2GF7A

Double tudor domain structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Jumonji domain-containing protein 2A
publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 21
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gf7A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gf7A02
3H6ZA 3L42A 4BACA 2QQSA 4NS5A 4N4HA 1KHCA 2NLUA 4IURA 2E6NA 1WJQA 3MO8A 2RHIA 5D6WA 2IG0A 2RJDA 2RO0A 4IUQA 2EQKA 3QIIA 5FROA 5KE2A 2RHYA 3OYIA 4E7LA 2GFUA 2M0OA 3DB3A 4X34A 3OYCA 1OYXA 3QJ6A 4IUUA 4QQGA 3FC3A 1RI0A 2K3YA 2RI3A 2EKOA 2RI2A 5D6XA 5IN1A 3P8HA 3L2QA 3S3MA 1WJSA 1OZ2A 1OI1A 4QVZA 1WJRA 2X4WA 3MEUA 5FRMA 3OA6A 2L8DA 4GY5A 2RJFA 3PFSA 3F70A 3KUFA 5C0MA 2L3RA 4UC4A 2JTFA 2MWOA 3OYFA 2DAQA 4L59A 4IUTA 3OYBA 5J26A 3OY9A 4QQDA 2X4YA 4PLLA 4ZTFA 3L2VA 1XNIA 2LDMA 2M1HA 1OZ3A 3OS0A 3E9FA 3NTHA 3META 3MP6A 4PL6A 3Q1JA 2E5QA 4FU6A 3ZEHA 2X4XA 2F5KA 4B9XA 3L2RA 3QKJA 4A4HA 3PNWC 2R57A 2EQJA 5M9OA 2P0KA 2MWPA 2XDPA 3GOXA 3OQ5A 3OYDA 3OMGA 3FLGA 3LGFA 2LCCA 2JZ2A 2O4XB 2XK0A 3MP1A 3QBYA 4E7HA 2LRQA 2RI5A 2RHUA 2HQXA 3FDRA 4Q5WA 2LVMA 4QW2A 2EQUA 4II1A 2K3XA 2D9TA 2X35A 4A4EA 3L2WA 3OS2A 4E7KA 3S3NA 3DB4A 5KCOA 2LTOA 1SSFA 2R5MA 3FEOA 2RHXA 2R5AA 5KH6A 4FL6A 1WGSA 2G3RA 2VYTA 4PLIA 4A4GA 2BIVA 2B8AA 2WACA 3MEAA 4A4FA 2BUDA 1H3ZA 3OYGA 5CIUA 3ASKA 5IAYA 2O4XA 3OYKA 2M16A 4IUPA 5KCHA 3LLRA 3M9QA 4N4IA 4C5HA 3O8VA 4B9WA 3LH0A 3EAEA 2BKDN 5FRNA 3OB9A 5C6SA 2DIQA 3CEYA 3E9GA 3ME9A 3MP8A 4E7IA 4OVAA 2DIGA 3OYEA 3NTKA 1N27A 3UWNA 4BE2A 2EFIA 3C4SA 3S6WA 4C5GA 4IKFA 2R58A 2GF7A 5KE3A 3UT1A 2RHZA 3OYHA 3H8ZA 3OYAA 3PMIA 3L2UA 2RJEA 4BDZA 2QQRA 3LGLA 4BE0A 1G5VA 2RJCA 3OYJA 3BDLA 2CKKA 2L89A 3LYIA 4N4GA 4QQ6A 3OYNA 3PMTA 2HQEA 4CRIA 5J39A 3P8DA 4BE1A 2YRVA 4HCZA 3NTIA 3LX7A 1MHNA 3OS1A 5D6YA 3SD4A 4E7JA 4C5EA 3MEVA 2GFAA 4RG2A 4C5IA 4BDYA 2PQWA 4LD6A 4BD3A 3S3OA 4Z02A 4EDUA 4IUVA 3OYLA 3DLMA 3MEWA 3OYMA 4ZTJA 3OMCA 2FHDA 2EQMA
chains in the Genus database with same CATH superfamily
1UUEA 2JM8A 4OMOA 3CCLA 2IIMA 4N4HA 4ELZC 3CC2T 2PZ1A 5FU6C 2ENMA 3EFSA 3I56T 4XK8E 3THKA 2K6DA 1VYUA 4XU1A 1ZHIA 3H0HA 1Z9QA 3QJ6A 5IXFA 4M7AB 2ED0A 2CS7A 4AG2C 4BI4A 5EC7A 4C8QD 1OZ2A 3GNGA 2L8DA 4FIBA 1NEGA 2L3RA 2JTFA 2FZGB 5GAOl 4OB3B 2J06A 2NUPA 1N9SA 2V1QA 1VIFA 4X1VA 3M5AA 1JRIA 3E2UA 3OBYA 2EQJA 3CCJA 1R0CB 1SRMA 5GANf 2Y90A 2E3HA 2K3BA 4LUDA 5FU7B 2LQKA 4OP0A 4HCBA 1OQKA 1GBQA 1VQ5A 1VQ7Q 3RR6A 3FEOA 1IO6A 2DJQA 1VYVA 2KVQG 1Y96A 2RQTA 1WHJA 2JMAA 2LT4A 4KUDK 3VS4A 4PJOD 1X27A 1RAEB 4M7DG 2X4JA 3TVTA 1VUBA 2LJ0A 2CREA 5KYYA 1S1NA 3CCVQ 1Q82C 1VQ8Q 1HXDA 1FMWA 1XTDA 4A4KA 1VQKQ 2HD0A 2YRVA 2EGCA 4HCZA 1M1KR 2KT8A 2E70A 1BIAA 2K2MA 5I2SA 4LD6A 3EGDA 1K8AC 1TXQA 1SKUB 1BCOA 1PKSA 5FU6B 3RUXA 2KAFA 3ER0A 4C0DC 4EMGA 1W1FA 2HBWA 1NEBA 4Y92A 4PFPA 4N0AC 1CZ5A 2ESWA 2JT4A 2JTEA 3CCMA 3GBQA 4WF2A 5CAIA 3H0FA 3ZJVA 4LNPA 1LJOA 3UA6A 2K3YA 1PD0A 3P8HA 4MZPA 3VUZA 4DOWA 2X4WA 3A8MB 5GANj 1RAIB 1YJWT 2ROTA 4IIOA 4RTXA 3JCMJ 1AWOA 3RNJA 1H92A 2JM9A 1KC8U 2VV5A 2LCCA 3WXMB 1XQHA 5LJ5d 4J9DA 1U06A 1AOJA 3L2WA 4C0FA 3OS2A 4JRPA 1N5ZA 4OMLA 1PG5B 2LP5A 3VJPA 3GP8A 4ESRA 2R5AA 2BIVA 1MV0B 2BZ8A 5I2MA 5CIUA 5KCHA 4FSSA 2COZA 1YI2T 1K8AR 2K57A 2E64A 1X6BA 4JS4A 4KH0B 2FRWA 1VA7A 2L3PA 4KT0E 2FVUA 1WX6A 2O2OA 3IQLA 1M4ZA 4OVAA 3NTKA 2CZ7B 5GAN5 3UT1A 2RHZA 2CZ6B 3OYHA 3X25B 3QQ8A 1E6GA 2QQRA 1QCNA 5GMKm 2Q19X 4VUBA 1OX8A 1P92A 2HQEA 5GAN6 3TIWA 4C0DB 3EGXA 4P5NA 2E4HA 2QQAA 5GAN7 3SD4A 4F04B 3MCAB 3QO3A 2OTJQ 4HVUA 1V29B 1N8RU 3QDFA 2PU9B 1VQ6T 4JJDA 2KR3A 1AZEA 2QTVA 5DLOA 2E1HA 1TWBA 4C8QF 2KMTA 3CXCS 5D6WA 2JS0A 4FYYB 2RHYA 2YRDA 1JQQA 3LW5E 3QYGB 2CGHA 1D1BA 2D8HA 2MIOA 1UFFA 2OAUA 2E41A 1YJWQ 4JDSA 1YJNT 2OTLT 2O31A 5GAMd 2YXYA 1RAGB 2DTOA 1QDNA 3JB9G 2MWOA 1QQJA 3M0SA 1NPPA 1W2BP 1MMGA 3V7CA 3META 2DJZA 3CCJT 4FU6A 2LX7A 2JN0A 2YUOA 2DX1A 3EFRA 5LJ5e 1YIJT 3JB9I 1TH7A 2P0KA 1JJ2P 2XDPA 2P0PA 1VQMT 3CD6Q 3MJXA 1S72A 1YHQQ 2BTTA 2NWMA 1QCOA 3QBYA 4BI3A 2QA4T 3CC4A 1YCYA 2D9TA 2AK5A 2QI2A 4PJOF 2LTOA 4C0GA 4OMNA 3A5ZB 1VQ9A 1OX9A 1KJWA 1EZZB 2DL4A 3HU1A 2A37A 4IUPA 1BCMA 2QYZA 3QWXX 5CCBA 3M57A 2O9SA 1PHTA 2LC4A 1T0JA 3C4SA 4IKFA 4J9IA 1KC8C 2QGFB 1D0YA 2XKOC 3CCUT 1QCSA 2YUQA 2ZPEB 2RJEA 5LJ5h 3CCSA 1ZSZC 4AFZC 2CKKA 1VQOA 3QWZA 5J39A 5EQJB 3CCLQ 3EHQA 1TS9A 4M78C 2DYIA 3I5SA 2COYA 4ZTJA 2DRKA 4JZ3A 1K9MU 3KXTA 3NHNA 2ED1A 4M7DA 3CMAA 1WXBA 4R56A 1N6AA 2MK5A 5AT1B 3QPHA 2QGGA 4F14A 5FROA 1M27C 3HU2A 1WHHA 1YJNQ 3VS7A 4IUUA 5FLXE 2EKOA 2KDSA 4Y28E 2K5IA 2L0AA 1G8XA 3MEUA 5CR2A 1G3SA 4D6WA 3CCJQ 4J5YA 3OY9A 2A28A 1ZUYA 1VQLT 3E9FA 3Q1JA 1WXUA 4HA8A 4J9GA 2YDLA 2D8JA 2COWA 1OEBA 5CO7A 1Y71A 2DK3A 1M2VB 2QA4Q 1MUZA 3I55T 1VQ5Q 1E7OA 1QP2A 3VUBA 2G6FX 4JRQA 2Q1DX 2VGMA 3M4GA 1KIKA 2EYQA 2DXBA 1WQ7A 3X24B 2F2VA 4LUEA 3EFOB 2ABLA 5A0DA 3HRSA 3QZ5B 3CPWP 5IHKA 5GAMh 3G71A 2EWNA 1Q81R 2H8HA 2VYTA 4F7UE 2AZSA 2YSQA 3OYGA 1YJ9A 5DYIA 3M58A 1ZSZB 2YUPA 4BE2A 1JO8A 1KQ2A 2VUBA 2R58A 2FB7A 2V8JA 1D0ZA 1B34B 2PUKB 1YITA 3PMIA 2VC8A 4M78B 3FRNA 1M30A 4E7SA 4M7AE 4J7FA 5CCXA 2XG8D 3QJYA 4GLMA 5I21A 8ATCB 1KQSA 1AVZC 3J80E 2FRYA 1MNDA 3S3OA 3HL8A 1UGPB 1BI3A 2D0QB 3CCMQ 4ZNXA 4C92F 3TQ7P 3H9NA 4XTXA 1N8RR 4M7DD 4C92C 1M1KU 1NLPC 2YWWA 5GMKj 1U8RA 1K0XA 1H8KA 2JXBA 3VS1A 3OYCA 2EW3A 1BI1A 2NUPB 3RERA 1NM7A 2RH2A 2XDDA 1OULA 2CP6A 2O9VA 5GAOm 3GF5A 2K5FA 1T3SA 5L8RE 3CQTA 2DAQA 2KT1A 4HVVA 2XDBA 4JJBA 2M1HA 1ZX6A 2X4XA 1K9MC 4XTYA 4ZGDB 1OPLA 2J6FA 1QVGP 5CD1A 3OQ5A 1W2BA 4M4ZA 3CC4T 2V8KA 4B6MA 5GAN3 4GBQA 2H3EB 1PNJA 4OMFB 3CMEA 3SFMA 5GAOq 4F7UG 1JJ2A 3INZA 3SDZA 1WGSA 1EFNA 2WACA 2XIDA 4DBFA 1HD3A 2HL3A 1B7TA 1GXIE 3ZGZA 3MP8A 2DVEA 1PC0A 2CP3A 3CCST 2CH4W 2GF7A 2PVGB 4M7AG 2QXFA 1PSEA 3LYIA 1OV3A 2HDAA 4XQ3A 1YN8A 2KGTA 3NTIA 4GLKA 4FW2A 4FCYA 1RAFB 1ZSGA 4C92B 5IT9E 4KUIA 5FTNA 3DLMA 3OYMA 2MMPA 4E47A 1ARKA 4X34A 1AHJB 