47 A;  5LJ5 e;  3HRT A;  2RJE A;  5CQX A;  5LL6 S;  5FTK A;  5GAN 7;  4L6V 5;  4IUU A;  2K5L A;  3CCL A;  1VQN A;  2DK3 A;  3NTK A;  5GAN 6;  4RMO A;  4PNO A;  4LD6 A;  5GAM j;  3X20 B;  3ZJT A;  3VKI A;  1NJI C;  4BI4 A;  4M77 F;  1YI2 A;  3QII A;  3OYA A;  3DLL A;  2X4W A;  2D0Q B;  2VV5 A;  1BI1 A;  3BY7 A;  4XU3 A;  1M90 U;  4C92 A;  1KQ2 A;  4C5G A;  2DO3 A;  4FL6 A;  3CCE T;  4PJO B;  4E7L A;  5CVI A;  3SWN A;  2CKK A;  3P8D A;  3V8J A;  3CCM T;  2LQK A;  2YRV A;  3MEV A;  4A4H A;  4M7D G;  1Q81 U;  4UC4 A;  3A8H B;  1K8A U;  3QUI A;  1M1G A;  3E9F A;  5LJ3 d;  3JB9 J;  1VQP T;  4PLI A;  2V8K A;  4A4G A;  1V29 B;  5GAN g;  4EMK A;  3BDL A;  3OBY A;  3SWN B;  3CCS A;  2LTO A;  1O9S A;  2ZPB B;  3ZBD A;  3CC4 A;  1NE8 A;  2EQJ A;  4MZM A;  4OF1 A;  3QSU A;  1E32 A;  4C8Q C;  2VUB A;  3SD4 A;  5DYG A;  2K5F A;  3OMC A;  5FTJ A;  5CR2 A;  4OB3 B;  1JJ2 S;  3FLG A;  5GAM g;  1M1K C;  1QVF A;  1QW1 A;  3UDC A;  1ZQ1 A;  2DZC A;  2X4J A;  3CCS T;  3CCJ A;  2GF7 A;  3HFO A;  2RHI A;  2RHX A;  3A8L B;  4TVR A;  5KE3 A;  1KC8 U;  5DYI A;  4KLN A;  3OYF A;  3LX7 A;  1JJ2 A;  3M53 A;  2VXF A;  1OI1 A;  2OAU A;  3JCM e;  3V7C A;  3JCM Q;  2RI5 A;  3JCM h;  1OZ3 A;  1Q86 U;  1VIF A;  2IVW A;  3ZEH A;  4PL6 A;  3OYE A;  4JLI A;  5GAN f;  3OYG A;  3M4G A;  4M78 D;  5GAN 5;  3I55 A;  3R6O A;  1YIJ T;  2RK2 A;  2CYZ B;  1QVG A;  2XDB A;  5EQJ B;  4AQ7 A;  4FM4 B;  1UEB A;  4KUI A;  4M77 C;  1I8F A;  4BUG A;  3CME T;  2X4Y A;  4II1 A;  5B6C A;  3BDU A;  3CCQ T;  2LW6 A;  2EJ9 A;  1WPY A;  3LW5 E;  3OS5 A;  5C6S A;  3ZJV A;  2KK4 A;  5FU7 C;  4F7U G;  3CCU T;  3M59 A;  5LJ3 h;  3FC3 A;  2Y4X A;  3CMA T;  3F70 A;  3VV0 A;  3CXC A;  3CCM A;  4OMF B;  3JCM W;  4E7J A;  3JCM J;  1VQM T;  1EIF A;  5GAN h;  1G5V A;  1R7R A;  2XU8 A;  1X75 C;  2WSE E;  2JV2 A;  3LYI A;  2ZPE B;  4MDW A;  2LT1 A;  4X9C A;  2ZPI B;  4ZGJ B;  3HP9 A;  3G4S A;  1S72 A;  5GMK h;  5GAM d;  1XOV A;  4FSX A;  4LDX A;  5GMK e;  3FRN A;  1FWZ A;  4LDU A;  3H8Z A;  4BDZ A;  1WLF A;  2QQ9 A;  1Y71 A;  2DTO A;  1BKB A;  1AHJ B;  2LX9 A;  1UGQ B;  1B34 A;  3JSC A;  4HCZ A;  4C8Q B;  4M75 E;  1VQ7 T;  3PMT A;  1FX7 A;  2DKG A;  1CZ4 A;  4D6W A;  3SDZ A;  2YVL A;  3OSV A;  5I21 A;  3G71 A;  2G3R A;  1ZHI A;  3L1A A;  4IUR A;  2MM2 A;  5GLF A;  1JRI A;  2O01 E;  3EAE A;  3P8B B;  2RA2 A;  4HT8 A;  3DB3 A;  5I2S A;  1G3T A;  3VYG A;  4Y28 E;  2RD1 A;  4M75 C;  