4PJJA 6AT1B 4XTVA 2QQ9A 1KFZA 4DEXA 1KHCA 5FWBA 2J6KA 1K9MR 1YNZA 2HEQA 2XMFA 3CCVT 2HAXA 1RI9A 2D6FA 1Y57A 4MZMA 1YWPA 2NUZA 5D6XA 5CVIA 2V8IA 4OMMA 1OI1A 2CH4A 4OB0B 4PJLA 3HTRA 5J26A 1BBZA 2KYBA 4FT2A 4Z8AA 1ZUKA 2WSFE 3CC4Q 1G3YA 3J7AF 5CKFA 1IREB 1SEMA 1M1KC 1GCQC 3HP9A 2ZPGB 5GANe 2DF6A 2L2PA 3OYYA 1QWFA 3JCMe 2DVJA 1UB4A 1G3TA 2MI6A 2OI3A 2V26A 2RPNA 2C0TA 1SHGA 2B86A 4M77F 3G6ET 2WSEE 2GNCA 2R5MA 3QDRB 4M77C 5KYUA 3JB9D 2B8AA 4XTUA 1D1CA 2A3LA 4XU0A 5CKDA 3PIPA 4B9WA 3VYHB 3CCSQ 2DD4A 2BKDN 1ZUUA 1WLPB 1VQOQ 2F5TX 3CPWA 1RABB 3JCMf 2VGNA 1W4SA 1TOVA 4BDZA 5LJ3f 2RD1A 2W10A 1LNXA 4X9DA 3JCMc 3U23A 4BE1A 4OMPA 5GANh 1I07A 2AKLA 3HFNA 3CMAQ 2AHJB 2QEXA 4BDYA 2MYSA 4Z02A 4QVDA 5LL6S 2FHDA 4LDXA 3V8JA 2A08A 2ZPBB 1TUGB 1I81A 3EG9A 3R6OA 4MDWA 2VWFA 1IRXA 4RKUE 2E6NA 3RMSA 5FTJA 1VIEA 3QQ7A 1UG1A 2EQKA 2K7AA 2P0QA 4JJNK 4E7LA 1FWZA 1WIEA 2ZGWA 3CCQA 3MKDA 2DZCA 3H0IA 3FC3A 2CUBA 2RM4A 1SPKA 3M56A 4RTUA 3S3MA 3L2ZA 2DXCA 1B07A 3GIBA 2DTHA 2JMCA 5C0MA 2HQHA 2DE0X 3HHTB 4J83A 1GRIA 1FMVA 3HFOA 4IUTA 2OTJT 3M59A 1GL5A 1M5Q1 2KI7A 4J7IA 3JAME 4KGZB 2DYBA 2X51A 3MP6A 2HKQB 2RK1A 4LE9A 4PJMA 4RCBA 3G71Q 2JZ2A 4Z88A 7AT1B 4E7HA 3G6EQ 2EIFA 2AKKA 4M77B 2BZYA 1ZA2B 3PVLA 1YJ9Q 5DYGA 3PVQA 1QVGA 4QVCA 2EYXA 2GTJA 5LJ3j 1RAHB 4CC4B 2GBQA 2LW6A 3WVDB 4AFSC 4TVRA 1YITQ 4M75A 3LH0A 1VQPA 4C0ZA 2DIQA 2RQRA 1NYGA 3ME9A 1BI2A 2RK2A 2PVOB 3A8OB 4JS5A 2RN8A 3JCMb 1OU9A 1KQSS 4FYVB 1Q81U 3CD6T 1BU1A 4LDUA 2CYZB 1YHQT 3HRUA 1C0MA 1IGQA 3EG2A 4QQ6A 1KSWA 3PMTA 3X26B 5KYWA 4F7UA 5D6YA 4FYXB 3A8GB 3M0QA 2EAYA 2PQWA 1T3LA 2DKGA 1QVPA 4J9HA 4RTYA 2JW4A 3M54A 4BY6C 2CDTA 4JUVA 2LJ1A 5CKBA 4E6RA 3JCMP 5GANg 5ERGB 2RO0A 1FYNA 1TUCA 1NLOC 4M7AA 1PM3A 3JCMg 3CBOA 1UEBA 1QVFP 5GAN8 1WQWA 3OYIA 3DB3A 1IXDA 1ABOA 1U1TA 5LJ3g 1RAAB 2RI2A 5GAN2 5IN1A 2DNUA 5FRMA 5GAOp 3CCLT 2K9GA 2DBKA 1K76A 2EJFA 1CSKA 5FTLA 3FJ5A 4L59A 4DEYA 3E19A 1W2BS 4PL6A 3ULRB 3HKSA 4C8QC 4B9XA 4RTVA 3RKWA 1CR5A 5DM7R 3M0UA 2J05A 4XTWA 1IB8A 3CMEQ 5M9OA 3SWNC 1JJ2S 4M78E 2NYSA 1K0SA 3M0TA 2DEQA 3FDRA 3VS0A 4WCIA 3RKYA 3CCEA 3OS5A 2NUTB 2DL7A 5EPPA 2DZ9A 2M51A 2G3RA 4A4GA 3MEAA 3KBGA 3VV0A 2VB6A 1ACMB 1SRLA 1E32A 4NL3A 3O8VA 4JPBW 3OW2P 1WHMA 2EBPA 2LQWA 1R8OB 4M75D 1QW1A 1UGQB 2DIGA 3LH5A 3UWNA 4PNOA 3JB9H 2DRMA 1Q86R 1VQ5T 2MF2A 2EJGA 2F69A 1ABQA 1WZOA 2MAMA 2M9UA 3D7SB 4CRIA 1SHFA 4PJOC 1I4K1 3LX7A 2FG0A 4BY6B 4OMQA 2DLPA 1X69A 3M0PA 2D0NA 4A63B 1TG0A 4O6JA 3OMCA 2LNVA 2EQMA 2A36A 2OJ2A 1KD1R 1NG2A 1GFDA 1LCKA 2ZPHB 4M7AD 2LCLA 1Q81C 3C0CA 3A8LB 1PKTA 2JJ9A 5KYXB 1M3CA 2K79A 1NE8A 3FPTA 1M8VA 4MZTA 1WXTA 4QVZA 4K11A 2PWYA 4C8QB 3GNFB 3N5BB 2LCSA 2DTIA 5GJVB 3SWNB 5GMKe 3CBMA 3QHSA 3RIRA 3CCMT 1AWJA 3EG0A 1Q7YR 2F5KA 1VOMA 4KULA 3CCRA 4LN2A 2FZKB 3R6NA 4M78G 1NPRA 4KODA 4JRIA 3OMGA 5GAOr 2O88A 3VYGA 3G1JA 1RACB 4A4EA 1WPYA 3JSCA 1GBRA 2JTMA 3DB4A 1X01A 1Q95G 3CPWS 5GAN4 4C92E 1SG5A 4PLIA 1N8RC 1I8FA 1H3ZA 2BUDA 2O4XA 1VQ8A 3G4SA 2DEUA 1GFCA 1A0NB 2B25A 1VQKA 3QXEB 4J8OA 5GMKh 2DPPB 2PTKA 2AZVA 1VQ4A 2KEAA 4PJOB 3RDVA 2A7YA 2QEXQ 4O5VA 1G5VA 1D1AA 3CC2A 5GAMf 3I56A 4N0AA 4E7JA 1D3BB 1K73U 1V76A 2GQIA 1UGVA 1BKBA 1JXOA 3BE3A 4IUVA 4J6YA 2CSIA 3GLXA 4LDWA 3CCQQ 2EVRA 1H641 4Z89A 2QK0A 4BI8B 4R0KA 5KYNA 4QT7A 3ZL7C 1R77A 1QP3A 3J81E 2M0OA 1LPLA 1U3OA 3TCJA 4L5GA 3UDCA 1O75A 1MMNA 1IZ6A 4WTOB 3KUFA 4UC4A 1UJYA 2DXTA 2I0NA 3OYFA 1QVFA 2YLCA 1Y0MA 3C95A 3QYHB 1FMKA 3EGUA 4PFOA 2JV2A 3BY7A 2Y4YA 2FPDA 5L23A 4CC2A 1OPKA 2JS2A 3CC7A 1W70A 4J6WA 3CPFA 2AIRB 2GTOA 1QVGS 3TSWA 5FTKA 1F1BB 1X75C 4II1A 1CZ4A 1KG1A 4HVWA 3RESA 1KHIA 2C0OA 2CT4A 5KCOA 4M75F 4C92G 1VQPQ 3FPRA 1WHGA 1QKXA 1YCSB 1ZLMA 4CC7A 4IIMA 4M75C 2MM2A 4OGCA 4A4FA 1I5OB 4OGEA 4N4IA 1S72T 1R0BG 3QC8A 5GAMj 1O9SA 1Y96B 2BE7D 1M90R 2QDYB 4KRTA 3VS6A 1WI7A 2XHCA 1MMDA 1VQ9T 4HXJA 5GANd 2RJCA 1WLFA 1U5SA 1MNEA 3OYNA 5CCAA 3OW2A 3OSVA 3JCMd 5KYYB 1X2KA 4RG8A 2L3SA 3ZBDA 4D8DA 3VS2A 2C0IA 4C5EA 3MEVA 5LJ3d 2YUNA 1IHVA 3QZ9B 2IVWA 1LOJA 3JCMX 3REAB 1GCPA 4M7AF 2F1LA 3RKXA 4AFUC 1IHWA 2L5QA 4J9BA 2EJ9A 1NJIR 2CP5A 3EGDB 1YJWA 1VQOT 3M53A 2BE9B 4FYWB 1NZ9A 2QDLA 4M77E 2HL5C 2EQIA 1O54A 4LXCA 1V1CA 1X6GA 2KSSA 1WJSA 3NFCA 3EH1A 3CMAT 1X43A 1K73C 1IGUA 4Y91A 1HYOA 1M2VA 1OZ3A 4FW1A 1FXXA 5HY6A 2DMOA 5FW9A 2E5QA 1WNLA 4X9CA 2R57A 4XAXB 4AMCA 3CCEQ 2GGRA 2KXDA 3A98A 1YI2A 2ROLA 3EFOA 3MHXA 1TUDA 4XTZA 4KH1B 4M75B 1ZA1B 2IPOB 1QKWA 3M55A 1BYMA 4ELYC 3UPUA 5FTMA 1S72Q 1I9GA 4HKEA 1G3WA 1ZSZA 3EG1A 2LX9A 3OYKA 3LLRA 1Z9ZA 4OF1A 4E2FB 4AG1C 3EAEA 1B34A 3OB9A 1VQ9Q 3URGA 3X28B 4M78A 3OYEA 1Y7XA 1VQ6A 2Q1AX 2DL3A 3G71T 4AS1A 2PNIA 4BE0A 3OYJA 4DBHA 2KNBB 4ME7A 4OB1B 5LJ3e 3A1PA 4J6XA 1YJ9T 2J7IA 4ANJA 3LWHA 2CP7A 3EGXB 1WYXA 2CP0A 1M2OA 4EDUA 1Q86U 1K73R 4AQ7A 1YJNA 2OTLA 3C12A 1YITT 2GCXA 2J6OA 1ZBXA 4NS5A 2NLUA 3EH2A 4IURA 4EMKA 4QKUA 4HCCA 2RJDA 1T0HA 2E12A 2QAZA 3REBB 4M77G 4ZN1A 5FWCA 1I5LA 3PTAA 2GFUA 4LDYA 5IHNA 4M7DF 1K4US 4QQGA 2RI3A 3JCMh 1YIJA 4PJNA 3L2QA 3VS3A 4M7DC 3I9QA 1VQMA 1VQNA 2YT6A 3ZJUA 4GY5A 2RJFA 5LJ3h 9ATCB 3I5RA 2QA4A 1KD1U 3CCRQ 4MMLA 2X4YA 4ZTFA 3L2VA 1UJ0A 3CC7T 2OAWA 2O01E 3P8BB 1BI0A 3PNWC 2Z0WA 4DBQA 2ZPFB 3PE0A 2FL7A 2M0YA 2MWPA 1CKAA 3OYDA 1EX4A 2LMJA 2LRQA 2LVMA 4QW2A 2EQUA 2K3XA 5I11A 1ZQ1A 4KO8A 3G4SQ 1Q7YU 1FX7A 3MB5A 3VRZA 3CCUA 2VKNA 2FEIA 3CBPA 4FL6A 4A54A 2MPXC 1VQ4Q 2K2VA 3M9QA 4C5HA 2YUJA 4J9FA 2DXUA 5FRNA 3CC2Q 4E7IA 3L1AA 1ZC1A 4LDVA 3CMET 1N27A 2JUFA 3I56Q 2EFIA 2XD0A 4M78D 2EGAA 3ZFJA 1QWEA 3OBWA 3NPFA 3H8ZA 2HNIA 3VU3C 2ECZA 4C92A 3P8DA 2DO3A 5HKCA 3M4YA 2MM0A 4C8QE 2FYKA 5CQXA 2JNGA 4MMKA 3OSSC 1MV3A 3TSZA 2W0ZA 1PRMC 3LWIA 3L42A 4ARCA 2QASA 3VKIA 1AWWA 1TSFA 1UGSB 1PD1A 2DERA 3BDUA 3G7ZA 3JCMQ 4IUQA 4M7DB 3LHDA 1VQLA 5KE2A 1QVFS 3V7RA 4F17A 1HJDA 2K5LA 2KE9A 1RI0A 1M1GA 4D8KA 5B6CA 3I55A 4XU3A 3TREA 4E7ZA 2HZYA 1Q82R 4ATOA 1M1FA 4FT4A 3PFSA 1X6OA 3CC7Q 3AT1B 1M8MA 4RMOA 5IXBA 5HK3A 1PSFA 4YTLA 1XNIA 2ZAEA 3OS0A 2HSPA 1Q86C 3L2RA 1KQ1A 2JVVA 4HT9A 4PJOE 2CT3A 3FPUA 3DLLA 2KXCA 3UA7A 1S3SA 2O4XB 4RV0A 2KRSA 3O5ZA 2HQXA 1KQSP 3X20B 2DL5A 2ZPIB 4RTWA 2X35A 1UECA 3S3NA 2M02A 2LJ3A 1AEYA 2E10A 2EYYA 2RHXA 1JXMA 4KLNA 2RA2A 2D1XA 5D7UA 3A8HB 1K1ZA 1JU5C 3QSUA 3ASKA 1J3TA 4RUGA 1I1JA 2M16A 1KD1C 3JB9J 2KYMA 5C6SA 3OW2S 3JB9F 3FIFA 1DJ7B 3BW1A 4C5GA 3HRTA 5KE3A 1QMCA 2PJHB 2Q18X 3BDLA 1TU0B 5GMKi 2KROA 1QLYA 4C8QG 1UGRB 1MHNA 3OS1A 1M90U 4C92D 2E3IA 1JEGA 1Q7YC 3JV3A 2RB6A 4BD3A 1XJWB 2OX7A 2EYWA 4A53A 4KDLA 1OU8A 3QWYA 5A2QE 1PCXA 1SSHA 3HSBA 1UE9A 1G2BA 3QUIA 3CXCP 2XICA 1SF9A 1K9AA 2EPDA 3TEEA 4DQ2A 2H3JA 4CC3A 2QEXT 3H41A 1RLQC 1OYXA 2FZCB 3PIOA 1VQNT 8AT1B 5A0LA 3NGPA 2YRCA 1NJIU 2WSCE 3OA6A 1UTIA 3F70A 1GCQA 1RL2A 1WHKA 1JB0E 4JJCA 2FO0A 2LQNA 4PLLA 1YI2Q 1BIBA 2P84A 3I35A 3VRYA 2F2XA 1YP5A 1M9SA 5IH2A 3CCQT 5LJ5f 4PJOG 2E6ZA 1N9RA 1RADB 3VS5A 4JLGA 4M77A 3T9NA 2EYZA 3MPUB 4KDIA 4BB7A 2XK0A 2RI5A 2RHUA 3C94A 4EPCA 2X3XD 2HKNA 5KH6A 2DILA 4M78F 1OOTA 2VXFA 1UHCA 5IAYA 1VQ6Q 2MCNA 5HK0A 4DBRA 1CKBA 1VQ7A 2CZ1B 2KY9A 4JZ4A 3E9GA 2YVLA 2E5KA 2ZZDA 4HCKA 2DFUA 2YLBA 3OYAA 5CKEA 2P4RA 2GQVA 2AT1B 1B3QA 2X9HA 2OTLQ 5EG2A 3PGGA 5GAMe 1XOVA 1VQPT 3CCVA 5GMKl 3CF2A 2GFAA 3QG1A 3SHWA 2EKHA 3AHUA 1AT1B 3MEWA 4EMKC 4DA4A 3JCMW 3EG3A 1MMAA 1C1AA 4BACA 2QQSA 1I0CA 4XU2A 1WJQA 1YIJQ 3MO8A 2RNAA 2RHIA 2PUOB 1VQMQ 1VQNQ 4FM4B 2KK4A 1Y07A 2LT1A 3RBBB 4M75E 4ARIA 4KBMB 2CZ0B 4V2SA 5LJ5j 2QQBA 3JRZA 2HMAA 1AWXA 1BK2A 3V8LA 1YFNA 1KC8R 4KGXB 4L6V5 1M90C 4PFZA 2HBPA 3OYBA 4QQDA 5A0GA 4J9CA 2LQ8A 4FSXA 2LDMA 4R55A 3G6EA 3NTHA 3PT9A 2X3WD 1TTHB 3ZEHA 3BFMA 2VVKA 4A4HA 4AT1B 2QTXA 3GOXA 3CCUQ 4M77D 2NUTA 3LGFA 3V8KA 5AYFA 2DD5A 4F16A 4JRKA 3UATA 2DBMA 1ZBJA 4ZN3A 5GAOn 3HU3A 2FPEA 2KRMA 1D0XA 3SEMA 4EMHA 5CK9A 1NJIC 1R7RA 4RCCA 5KYUB 3GPLA 2SRCA 1AD5A 4HT8A 3WVEB 1LVKA 1UDLA 4ORZA 2CSQA 1PWTA 1NYFA 2K4YA 2RF0A 4PKCC 3JCMV 5LJ5g 3CCET 1E6HA 3S6WA 2Y4XA 2F2WA 1NBEB 1X2QA 2I2LA 2DA9A 3LGLA 4NOYA 2KRNA 2L89A 4N4GA 3HPWA 1C6VX 1G83A 2FPFA 3V7SA 1W6XA 4EMKB 2ATCB 4J9EA 3FB9A 2SEMA 3TU4K 3BQBA 3DKMA 5C18A 4C5IA 2LZ6B 1PRLC 4AFQC 2E65A 1VQLQ 2ZCFB 2V1RA 4RTTA 3H6ZA 2CP2A 4F7UF 3ZJTA 4OB2B 5I22A 3M0RA 3I55Q 2IG0A 2OTJA 5KYXA 3QIIA 3EG9B 1QCFA 4M75G 1H3HA 2HCKA 4C8QA 5IHIA 3KFVA 2EGEA 1M3AA 2RQUA 3CXCA 1WFWA 5J3BA 3LGAA 2KBTA 4ZGJB 1WJRA 3SWNA 1YWOA 3E1SA 2RMOA 2PVDB 5CKHA 4KGVB 4LD9K 4M7AC 1UHFA 4CQNA 1EIFA 4JLIA 1VYTA 1AZGB 2L3QA 3QKJA 1M3BA 1WDXA 2XU8A 2A0FB 2JOYA 1Q82U 1RUWA 2Q1CX 3FLGA 3MP1A 2VXEA 2MOXA 2P4TA 4ZGEB 3RMQA 1KK7A 4Q5WA 5CQYA 5GAMg 5GLFA 1MGQA 1HSQA 5DY9A 4CI0C 4E7KA 2BZXA 2VASA 3CD6A 1SSFA 3NMZC 1YHQA 1K8AU 2CUDA 5FU7C 3UF4A 2RQWA 3CCRT 2LNHB 2DL8A 1VQ7T 2YHTA 4PJOA 4DOVA 4RTZA 2KQWA 1WHLA 3CEYA 3EHRA 1YBYA 4PK4A 2RQVA 4EIKA 4NL2A 4M7DE 5ECAA 3L2UA 2XI9A 1BB9A 1D3BA 4BUGA 4MDXA 5C1BA 3SB2A 1U1SA 2C06A 1VQ8T 3G4ST 1JBMA 2QG9B 2DETA 2DM1A 3FJPA 5GJWB 1WA7A 4RG2A 1VQKT 5HCKA 5DLQE 1RLPC 1D09B 5KYWB 4F7UB 1VQ4T 3OYLA 2HSEB 1HK9A
chains in the Genus database with same CATH topology
4C92F 3LWIA 3L42A 4ARCA 3CCLA 3VKIA 4N4HA 4XTXA 4ELZC 4M7DD 4C92C 1UGSB 3CC2T 1M1KU 3BDUA 3G7ZA 5FU6C 3EFSA 3JCMQ 3I56T 4IUQA 4M7DB 5GMKj 3LHDA 1U8RA 4XK8E 1VQLA 5KE2A 2ZPHB 1QVFS 3OYCA 4M7AD 2LCLA 4XU1A 3V7RA 1Q81C 1BI1A 1ZHIA 3A8LB 3QJ6A 2K5LA 1RI0A 1M1GA 3RERA 5B6CA 4M7AB 1NE8A 2CS7A 4BI4A 2RH2A 2XDDA 4C8QD 3I55A 4XU3A 1M8VA 3FPTA 3TREA 5GAOm 1OZ2A 3GNGA 3GF5A 4MZTA 4QVZA 4ATOA 2K5FA 2L8DA 1M1FA 4FT4A 3PFSA 4FIBA 2PWYA 4C8QB 3GNFB 1X6OA 3N5BB 5L8RE 2L3RA 4RMOA 2JTFA 2DTIA 2DAQA 5HK3A 1PSFA 4YTLA 4OB3B 3SWNB 1XNIA 5GMKe 3CBMA 5GAOl 2XDBA 3QHSA 3RIRA 2M1HA 3CCMT 3OS0A 1Q86C 1N9SA 1VIFA 2X4XA 2F5KA 3L2RA 1K9MC 1KQ1A 3M5AA 4XTYA 1JRIA 4KULA 2JVVA 3OBYA 4ZGDB 2EQJA 3CCRA 3CCJA 4HT9A 4PJOE 3FPUA 5CD1A 4M78G 5GANf 1NPRA 2Y90A 3OQ5A 4JRIA 3DLLA 1W2BA 4KODA 3OMGA 1S3SA 3CC4T 2O4XB 2V8KA 5GAOr 5GAN3 4RV0A 3VYGA 5FU7B 2HQXA 3X20B 2ZPIB 2LQKA 2X35A 4A4EA 4OMFB 3CMEA 4OP0A 3SFMA 1WPYA 3JSCA 3S3NA 4HCBA 2JTMA 3DB4A 1X01A 5GAOq 2E10A 1VQ5A 3FEOA 3CPWS 2RHXA 5GAN4 4F7UG 1JJ2A 4KLNA 2RA2A 3INZA 3SDZA 4C92E 1WGSA 4PLIA 3A8HB 2KVQG 1Y96A 2WACA 2XIDA 1I8FA 1N8RC 2BUDA 1H3ZA 3QSUA 3ASKA 2O4XA 1KD1C 2M16A 1VQ8A 3G4SA 1GXIE 2LT4A 3ZGZA 3JB9J 4KUDK 5C6SA 3OW2S 4PJOD 2B25A 1VQKA 3MP8A 2X4JA 3JB9F 3QXEB 4J8OA 4M7DG 2DVEA 2DPPB 3FIFA 5GMKh 1DJ7B 1VUBA 3BW1A 1VQ4A 4PJOB 4C5GA 3CCST 2GF7A 3HRTA 5KE3A 2A7YA 2PJHB 2Q18X 1Q82C 2PVGB 4M7AG 4O5VA 1G5VA 3BDLA 2QXFA 1HXDA 1PSEA 3LYIA 4XQ3A 1XTDA 4A4KA 3CC2A 2HD0A 5GMKi 5GAMf 2YRVA 4HCZA 4N0AA 4C8QG 3NTIA 3I56A 1UGRB 1MHNA 3OS1A 4E7JA 1M90U 4C92D 1D3BB 4GLKA 2E70A 1K73U 1BIAA 1Q7YC 5I2SA 2RB6A 4LD6A 4BD3A 4C92B 5IT9E 1BKBA 4KUIA 5FTNA 4A53A 1K8AC 4IUVA 5FU6B 3DLMA 3RUXA 4C0DC 3OYMA 2KAFA 3ER0A 2MMPA 4J6YA 4E47A 4EMGA 4X34A 1AHJB 3GLXA 5A2QE 4LDWA 4XTVA 3HSBA 2QQ9A 1H641 3QUIA 1KHCA 2XICA 4N0AC 4BI8B 1CZ5A 2XD0A 4PJOC 3TEEA 3CCMA 4DQ2A 2H3JA 1QP3A 3J81E 4WF2A 2M0OA 5CAIA 3CCVT 2HAXA 3ZJVA 1LJOA 2QEXT 1OYXA 2D6FA 3TCJA 4MZMA 2K3YA 4L5GA 3PIOA 3UDCA 1O75A 1VQNT 5D6XA 5A0LA 4MZPA 2V8IA 3P8HA 5CVIA 3VUZA 4DOWA 1NJIU 1OI1A 2X4WA 1IZ6A 4OB0B 3A8MB 2WSCE 3OA6A 5GANj 3F70A 1RL2A 3KUFA 1YJWT 4UC4A 1JB0E 2DXTA 1QVFA 3OYFA 2YLCA 5J26A 3C95A 3QYHB 4PLLA 1BIBA 3JCMJ 3BY7A 2JV2A 2Y4YA 4FT2A 1M9SA 3CCQT 2WSFE 5LJ5f 4PJOG 2E6ZA 1N9RA 1G3YA 3CC7A 3J7AF 4J6WA 4JLGA 5CKFA 3CPFA 1KC8U 4M77A 1IREB 2VV5A 3T9NA 1QVGS 1M1KC 4KDIA 4BB7A 2LCCA 2XK0A 3HP9A 2ZPGB 3WXMB 5GANe 1XQHA 2RI5A 2RHUA 5FTKA 5LJ5d 3C94A 3OYYA 1X75C 4II1A 1CZ4A 1KG1A 3JCMe 3RESA 4C0FA 3OS2A 3L2WA 1UB4A 4EPCA 4JRPA 1G3TA 1KHIA 2MI6A 3VJPA 5KCOA 4M77F 3G6ET 4M75F 4C92G 3GP8A 2WSEE 3FPRA 2R5MA 2R5AA 5KH6A 3QDRB 4M77C 3JB9D 4M78F 4M75C 2B8AA 2BIVA 5I2MA 4OGCA 2MM2A 4A4FA 4XTUA 2VXFA 5CIUA 5IAYA 