3GPL A;  1SSF A;  4LD9 K;  3LGL A;  4OGC A;  1D3B A;  4PKC C;  3CBM A;  1QVG S;  3OYH A;  4LDV A;  3CXC S;  2YLB A;  2HQX A;  3BW1 A;  2QQA A;  3I55 T;  1YIJ A;  1Y7X A;  2FL7 A;  5GAM f;  2JZ2 A;  4N4G A;  3TRE A;  3JCM X;  4M7A D;  5LJ5 d;  3Q1J A;  2I2L A;  1W2B S;  2KQW A;  2O4X B;  2ZPG B;  4ZN1 A;  3PTA A;  2MM0 A;  4RV0 A;  3C94 A;  4EMH A;  3G6E T;  4OB1 B;  3L2Q A;  1QCS A;  2F5T X;  2EWN A;  1VQN T;  4PJO A;  3QBY A;  1M4Z A;  4M7D E;  1W2B A;  5DY9 A;  4N4I A;  1QVP A;  4XTW A;  5C1B A;  3L2V A;  3QZ5 B;  3A8O B;  2E6N A;  3NFC A;  4M78 G;  4J83 A;  2LNV A;  2FB7 A;  2JOY A;  2WAC A;  1S72 T;  2Y90 A;  4BI8 B;  2EQU A;  3FDR A;  2DIG A;  4QW2 A;  4XU2 A;  4PJO F;  5A0D A;  4JRP A;  2V8J A;  2M16 A;  1XQH A;  1N27 A;  4J8O A;  5GAN d;  3J7A F;  3HFN A;  2EAY A;  1O75 A;  3M55 A;  2NLU A;  2Q19 X;  4M7D F;  5GMK j;  4M7D B;  2CGH A;  2DZ9 A;  2K57 A;  4EMG A;  2FVU A;  4KDI A;  4E7I A;  3CF2 A;  5HK0 A;  1H3Z A;  3PFS A;  1UGR B;  2KDS A;  2DXT A;  2XDP A;  2QA4 A;  2RM4 A;  4L59 A;  5HY6 A;  2P0Q A;  5CO7 A;  1BIA A;  2ZPH B;  2AHJ B;  3QHS A;  5IT9 E;  2DTH A;  4BI3 A;  2LVM A;  1WJQ A;  4FU6 A;  3DLM A;  5AYF A;  2JUF A;  4M78 C;  3VUZ A;  1WJS A;  4Y91 A;  4M7A B;  2Q1C X;  1G3Y A;  4KUD K;  3I56 T;  1LOJ A;  1YJW T;  2YUJ A;  4M78 E;  5IN1 A;  2K2V A;  1JBM A;  2XID A;  2PJH B;  4XTZ A;  4J6W A;  1WGS A;  1RI0 A;  5IAY A;  2F5K A;  2P4T A;  3GNF B;  2Q1A X;  2XIC A;  5CCB A;  4M77 B;  3JCM d;  2X35 A;  2QI2 A;  4F7U A;  5J39 A;  1KD1 C;  1NPP A;  2JN0 A;  4JUV A;  5GAN 3;  4EDU A;  2A7Y A;  4FT4 A;  3J80 E;  4BAC A;  2PVO B;  3M58 A;  3JB9 I;  3OY9 A;  4BE0 A;  1KHI A;  4M7A E;  3C12 A;  2CZ1 B;  4OP0 A;  4ELY C;  2HNI A;  2WSF E;  3CEY A;  5DLQ E;  3FPT A;  3LHD A;  4BE1 A;  2QQS A;  2EFI A;  4GLK A;  3A5Z B;  4F7U F;  4HCC A;  3JCM P;  2GFA A;  1BI3 A;  2E6Z A;  3PNW C;  5CCX A;  4AS1 A;  4E7K A;  4BY6 B;  3PT9 A;  5D6Y A;  3SB2 A;  2DD4 A;  5LJ5 j;  2CZ0 B;  2RO0 A;  4MML A;  4RCB A;  4IUT A;  2B25 A;  2DXU A;  2EIF A;  4MZT A;  2K4Y A;  3LGF A;  3MP8 A;  1YIT A;  3A8M B;  1WNL A;  4M7D C;  4C8Q A;  3S3M A;  1QVF S;  2DXC A;  5GMK l;  2P0P A;  2R5A A;  2E1H A;  3OS2 A;  3KUF A;  5A2Q E;  5GAM e;  3L2U A;  5LJ5 f;  1YHQ A;  2QQR A;  4J6X A;  2YHT A;  1XNI A;  4ELZ C;  5L8R E;  1VQ8 T;  4HKE A;  5FRO A;  2OTL T;  3CC4 T;  5CCA A;  3ZGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...