4OGEA 5KCHA 1YI2T 4N4IA 5HK0A 2A3LA 4XU0A 2K57A 5CKDA 2E64A 4B9WA 3PIPA 5GAMj 3VYHB 1S72T 3QC8A 4JS4A 1O9SA 2DD4A 2CZ1B 1Y96B 2BKDN 1VQ7A 2KY9A 2QDYB 4KT0E 2F5TX 3E9GA 3CPWA 2FVUA 4OVAA 1M4ZA 3NTKA 3JCMf 2CZ7B 2VGNA 1W4SA 2YVLA 2ZZDA 5GAN5 2XHCA 3UT1A 2YLBA 1VQ9T 2RHZA 2CZ6B 3OYAA 3X25B 3OYHA 3QQ8A 5GANd 4BDZA 5LJ3f 2QQRA 5CKEA 2RD1A 2RJCA 2GQVA 5GMKm 1LNXA 1WLFA 4VUBA 4X9DA 3OYNA 5CCAA 2Q19X 1P92A 2HQEA 5GAN6 3OW2A 3OSVA 3JCMd 3TIWA 3JCMc 4C0DB 4BE1A 4P5NA 4RG8A 5EG2A 3PGGA 5GANh 3ZBDA 2QQAA 5GAN7 3SD4A 5GAMe 4C5EA 1XOVA 1VQPT 3MEVA 3CCVA 3HFNA 5LJ3d 5GMKl 3CF2A 2AHJB 2GFAA 3MCAB 2QEXA 3QZ9B 4BDYA 2IVWA 1LOJA 3QG1A 3QO3A 3JCMX 3AHUA 4Z02A 1V29B 1N8RU 3MEWA 4QVDA 2PU9B 1VQ6T 5LL6S 4EMKC 2FHDA 4LDXA 4DA4A 4M7AF 3RKXA 3V8JA 2L5QA 2ZPBB 5DLOA 2EJ9A 3JCMW 1I81A 4BACA 2E1HA 2QQSA 3R6OA 4MDWA 1YJWA 4XU2A 4RKUE 2E6NA 3RMSA 4C8QF 1WJQA 2KMTA 3M53A 3CXCS 1VQOT 3MO8A 5FTJA 2RHIA 5D6WA 1ZC1A 1VIEA 3QQ7A 2PUOB 4FM4B 2KK4A 2EQKA 1NZ9A 2P0QA 2RHYA 4JJNK 1Y07A 2LT1A 4E7LA 3LW5E 4M77E 1FWZA 2ZGWA 3QYGB 4M75E 4KBMB 2DZCA 2CGHA 3CCQA 1O54A 4ARIA 3FC3A 2OAUA 2CZ0B 4V2SA 2RM4A 5LJ5j 2E41A 2QQBA 3JRZA 3M56A 4JDSA 3S3MA 2KSSA 3V8LA 1YJNT 1WJSA 2OTLT 3L2ZA 2DXCA 5GAMd 3GIBA 3NFCA 2DTHA 2DTOA 5C0MA 3CMAT 1QDNA 4L6V5 3JB9G 3HHTB 4J83A 2MWOA 1M90C 1K73C 1NPPA 2HBPA 3HFOA 4IUTA 3OYBA 2OTJT 4QQDA 5A0GA 2LQ8A 3M59A 4Y91A 4FSXA 1M5Q1 2LDMA 4J7IA 3V7CA 3JAME 4R55A 3G6EA 1OZ3A 3NTHA 1FXXA 3META 3MP6A 3PT9A 2DJZA 5HY6A 2E5QA 4FU6A 3ZEHA 1WNLA 3CCJT 3BFMA 4A4HA 2JN0A 2RK1A 4X9CA 2R57A 3EFRA 4XAXB 2QTXA 5LJ5e 1YIJT 3JB9I 1TH7A 2P0KA 4RCBA 2XDPA 3GOXA 1YI2A 2P0PA 1VQMT 4M77D 1S72A 3LGFA 3MHXA 2JZ2A 2DD5A 3QBYA 5AYFA 3V8KA 4BI3A 4XTZA 4E7HA 4JRKA 2QA4T 2EIFA 4M77B 4M75B 3CC4A 1YCYA 4ZN3A 2D9TA 5GAOn 3HU3A 2QI2A 3M55A 4PJOF 5DYGA 2LTOA 4C0GA 3A5ZB 1VQ9A 1BYMA 4EMHA 1QVGA 4ELYC 5CK9A 3UPUA 5FTMA 1NJIC 1R7RA 1I9GA 4QVCA 4HKEA 1G3WA 5LJ3j 3HU1A 2LX9A 3OYKA 4IUPA 3LLRA 4OF1A 2LW6A 3WVDB 4RCCA 4TVRA 4M75A 3LH0A 1VQPA 3EAEA 4C0ZA 3GPLA 1B34A 3OB9A 2DIQA 3URGA 3WVEB 4HT8A 3ME9A 1BI2A 3X28B 2RK2A 2PVOB 3A8OB 4M78A 4JS5A 3M57A 5CCBA 3JCMb 3OYEA 5LJ5g 2LC4A 2K4YA 3JCMV 3CCET 4PKCC 4M7DE 1Y7XA 3C4SA 3S6WA 4IKFA 1KQSS 1VQ6A 2Y4XA 1Q81U 2Q1AX 1KC8C 3CD6T 2XKOC 3CCUT 3G71T 1QCSA 4LDUA 2CYZB 2ZPEB 1YHQT 3HRUA 2I2LA 2RJEA 4AS1A 5LJ5h 3LGLA 4NOYA 3CCSA 3OYJA 4BE0A 2CKKA 2L89A 4N4GA 3HPWA 4QQ6A 1VQOA 4ME7A 3PMTA 4OB1B 3V7SA 3X26B 5LJ3e 4J6XA 5J39A 3QWZA 5EQJB 4EMKB 4F7UA 5D6YA 1YJ9T 3LWHA 3A8GB 3FB9A 3TU4K 3BQBA 3DKMA 4M78C 5C18A 4C5IA 2EAYA 2PQWA 2DKGA 2E65A 4EDUA 1Q86U 4ZTJA 4AQ7A 1QVPA 1K9MU 3M54A 2ZCFB 1YJNA 2OTLA 4BY6C 3C12A 3H6ZA 3KXTA 4M7DA 1YITT 4F7UF 2GCXA 4JUVA 1ZBXA 4NS5A 5CKBA 3CMAA 3ZJTA 2NLUA 4IURA 4OB2B 4R56A 4EMKA 3JCMP 5GANg 5ERGB 1N6AA 2OTJA 2IG0A 4HCCA 2RJDA 2RO0A 3QPHA 2E12A 4M7AA 4M77G 3JCMg 3CBOA 1UEBA 3QIIA 4M75G 1WQWA 5FROA 4ZN1A 5GAN8 3OYIA 1I5LA 3PTAA 2GFUA 4LDYA 3DB3A 3HU2A 4M7DF 4IUUA 1U1TA 4QQGA 4C8QA 5FLXE 5LJ3g 2RI3A 3JCMh 1YIJA 2EKOA 2RI2A 5GAN2 2KDSA 5IN1A 3L2QA 4Y28E 2K5IA 5J3BA 3CXCA 4ZGJB 4M7DC 3LGAA 1VQMA 5FRMA 1WJRA 5GAOp 3MEUA 1VQNA 3SWNA 3CCLT 3ZJUA 4GY5A 2RJFA 5LJ3h 3E1SA 2QA4A 5CR2A 1KD1U 4KDLA 1G3SA 2EJFA 2PVDB 4D6WA 4L59A 4J5YA 5CKHA 3E19A 4LD9K 5FTLA 3OY9A 1W2BS 4MMLA 2X4YA 4M7AC 4ZTFA 3L2VA 1VQLT 4CQNA 3CC7T 3E9FA 1EIFA 4JLIA 4PL6A 2O01E 3P8BB 3Q1JA 3HKSA 1BI0A 4C8QC 4B9XA 3QKJA 3RKWA 1CR5A 4HA8A 3PNWC 5DM7R 4XTWA 5CO7A 5M9OA 1Y71A 2DK3A 2XU8A 2JOYA 2ZPFB 1Q82U 2FL7A 3I55T 2MWPA 3SWNC 2Q1CX 3OYDA 1JJ2S 1QP2A 3FLGA 3VUBA 4JRQA 3MP1A 4M78E 2Q1DX 2VGMA 2VXEA 2P4TA 2LRQA 3RMQA 4ZGEB 3M4GA 2DEQA 2EYQA 3FDRA 2DXBA 2LVMA 4Q5WA 2EQUA 1WQ7A 4QW2A 5CQYA 3RKYA 5GAMg 2K3XA 3X24B 5GLFA 1MGQA 1ZQ1A 5DY9A 4KO8A 4CI0C 3CCEA 4E7KA 3OS5A 1Q7YU 5A0DA 1FX7A 3HRSA 3QZ5B 3MB5A 3CD6A 1SSFA 5GAMh 3G71A 3CCUA 2EWNA 1YHQA 5EPPA 2DZ9A 1K8AU 5FU7C 3CBPA 4FL6A 4A54A 2G3RA 2VYTA 4A4GA 4F7UE 3MEAA 3KBGA 3CCRT 3VV0A 2K2VA 3OYGA 1VQ7T 2YHTA 3M9QA 4C5HA 1E32A 2YUJA 4NL3A 3O8VA 1YJ9A 4PJOA 4DOVA 2DXUA 2KQWA 5FRNA 3M58A 5DYIA 3OMCA 1R8OB 3CEYA 4M75D 1YBYA 4E7IA 1UGQB 1QW1A 2DIGA 3L1AA 4LDVA 1N27A 2JUFA 4NL2A 2EFIA 3UWNA 3CMET 4BE2A 4PNOA 1KQ2A 4M78D 3JB9H 2VUBA 2R58A 2FB7A 2V8JA 3ZFJA 1VQ5T 1B34B 2PUKB 2MF2A 3OBWA 3H8ZA 2HNIA 3PMIA 3VU3C 2VC8A 2XI9A 2EJGA 2F69A 4M78B 3L2UA 1YITA 1D3BA 3FRNA 4M7AE 2MAMA 2M9UA 4BUGA 4MDXA 4J7FA 4CRIA 5C1BA 5CCXA 2XG8D 3P8DA 3QJYA 3SB2A 1I4K1 1U1SA 2DO3A 4C92A 3LX7A 1VQ8T 5HKCA 3G4ST 2C06A 1JBMA 3M4YA 4BY6B 5I21A 2MM0A 4C8QE 1KQSA 3FJPA 2FYKA 5CQXA 2JNGA 4RG2A 4MMKA 1VQKT 3J80E 3OSSC 5DLQE 3S3OA 3HL8A 4F7UB 1UGPB 4O6JA 3OYLA 1BI3A 1VQ4T 2D0QB 1HK9A 2LNVA 2EQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6Z A;  3L42 A;  4BAC A;  2QQS A;  4NS5 A;  4N4H A;  1KHC A;  2NLU A;  4IUR A;  2E6N A;  1WJQ A;  3MO8 A;  2RHI A;  5D6W A;  2IG0 A;  2RJD A;  2RO0 A;  4IUQ A;  2EQK A;  3QII A;  5FRO A;  5KE2 A;  2RHY A;  3OYI A;  4E7L A;  2GFU A;  2M0O A;  3DB3 A;  4X34 A;  3OYC A;  1OYX A;  3QJ6 A;  4IUU A;  4QQG A;  3FC3 A;  1RI0 A;  2K3Y A;  2RI3 A;  2EKO A;  2RI2 A;  5D6X A;  5IN1 A;  3P8H A;  3L2Q A;  3S3M A;  1WJS A;  1OZ2 A;  1OI1 A;  4QVZ A;  1WJR A;  2X4W A;  3MEU A;  5FRM A;  3OA6 A;  2L8D A;  4GY5 A;  2RJF A;  3PFS A;  3F70 A;  3KUF A;  5C0M A;  2L3R A;  4UC4 A;  2JTF A;  2MWO A;  3OYF A;  2DAQ A;  4L59 A;  4IUT A;  3OYB A;  5J26 A;  3OY9 A;  4QQD A;  2X4Y A;  4PLL A;  4ZTF A;  3L2V A;  1XNI A;  2LDM A;  2M1H A;  1OZ3 A;  3OS0 A;  3E9F A;  3NTH A;  3MET A;  3MP6 A;  4PL6 A;  3Q1J A;  2E5Q A;  4FU6 A;  3ZEH A;  2X4X A;  2F5K A;  4B9X A;  3L2R A;  3QKJ A;  4A4H A;  3PNW C;  2R57 A;  2EQJ A;  5M9O A;  2P0K A;  2MWP A;  2XDP A;  3GOX A;  3OQ5 A;  3OYD A;  3OMG A;  3FLG A;  3LGF A;  2LCC A;  2JZ2 A;  2O4X B;  2XK0 A;  3MP1 A;  3QBY A;  4E7H A;  2LRQ A;  2RI5 A;  2RHU A;  2HQX A;  3FDR A;  4Q5W A;  2LVM A;  4QW2 A;  2EQU A;  4II1 A;  2K3X A;  2D9T A;  2X35 A;  4A4E A;  3L2W A;  3OS2 A;  4E7K A;  3S3N A;  3DB4 A;  5KCO A;  2LTO A;  1SSF A;  2R5M A;  3FEO A;  2RHX A;  2R5A A;  5KH6 A;  4FL6 A;  1WGS A;  2G3R A;  2VYT A;  4PLI A;  4A4G A;  2BIV A;  2B8A A;  2WAC A;  3MEA A;  4A4F A;  2BUD A;  1H3Z A;  3OYG A;  5CIU A;  3ASK A;  5IAY A;  2O4X A;  3OYK A;  2M16 A;  4IUP A;  5KCH A;  3LLR A;  3M9Q A;  4N4I A;  4C5H A;  3O8V A;  4B9W A;  3LH0 A;  3EAE A;  2BKD N;  5FRN A;  3OB9 A;  5C6S A;  2DIQ A;  3CEY A;  3E9G A;  3ME9 A;  3MP8 A;  4E7I A;  4OVA A;  2DIG A;  3OYE A;  3NTK A;  1N27 A;  3UWN A;  4BE2 A;  2EFI A;  3C4S A;  3S6W A;  4C5G A;  4IKF A;  2R58 A;  2GF7 A;  5KE3 A;  3UT1 A;  2RHZ A;  3OYH A;  3H8Z A;  3OYA A;  3PMI A;  3L2U A;  2RJE A;  4BDZ A;  2QQR A;  3LGL A;  4BE0 A;  1G5V A;  2RJC A;  3OYJ A;  3BDL A;  2CKK A;  2L89 A;  3LYI A;  4N4G A;  4QQ6 A;  3OYN A;  3PMT A;  2HQE A;  4CRI A;  5J39 A;  3P8D A;  4BE1 A;  2YRV A;  4HCZ A;  3NTI A;  3LX7 A;  1MHN A;  3OS1 A;  5D6Y A;  3SD4 A;  4E7J A;  4C5E A;  3MEV A;  2GFA A;  4RG2 A;  4C5I A;  4BDY A;  2PQW A;  4LD6 A;  4BD3 A;  3S3O A;  4Z02 A;  4EDU A;  4IUV A;  3OYL A;  3DLM A;  3MEW A;  3OYM A;  4ZTJ A;  3OMC A;  2FHD A;  2EQM A; 
#chains in the Genus database with same CATH topology
 1UUE A;  2JM8 A;  4OMO A;  3CCL A;  2IIM A;  4N4H A;  4ELZ C;  3CC2 T;  2PZ1 A;  5FU6 C;  2ENM A;  3EFS A;  3I56 T;  4XK8 E;  3THK A;  2K6D A;  1VYU A;  4XU1 A;  1ZHI A;  3H0H A;  1Z9Q A;  3QJ6 A;  5IXF A;  4M7A B;  2ED0 A;  2CS7 A;  4AG2 C;  4BI4 A;  5EC7 A;  4C8Q D;  1OZ2 A;  3GNG A;  2L8D A;  4FIB A;  1NEG A;  2L3R A;  2JTF A;  2FZG B;  5GAO l;  4OB3 B;  2J06 A;  2NUP A;  1N9S A;  2V1Q A;  1VIF A;  4X1V A;  3M5A A;  1JRI A;  3E2U A;  3OBY A;  2EQJ A;  3CCJ A;  1R0C B;  1SRM A;  5GAN f;  2Y90 A;  2E3H A;  2K3B A;  4LUD A;  5FU7 B;  2LQK A;  4OP0 A;  4HCB A;  1OQK A;  1GBQ A;  1VQ5 A;  1VQ7 Q;  3RR6 A;  3FEO A;  1IO6 A;  2DJQ A;  1VYV A;  2KVQ G;  1Y96 A;  2RQT A;  1WHJ A;  2JMA A;  2LT4 A;  4KUD K;  3VS4 A;  4PJO D;  1X27 A;  1RAE B;  4M7D G;  2X4J A;  3TVT A;  1VUB A;  2LJ0 A;  2CRE A;  5KYY A;  1S1N A;  3CCV Q;  1Q82 C;  1VQ8 Q;  1HXD A;  1FMW A;  1XTD A;  4A4K A;  1VQK Q;  2HD0 A;  2YRV A;  2EGC A;  4HCZ A;  1M1K R;  2KT8 A;  2E70 A;  1BIA A;  2K2M A;  5I2S A;  4LD6 A;  3EGD A;  1K8A C;  1TXQ A;  1SKU B;  1BCO A;  1PKS A;  5FU6 B;  3RUX A;  2KAF A;  3ER0 A;  4C0D C;  4EMG A;  1W1F A;  2HBW A;  1NEB A;  4Y92 A;  4PFP A;  4N0A C;  1CZ5 A;  2ESW A;  2JT4 A;  2JTE A;  3CCM A;  3GBQ A;  4WF2 A;  5CAI A;  3H0F A;  3ZJV A;  4LNP A;  1LJO A;  3UA6 A;  2K3Y A;  1PD0 A;  3P8H A;  4MZP A;  3VUZ A;  4DOW A;  2X4W A;  3A8M B;  5GAN j;  1RAI B;  1YJW T;  2ROT A;  4IIO A;  4RTX A;  3JCM J;  1AWO A;  3RNJ A;  1H92 A;  2JM9 A;  1KC8 U;  2VV5 A;  2LCC A;  3WXM B;  1XQH A;  5LJ5 d;  4J9D A;  1U06 A;  1AOJ A;  3L2W A;  4C0F A;  3OS2 A;  4JRP A;  1N5Z A;  4OML A;  1PG5 B;  2LP5 A;  3VJP A;  3GP8 A;  4ESR A;  2R5A A;  2BIV A;  1MV0 B;  2BZ8 A;  5I2M A;  5CIU A;  5KCH A;  4FSS A;  2COZ A;  1YI2 T;  1K8A R;  2K57 A;  2E64 A;  1X6B A;  4JS4 A;  4KH0 B;  2FRW A;  1VA7 A;  2L3P A;  4KT0 E;  2FVU A;  1WX6 A;  2O2O A;  3IQL A;  1M4Z A;  4OVA A;  3NTK A;  2CZ7 B;  5GAN 5;  3UT1 A;  2RHZ A;  2CZ6 B;  3OYH A;  3X25 B;  3QQ8 A;  1E6G A;  2QQR A;  1QCN A;  5GMK m;  2Q19 X;  4VUB A;  1OX8 A;  1P92 A;  2HQE A;  5GAN 6;  3TIW A;  4C0D B;  3EGX A;  4P5N A;  2E4H A;  2QQA A;  5GAN 7;  3SD4 A;  4F04 B;  3MCA B;  3QO3 A;  2OTJ Q;  4HVU A;  1V29 B;  1N8R U;  3QDF A;  2PU9 B;  1VQ6 T;  4JJD A;  2KR3 A;  1AZE A;  2QTV A;  5DLO A;  2E1H A;  1TWB A;  4C8Q F;  2KMT A;  3CXC S;  5D6W A;  2JS0 A;  4FYY B;  2RHY A;  2YRD A;  1JQQ A;  3LW5 E;  3QYG B;  2CGH A;  1D1B A;  2D8H A;  2MIO A;  1UFF A;  2OAU A;  2E41 A;  1YJW Q;  4JDS A;  1YJN T;  2OTL T;  2O31 A;  5GAM d;  2YXY A;  1RAG B;  2DTO A;  1QDN A;  3JB9 G;  2MWO A;  1QQJ A;  3M0S A;  1NPP A;  1W2B P;  1MMG A;  3V7C A;  3MET A;  2DJZ A;  3CCJ T;  4FU6 A;  2LX7 A;  2JN0 A;  2YUO A;  2DX1 A;  3EFR A;  5LJ5 e;  1YIJ T;  3JB9 I;  1TH7 A;  2P0K A;  1JJ2 P;  2XDP A;  2P0P A;  1VQM T;  3CD6 Q;  3MJX A;  1S72 A;  1YHQ Q;  2BTT A;  2NWM A;  1QCO A;  3QBY A;  4BI3 A;  2QA4 T;  3CC4 A;  1YCY A;  2D9T A;  2AK5 A;  2QI2 A;  4PJO F;  2LTO A;  4C0G A;  4OMN A;  3A5Z B;  1VQ9 A;  1OX9 A;  1KJW A;  1EZZ B;  2DL4 A;  3HU1 A;  2A37 A;  4IUP A;  1BCM A;  2QYZ A;  3QWX X;  5CCB A;  3M57 A;  2O9S A;  1PHT A;  2LC4 A;  1T0J A;  3C4S A;  4IKF A;  4J9I A;  1KC8 C;  2QGF B;  1D0Y A;  2XKO C;  3CCU T;  1QCS A;  2YUQ A;  2ZPE B;  2RJE A;  5LJ5 h;  3CCS A;  1ZSZ C;  4AFZ C;  2CKK A;  1VQO A;  3QWZ A;  5J39 A;  5EQJ B;  3CCL Q;  3EHQ A;  1TS9 A;  4M78 C;  2DYI A;  3I5S A;  2COY A;  4ZTJ A;  2DRK A;  4JZ3 A;  1K9M U;  3KXT A;  3NHN A;  2ED1 A;  4M7D A;  3CMA A;  1WXB A;  4R56 A;  1N6A A;  2MK5 A;  5AT1 B;  3QPH A;  2QGG A;  4F14 A;  5FRO A;  1M27 C;  3HU2 A;  1WHH A;  1YJN Q;  3VS7 A;  4IUU A;  5FLX E;  2EKO A;  2KDS A;  4Y28 E;  2K5I A;  2L0A A;  1G8X A;  3MEU A;  5CR2 A;  1G3S A;  4D6W A;  3CCJ Q;  4J5Y A;  3OY9 A;  2A28 A;  1ZUY A;  1VQL T;  3E9F A;  3Q1J A;  1WXU A;  4HA8 A;  4J9G A;  2YDL A;  2D8J A;  2COW A;  1OEB A;  5CO7 A;  1Y71 A;  2DK3 A;  1M2V B;  2QA4 Q;  1MUZ A;  3I55 T;  1VQ5 Q;  1E7O A;  1QP2 A;  3VUB A;  2G6F X;  4JRQ A;  2Q1D X;  2VGM A;  3M4G A;  1KIK A;  2EYQ A;  2DXB A;  1WQ7 A;  3X24 B;  2F2V A;  4LUE A;  3EFO B;  2ABL A;  5A0D A;  3HRS A;  3QZ5 B;  3CPW P;  5IHK A;  5GAM h;  3G71 A;  2EWN A;  1Q81 R;  2H8H A;  2VYT A;  4F7U E;  2AZS A;  2YSQ A;  3OYG A;  1YJ9 A;  5DYI A;  3M58 A;  1ZSZ B;  2YUP A;  4BE2 A;  1JO8 A;  1KQ2 A;  2VUB A;  2R58 A;  2FB7 A;  2V8J A;  1D0Z A;  1B34 B;  2PUK B;  1YIT A;  3PMI A;  2VC8 A;  4M78 B;  3FRN A;  1M30 A;  4E7S A;  4M7A E;  4J7F A;  5CCX A;  2XG8 D;  3QJY A;  4GLM A;  5I21 A;  8ATC B;  1KQS A;  1AVZ C;  3J80 E;  2FRY A;  1MND A;  3S3O A;  3HL8 A;  1UGP B;  1BI3 A;  2D0Q B;  3CCM Q;  4ZNX A;  4C92 F;  3TQ7 P;  3H9N A;  4XTX A;  1N8R R;  4M7D D;  4C92 C;  1M1K U;  1NLP C;  2YWW A;  5GMK j;  1U8R A;  1K0X A;  1H8K A;  2JXB A;  3VS1 A;  3OYC A;  2EW3 A;  1BI1 A;  2NUP B;  3RER A;  1NM7 A;  2RH2 A;  2XDD A;  1OUL A;  2CP6 A;  2O9V A;  5GAO m;  3GF5 A;  2K5F A;  1T3S A;  5L8R E;  3CQT A;  2DAQ A;  2KT1 A;  4HVV A;  2XDB A;  4JJB A;  2M1H A;  1ZX6 A;  2X4X A;  1K9M C;  4XTY A;  4ZGD B;  1OPL A;  2J6F A;  1QVG P;  5CD1 A;  3OQ5 A;  1W2B A;  4M4Z A;  3CC4 T;  2V8K A;  4B6M A;  5GAN 3;  4GBQ A;  2H3E B;  1PNJ A;  4OMF B;  3CME A;  3SFM A;  5GAO q;  4F7U G;  1JJ2 A;  3INZ A;  3SDZ A;  1WGS A;  1EFN A;  2WAC A;  2XID A;  4DBF A;  1HD3 A;  2HL3 A;  1B7T A;  1GXI E;  3ZGZ A;  3MP8 A;  2DVE A;  1PC0 A;  2CP3 A;  3CCS T;  2CH4 W;  2GF7 A;  2PVG B;  4M7A G;  2QXF A;  1PSE A;  3LYI A;  1OV3 A;  2HDA A;  4XQ3 A;  1YN8 A;  2KGT A;  3NTI A;  4GLK A;  4FW2 A;  4FCY A;  1RAF B;  1ZSG A;  4C92 B;  5IT9 E;  4KUI A;  5FTN A;  3DLM A;  3OYM A;  2MMP A;  4E47 A;  1ARK A;  4X34 A;  1AHJ B;  4PJJ A;  6AT1 B;  4XTV A;  2QQ9 A;  1KFZ A;  4DEX A;  1KHC A;  5FWB A;  2J6K A;  1K9M R;  1YNZ A;  2HEQ A;  2XMF A;  3CCV T;  2HAX A;  1RI9 A;  2D6F A;  1Y57 A;  4MZM A;  1YWP A;  2NUZ A;  5D6X A;  5CVI A;  2V8I A;  4OMM A;  1OI1 A;  2CH4 A;  4OB0 B;  4PJL A;  3HTR A;  5J26 A;  1BBZ A;  2KYB A;  4FT2 A;  4Z8A A;  1ZUK A;  2WSF E;  3CC4 Q;  1G3Y A;  3J7A F;  5CKF A;  1IRE B;  1SEM A;  1M1K C;  1GCQ C;  3HP9 A;  2ZPG B;  5GAN e;  2DF6 A;  2L2P A;  3OYY A;  1QWF A;  3JCM e;  2DVJ A;  1UB4 A;  1G3T A;  2MI6 A;  2OI3 A;  2V26 A;  2RPN A;  2C0T A;  1SHG A;  2B86 A;  4M77 F;  3G6E T;  2WSE E;  2GNC A;  2R5M A;  3QDR B;  4M77 C;  5KYU A;  3JB9 D;  2B8A A;  4XTU A;  1D1C A;  2A3L A;  4XU0 A;  5CKD A;  3PIP A;  4B9W A;  3VYH B;  3CCS Q;  2DD4 A;  2BKD N;  1ZUU A;  1WLP B;  1VQO Q;  2F5T X;  3CPW A;  1RAB B;  3JCM f;  2VGN A;  1W4S A;  1TOV A;  4BDZ A;  5LJ3 f;  2RD1 A;  2W10 A;  1LNX A;  4X9D A;  3JCM c;  3U23 A;  4BE1 A;  4OMP A;  5GAN h;  1I07 A;  2AKL A;  3HFN A;  3CMA Q;  2AHJ B;  2QEX A;  4BDY A;  2MYS A;  4Z02 A;  4QVD A;  5LL6 S;  2FHD A;  4LDX A;  3V8J A;  2A08 A;  2ZPB B;  1TUG B;  1I81 A;  3EG9 A;  3R6O A;  4MDW A;  2VWF A;  1IRX A;  4RKU E;  2E6N A;  3RMS A;  5FTJ A;  1VIE A;  3QQ7 A;  1UG1 A;  2EQK A;  2K7A A;  2P0Q A;  4JJN K;  4E7L A;  1FWZ A;  1WIE A;  2ZGW A;  3CCQ A;  3MKD A;  2DZC A;  3H0I A;  3FC3 A;  2CUB A;  2RM4 A;  1SPK A;  3M56 A;  4RTU A;  3S3M A;  3L2Z A;  2DXC A;  1B07 A;  3GIB A;  2DTH A;  2JMC A;  5C0M A;  2HQH A;  2DE0 X;  3HHT B;  4J83 A;  1GRI A;  1FMV A;  3HFO A;  4IUT A;  2OTJ T;  3M59 A;  1GL5 A;  1M5Q 1;  2KI7 A;  4J7I A;  3JAM E;  4KGZ B;  2DYB A;  2X51 A;  3MP6 A;  2HKQ B;  2RK1 A;  4LE9 A;  4PJM A;  4RCB A;  3G71 Q;  2JZ2 A;  4Z88 A;  7AT1 B;  4E7H A;  3G6E Q;  2EIF A;  2AKK A;  4M77 B;  2BZY A;  1ZA2 B;  3PVL A;  1YJ9 Q;  5DYG A;  3PVQ A;  1QVG A;  4QVC A;  2EYX A;  2GTJ A;  5LJ3 j;  1RAH B;  4CC4 B;  2GBQ A;  2LW6 A;  3WVD B;  4AFS C;  4TVR A;  1YIT Q;  4M75 A;  3LH0 A;  1VQP A;  4C0Z A;  2DIQ A;  2RQR A;  1NYG A;  3ME9 A;  1BI2 A;  2RK2 A;  2PVO B;  3A8O B;  4JS5 A;  2RN8 A;  3JCM b;  1OU9 A;  1KQS S;  4FYV B;  1Q81 U;  3CD6 T;  1BU1 A;  4LDU A;  2CYZ B;  1YHQ T;  3HRU A;  1C0M A;  1IGQ A;  3EG2 A;  4QQ6 A;  1KSW A;  3PMT A;  3X26 B;  5KYW A;  4F7U A;  5D6Y A;  4FYX B;  3A8G B;  3M0Q A;  2EAY A;  2PQW A;  1T3L A;  2DKG A;  1QVP A;  4J9H A;  4RTY A;  2JW4 A;  3M54 A;  4BY6 C;  2CDT A;  4JUV A;  2LJ1 A;  5CKB A;  4E6R A;  3JCM P;  5GAN g;  5ERG B;  2RO0 A;  1FYN A;  1TUC A;  1NLO C;  4M7A A;  1PM3 A;  3JCM g;  3CBO A;  1UEB A;  1QVF P;  5GAN 8;  1WQW A;  3OYI A;  3DB3 A;  1IXD A;  1ABO A;  1U1T A;  5LJ3 g;  1RAA B;  2RI2 A;  5GAN 2;  5IN1 A;  2DNU A;  5FRM A;  5GAO p;  3CCL T;  2K9G A;  2DBK A;  1K76 A;  2EJF A;  1CSK A;  5FTL A;  3FJ5 A;  4L59 A;  4DEY A;  3E19 A;  1W2B S;  4PL6 A;  3ULR B;  3HKS A;  4C8Q C;  4B9X A;  4RTV A;  3RKW A;  1CR5 A;  5DM7 R;  3M0U A;  2J05 A;  4XTW A;  1IB8 A;  3CME Q;  5M9O A;  3SWN C;  1JJ2 S;  4M78 E;  2NYS A;  1K0S A;  3M0T A;  2DEQ A;  3FDR A;  3VS0 A;  4WCI A;  3RKY A;  3CCE A;  3OS5 A;  2NUT B;  2DL7 A;  5EPP A;  2DZ9 A;  2M51 A;  2G3R A;  4A4G A;  3MEA A;  3KBG A;  3VV0 A;  2VB6 A;  1ACM B;  1SRL A;  1E32 A;  4NL3 A;  3O8V A;  4JPB W;  3OW2 P;  1WHM A;  2EBP A;  2LQW A;  1R8O B;  4M75 D;  1QW1 A;  1UGQ B;  2DIG A;  3LH5 A;  3UWN A;  4PNO A;  3JB9 H;  2DRM A;  1Q86 R;  1VQ5 T;  2MF2 A;  2EJG A;  2F69 A;  1ABQ A;  1WZO A;  2MAM A;  2M9U A;  3D7S B;  4CRI A;  1SHF A;  4PJO C;  1I4K 1;  3LX7 A;  2FG0 A;  4BY6 B;  4OMQ A;  2DLP A;  1X69 A;  3M0P A;  2D0N A;  4A63 B;  1TG0 A;  4O6J A;  3OMC A;  2LNV A;  2EQM A;  2A36 A;  2OJ2 A;  1KD1 R;  1NG2 A;  1GFD A;  1LCK A;  2ZPH B;  4M7A D;  2LCL A;  1Q81 C;  3C0C A;  3A8L B;  1PKT A;  2JJ9 A;  5KYX B;  1M3C A;  2K79 A;  1NE8 A;  3FPT A;  1M8V A;  4MZT A;  1WXT A;  4QVZ A;  4K11 A;  2PWY A;  4C8Q B;  3GNF B;  3N5B B;  2LCS A;  2DTI A;  5GJV B;  3SWN B;  5GMK e;  3CBM A;  3QHS A;  3RIR A;  3CCM T;  1AWJ A;  3EG0 A;  1Q7Y R;  2F5K A;  1VOM A;  4KUL A;  3CCR A;  4LN2 A;  2FZK B;  3R6N A;  4M78 G;  1NPR A;  4KOD A;  4JRI A;  3OMG A;  5GAO r;  2O88 A;  3VYG A;  3G1J A;  1RAC B;  4A4E A;  1WPY A;  3JSC A;  1GBR A;  2JTM A;  3DB4 A;  1X01 A;  1Q95 G;  3CPW S;  5GAN 4;  4C92 E;  1SG5 A;  4PLI A;  1N8R C;  1I8F A;  1H3Z A;  2BUD A;  2O4X A;  1VQ8 A;  3G4S A;  2DEU A;  1GFC A;  1A0N B;  2B25 A;  1VQK A;  3QXE B;  4J8O A;  5GMK h;  2DPP B;  2PTK A;  2AZV A;  1VQ4 A;  2KEA A;  4PJO B;  3RDV A;  2A7Y A;  2QEX Q;  4O5V A;  1G5V A;  1D1A A;  3CC2 A;  5GAM f;  3I56 A;  4N0A A;  4E7J A;  1D3B B;  1K73 U;  1V76 A;  2GQI A;  1UGV A;  1BKB A;  1JXO A;  3BE3 A;  4IUV A;  4J6Y A;  2CSI A;  3GLX A;  4LDW A;  3CCQ Q;  2EVR A;  1H64 1;  4Z89 A;  2QK0 A;  4BI8 B;  4R0K A;  5KYN A;  4QT7 A;  3ZL7 C;  1R77 A;  1QP3 A;  3J81 E;  2M0O A;  1LPL A;  1U3O A;  3TCJ A;  4L5G A;  3UDC A;  1O75 A;  1MMN A;  1IZ6 A;  4WTO B;  3KUF A;  4UC4 A;  1UJY A;  2DXT A;  2I0N A;  3OYF A;  1QVF A;  2YLC A;  1Y0M A;  3C95 A;  3QYH B;  1FMK A;  3EGU A;  4PFO A;  2JV2 A;  3BY7 A;  2Y4Y A;  2FPD A;  5L23 A;  4CC2 A;  1OPK A;  2JS2 A;  3CC7 A;  1W70 A;  4J6W A;  3CPF A;  2AIR B;  2GTO A;  1QVG S;  3TSW A;  5FTK A;  1F1B B;  1X75 C;  4II1 A;  1CZ4 A;  1KG1 A;  4HVW A;  3RES A;  1KHI A;  2C0O A;  2CT4 A;  5KCO A;  4M75 F;  4C92 G;  1VQP Q;  3FPR A;  1WHG A;  1QKX A;  1YCS B;  1ZLM A;  4CC7 A;  4IIM A;  4M75 C;  2MM2 A;  4OGC A;  4A4F A;  1I5O B;  4OGE A;  4N4I A;  1S72 T;  1R0B G;  3QC8 A;  5GAM j;  1O9S A;  1Y96 B;  2BE7 D;  1M90 R;  2QDY B;  4KRT A;  3VS6 A;  1WI7 A;  2XHC A;  1MMD A;  1VQ9 T;  4HXJ A;  5GAN d;  2RJC A;  1WLF A;  1U5S A;  1MNE A;  3OYN A;  5CCA A;  3OW2 A;  3OSV A;  3JCM d;  5KYY B;  1X2K A;  4RG8 A;  2L3S A;  3ZBD A;  4D8D A;  3VS2 A;  2C0I A;  4C5E A;  3MEV A;  5LJ3 d;  2YUN A;  1IHV A;  3QZ9 B;  2IVW A;  1LOJ A;  3JCM X;  3REA B;  1GCP A;  4M7A F;  2F1L A;  3RKX A;  4AFU C;  1IHW A;  2L5Q A;  4J9B A;  2EJ9 A;  1NJI R;  2CP5 A;  3EGD B;  1YJW A;  1VQO T;  3M53 A;  2BE9 B;  4FYW B;  1NZ9 A;  2QDL A;  4M77 E;  2HL5 C;  2EQI A;  1O54 A;  4LXC A;  1V1C A;  1X6G A;  2KSS A;  1WJS A;  3NFC A;  3EH1 A;  3CMA T;  1X43 A;  1K73 C;  1IGU A;  4Y91 A;  1HYO A;  1M2V A;  1OZ3 A;  4FW1 A;  1FXX A;  5HY6 A;  2DMO A;  5FW9 A;  2E5Q A;  1WNL A;  4X9C A;  2R57 A;  4XAX B;  4AMC A;  3CCE Q;  2GGR A;  2KXD A;  3A98 A;  1YI2 A;  2ROL A;  3EFO A;  3MHX A;  1TUD A;  4XTZ A;  4KH1 B;  4M75 B;  1ZA1 B;  2IPO B;  1QKW A;  3M55 A;  1BYM A;  4ELY C;  3UPU A;  5FTM A;  1S72 Q;  1I9G A;  4HKE A;  1G3W A;  1ZSZ A;  3EG1 A;  2LX9 A;  3OYK A;  3LLR A;  1Z9Z A;  4OF1 A;  4E2F B;  4AG1 C;  3EAE A;  1B34 A;  3OB9 A;  1VQ9 Q;  3URG A;  3X28 B;  4M78 A;  3OYE A;  1Y7X A;  1VQ6 A;  2Q1A X;  2DL3 A;  3G71 T;  4AS1 A;  2PNI A;  4BE0 A;  3OYJ A;  4DBH A;  2KNB B;  4ME7 A;  4OB1 B;  5LJ3 e;  3A1P A;  4J6X A;  1YJ9 T;  2J7I A;  4ANJ A;  3LWH A;  2CP7 A;  3EGX B;  1WYX A;  2CP0 A;  1M2O A;  4EDU A;  1Q86 U;  1K73 R;  4AQ7 A;  1YJN A;  2OTL A;  3C12 A;  1YIT T;  2GCX A;  2J6O A;  1ZBX A;  4NS5 A;  2NLU A;  3EH2 A;  4IUR A;  4EMK A;  4QKU A;  4HCC A;  2RJD A;  1T0H A;  2E12 A;  2QAZ A;  3REB B;  4M77 G;  4ZN1 A;  5FWC A;  1I5L A;  3PTA A;  2GFU A;  4LDY A;  5IHN A;  4M7D F;  1K4U S;  4QQG A;  2RI3 A;  3JCM h;  1YIJ A;  4PJN A;  3L2Q A;  3VS3 A;  4M7D C;  3I9Q A;  1VQM A;  1VQN A;  2YT6 A;  3ZJU A;  4GY5 A;  2RJF A;  5LJ3 h;  9ATC B;  3I5R A;  2QA4 A;  1KD1 U;  3CCR Q;  4MML A;  2X4Y A;  4ZTF A;  3L2V A;  1UJ0 A;  3CC7 T;  2OAW A;  2O01 E;  3P8B B;  1BI0 A;  3PNW C;  2Z0W A;  4DBQ A;  2ZPF B;  3PE0 A;  2FL7 A;  2M0Y A;  2MWP A;  1CKA A;  3OYD A;  1EX4 A;  2LMJ A;  2LRQ A;  2LVM A;  4QW2 A;  2EQU A;  2K3X A;  5I11 A;  1ZQ1 A;  4KO8 A;  3G4S Q;  1Q7Y U;  1FX7 A;  3MB5 A;  3VRZ A;  3CCU A;  2VKN A;  2FEI A;  3CBP A;  4FL6 A;  4A54 A;  2MPX C;  1VQ4 Q;  2K2V A;  3M9Q A;  4C5H A;  2YUJ A;  4J9F A;  2DXU A;  5FRN A;  3CC2 Q;  4E7I A;  3L1A A;  1ZC1 A;  4LDV A;  3CME T;  1N27 A;  2JUF A;  3I56 Q;  2EFI A;  2XD0 A;  4M78 D;  2EGA A;  3ZFJ A;  1QWE A;  3OBW A;  3NPF A;  3H8Z A;  2HNI A;  3VU3 C;  2ECZ A;  4C92 A;  3P8D A;  2DO3 A;  5HKC A;  3M4Y A;  2MM0 A;  4C8Q E;  2FYK A;  5CQX A;  2JNG A;  4MMK A;  3OSS C;  1MV3 A;  3TSZ A;  2W0Z A;  1PRM C;  3LWI A;  3L42 A;  4ARC A;  2QAS A;  3VKI A;  1AWW A;  1TSF A;  1UGS B;  1PD1 A;  2DER A;  3BDU A;  3G7Z A;  3JCM Q;  4IUQ A;  4M7D B;  3LHD A;  1VQL A;  5KE2 A;  1QVF S;  3V7R A;  4F17 A;  1HJD A;  2K5L A;  2KE9 A;  1RI0 A;  1M1G A;  4D8K A;  5B6C A;  3I55 A;  4XU3 A;  3TRE A;  4E7Z A;  2HZY A;  1Q82 R;  4ATO A;  1M1F A;  4FT4 A;  3PFS A;  1X6O A;  3CC7 Q;  3AT1 B;  1M8M A;  4RMO A;  5IXB A;  5HK3 A;  1PSF A;  4YTL A;  1XNI A;  2ZAE A;  3OS0 A;  2HSP A;  1Q86 C;  3L2R A;  1KQ1 A;  2JVV A;  4HT9 A;  4PJO E;  2CT3 A;  3FPU A;  3DLL A;  2KXC A;  3UA7 A;  1S3S A;  2O4X B;  4RV0 A;  2KRS A;  3O5Z A;  2HQX A;  1KQS P;  3X20 B;  2DL5 A;  2ZPI B;  4RTW A;  2X35 A;  1UEC A;  3S3N A;  2M02 A;  2LJ3 A;  1AEY A;  2E10 A;  2EYY A;  2RHX A;  1JXM A;  4KLN A;  2RA2 A;  2D1X A;  5D7U A;  3A8H B;  1K1Z A;  1JU5 C;  3QSU A;  3ASK A;  1J3T A;  4RUG A;  1I1J A;  2M16 A;  1KD1 C;  3JB9 J;  2KYM A;  5C6S A;  3OW2 S;  3JB9 F;  3FIF A;  1DJ7 B;  3BW1 A;  4C5G A;  3HRT A;  5KE3 A;  1QMC A;  2PJH B;  2Q18 X;  3BDL A;  1TU0 B;  5GMK i;  2KRO A;  1QLY A;  4C8Q G;  1UGR B;  1MHN A;  3OS1 A;  1M90 U;  4C92 D;  2E3I A;  1JEG A;  1Q7Y C;  3JV3 A;  2RB6 A;  4BD3 A;  1XJW B;  2OX7 A;  2EYW A;  4A53 A;  4KDL A;  1OU8 A;  3QWY A;  5A2Q E;  1PCX A;  1SSH A;  3HSB A;  1UE9 A;  1G2B A;  3QUI A;  3CXC P;  2XIC A;  1SF9 A;  1K9A A;  2EPD A;  3TEE A;  4DQ2 A;  2H3J A;  4CC3 A;  2QEX T;  3H41 A;  1RLQ C;  1OYX A;  2FZC B;  3PIO A;  1VQN T;  8AT1 B;  5A0L A;  3NGP A;  2YRC A;  1NJI U;  2WSC E;  3OA6 A;  1UTI A;  3F70 A;  1GCQ A;  1RL2 A;  1WHK A;  1JB0 E;  4JJC A;  2FO0 A;  2LQN A;  4PLL A;  1YI2 Q;  1BIB A;  2P84 A;  3I35 A;  3VRY A;  2F2X A;  1YP5 A;  1M9S A;  5IH2 A;  3CCQ T;  5LJ5 f;  4PJO G;  2E6Z A;  1N9R A;  1RAD B;  3VS5 A;  4JLG A;  4M77 A;  3T9N A;  2EYZ A;  3MPU B;  4KDI A;  4BB7 A;  2XK0 A;  2RI5 A;  2RHU A;  3C94 A;  4EPC A;  2X3X D;  2HKN A;  5KH6 A;  2DIL A;  4M78 F;  1OOT A;  2VXF A;  1UHC A;  5IAY A;  1VQ6 Q;  2MCN A;  5HK0 A;  4DBR A;  1CKB A;  1VQ7 A;  2CZ1 B;  2KY9 A;  4JZ4 A;  3E9G A;  2YVL A;  2E5K A;  2ZZD A;  4HCK A;  2DFU A;  2YLB A;  3OYA A;  5CKE A;  2P4R A;  2GQV A;  2AT1 B;  1B3Q A;  2X9H A;  2OTL Q;  5EG2 A;  3PGG A;  5GAM e;  1XOV A;  1VQP T;  3CCV A;  5GMK l;  3CF2 A;  2GFA A;  3QG1 A;  3SHW A;  2EKH A;  3AHU A;  1AT1 B;  3MEW A;  4EMK C;  4DA4 A;  3JCM W;  3EG3 A;  1MMA A;  1C1A A;  4BAC A;  2QQS A;  1I0C A;  4XU2 A;  1WJQ A;  1YIJ Q;  3MO8 A;  2RNA A;  2RHI A;  2PUO B;  1VQM Q;  1VQN Q;  4FM4 B;  2KK4 A;  1Y07 A;  2LT1 A;  3RBB B;  4M75 E;  4ARI A;  4KBM B;  2CZ0 B;  4V2S A;  5LJ5 j;  2QQB A;  3JRZ A;  2HMA A;  1AWX A;  1BK2 A;  3V8L A;  1YFN A;  1KC8 R;  4KGX B;  4L6V 5;  1M90 C;  4PFZ A;  2HBP A;  3OYB A;  4QQD A;  5A0G A;  4J9C A;  2LQ8 A;  4FSX A;  2LDM A;  4R55 A;  3G6E A;  3NTH A;  3PT9 A;  2X3W D;  1TTH B;  3ZEH A;  3BFM A;  2VVK A;  4A4H A;  4AT1 B;  2QTX A;  3GOX A;  3CCU Q;  4M77 D;  2NUT A;  3LGF A;  3V8K A;  5AYF A;  2DD5 A;  4F16 A;  4JRK A;  3UAT A;  2DBM A;  1ZBJ A;  4ZN3 A;  5GAO n;  3HU3 A;  2FPE A;  2KRM A;  1D0X A;  3SEM A;  4EMH A;  5CK9 A;  1NJI C;  1R7R A;  4RCC A;  5KYU B;  3GPL A;  2SRC A;  1AD5 A;  4HT8 A;  3WVE B;  1LVK A;  1UDL A;  4ORZ A;  2CSQ A;  1PWT A;  1NYF A;  2K4Y A;  2RF0 A;  4PKC C;  3JCM V;  5LJ5 g;  3CCE T;  1E6H A;  3S6W A;  2Y4X A;  2F2W A;  1NBE B;  1X2Q A;  2I2L A;  2DA9 A;  3LGL A;  4NOY A;  2KRN A;  2L89 A;  4N4G A;  3HPW A;  1C6V X;  1G83 A;  2FPF A;  3V7S A;  1W6X A;  4EMK B;  2ATC B;  4J9E A;  3FB9 A;  2SEM A;  3TU4 K;  3BQB A;  3DKM A;  5C18 A;  4C5I A;  2LZ6 B;  1PRL C;  4AFQ C;  2E65 A;  1VQL Q;  2ZCF B;  2V1R A;  4RTT A;  3H6Z A;  2CP2 A;  4F7U F;  3ZJT A;  4OB2 B;  5I22 A;  3M0R A;  3I55 Q;  2IG0 A;  2OTJ A;  5KYX A;  3QII A;  3EG9 B;  1QCF A;  4M75 G;  1H3H A;  2HCK A;  4C8Q A;  5IHI A;  3KFV A;  2EGE A;  1M3A A;  2RQU A;  3CXC A;  1WFW A;  5J3B A;  3LGA A;  2KBT A;  4ZGJ B;  1WJR A;  3SWN A;  1YWO A;  3E1S A;  2RMO A;  2PVD B;  5CKH A;  4KGV B;  4LD9 K;  4M7A C;  1UHF A;  4CQN A;  1EIF A;  4JLI A;  1VYT A;  1AZG B;  2L3Q A;  3QKJ A;  1M3B A;  1WDX A;  2XU8 A;  2A0F B;  2JOY A;  1Q82 U;  1RUW A;  2Q1C X;  3FLG A;  3MP1 A;  2VXE A;  2MOX A;  2P4T A;  4ZGE B;  3RMQ A;  1KK7 A;  4Q5W A;  5CQY A;  5GAM g;  5GLF A;  1MGQ A;  1HSQ A;  5DY9 A;  4CI0 C;  4E7K A;  2BZX A;  2VAS A;  3CD6 A;  1SSF A;  3NMZ C;  1YHQ A;  1K8A U;  2CUD A;  5FU7 C;  3UF4 A;  2RQW A;  3CCR T;  2LNH B;  2DL8 A;  1VQ7 T;  2YHT A;  4PJO A;  4DOV A;  4RTZ A;  2KQW A;  1WHL A;  3CEY A;  3EHR A;  1YBY A;  4PK4 A;  2RQV A;  4EIK A;  4NL2 A;  4M7D E;  5ECA A;  3L2U A;  2XI9 A;  1BB9 A;  1D3B A;  4BUG A;  4MDX A;  5C1B A;  3SB2 A;  1U1S A;  2C06 A;  1VQ8 T;  3G4S T;  1JBM A;  2QG9 B;  2DET A;  2DM1 A;  3FJP A;  5GJW B;  1WA7 A;  4RG2 A;  1VQK T;  5HCK A;  5DLQ E;  1RLP C;  1D09 B;  5KYW B;  4F7U B;  1VQ4 T;  3OYL A;  2HSE B;  1HK9 A; 
#chains in the Genus database with same CATH homology
 4C92 F;  3LWI A;  3L42 A;  4ARC A;  3CCL A;  3VKI A;  4N4H A;  4XTX A;  4ELZ C;  4M7D D;  4C92 C;  1UGS B;  3CC2 T;  1M1K U;  3BDU A;  3G7Z A;  5FU6 C;  3EFS A;  3JCM Q;  3I56 T;  4IUQ A;  4M7D B;  5GMK j;  3LHD A;  1U8R A;  4XK8 E;  1VQL A;  5KE2 A;  2ZPH B;  1QVF S;  3OYC A;  4M7A D;  2LCL A;  4XU1 A;  3V7R A;  1Q81 C;  1BI1 A;  1ZHI A;  3A8L B;  3QJ6 A;  2K5L A;  1RI0 A;  1M1G A;  3RER A;  5B6C A;  4M7A B;  1NE8 A;  2CS7 A;  4BI4 A;  2RH2 A;  2XDD A;  4C8Q D;  3I55 A;  4XU3 A;  1M8V A;  3FPT A;  3TRE A;  5GAO m;  1OZ2 A;  3GNG A;  3GF5 A;  4MZT A;  4QVZ A;  4ATO A;  2K5F A;  2L8D A;  1M1F A;  4FT4 A;  3PFS A;  4FIB A;  2PWY A;  4C8Q B;  3GNF B;  1X6O A;  3N5B B;  5L8R E;  2L3R A;  4RMO A;  2JTF A;  2DTI A;  2DAQ A;  5HK3 A;  1PSF A;  4YTL A;  4OB3 B;  3SWN B;  1XNI A;  5GMK e;  3CBM A;  5GAO l;  2XDB A;  3QHS A;  3RIR A;  2M1H A;  3CCM T;  3OS0 A;  1Q86 C;  1N9S A;  1VIF A;  2X4X A;  2F5K A;  3L2R A;  1K9M C;  1KQ1 A;  3M5A A;  4XTY A;  1JRI A;  4KUL A;  2JVV A;  3OBY A;  4ZGD B;  2EQJ A;  3CCR A;  3CCJ A;  4HT9 A;  4PJO E;  3FPU A;  5CD1 A;  4M78 G;  5GAN f;  1NPR A;  2Y90 A;  3OQ5 A;  4JRI A;  3DLL A;  1W2B A;  4KOD A;  3OMG A;  1S3S A;  3CC4 T;  2O4X B;  2V8K A;  5GAO r;  5GAN 3;  4RV0 A;  3VYG A;  5FU7 B;  2HQX A;  3X20 B;  2ZPI B;  2LQK A;  2X35 A;  4A4E A;  4OMF B;  3CME A;  4OP0 A;  3SFM A;  1WPY A;  3JSC A;  3S3N A;  4HCB A;  2JTM A;  3DB4 A;  1X01 A;  5GAO q;  2E10 A;  1VQ5 A;  3FEO A;  3CPW S;  2RHX A;  5GAN 4;  4F7U G;  1JJ2 A;  4KLN A;  2RA2 A;  3INZ A;  3SDZ A;  4C92 E;  1WGS A;  4PLI A;  3A8H B;  2KVQ G;  1Y96 A;  2WAC A;  2XID A;  1I8F A;  1N8R C;  2BUD A;  1H3Z A;  3QSU A;  3ASK A;  2O4X A;  1KD1 C;  2M16 A;  1VQ8 A;  3G4S A;  1GXI E;  2LT4 A;  3ZGZ A;  3JB9 J;  4KUD K;  5C6S A;  3OW2 S;  4PJO D;  2B25 A;  1VQK A;  3MP8 A;  2X4J A;  3JB9 F;  3QXE B;  4J8O A;  4M7D G;  2DVE A;  2DPP B;  3FIF A;  5GMK h;  1DJ7 B;  1VUB A;  3BW1 A;  1VQ4 A;  4PJO B;  4C5G A;  3CCS T;  2GF7 A;  3HRT A;  5KE3 A;  2A7Y A;  2PJH B;  2Q18 X;  1Q82 C;  2PVG B;  4M7A G;  4O5V A;  1G5V A;  3BDL A;  2QXF A;  1HXD A;  1PSE A;  3LYI A;  4XQ3 A;  1XTD A;  4A4K A;  3CC2 A;  2HD0 A;  5GMK i;  5GAM f;  2YRV A;  4HCZ A;  4N0A A;  4C8Q G;  3NTI A;  3I56 A;  1UGR B;  1MHN A;  3OS1 A;  4E7J A;  1M90 U;  4C92 D;  1D3B B;  4GLK A;  2E70 A;  1K73 U;  1BIA A;  1Q7Y C;  5I2S A;  2RB6 A;  4LD6 A;  4BD3 A;  4C92 B;  5IT9 E;  1BKB A;  4KUI A;  5FTN A;  4A53 A;  1K8A C;  4IUV A;  5FU6 B;  3DLM A;  3RUX A;  4C0D C;  3OYM A;  2KAF A;  3ER0 A;  2MMP A;  4J6Y A;  4E47 A;  4EMG A;  4X34 A;  1AHJ B;  3GLX A;  5A2Q E;  4LDW A;  4XTV A;  3HSB A;  2QQ9 A;  1H64 1;  3QUI A;  1KHC A;  2XIC A;  4N0A C;  4BI8 B;  1CZ5 A;  2XD0 A;  4PJO C;  3TEE A;  3CCM A;  4DQ2 A;  2H3J A;  1QP3 A;  3J81 E;  4WF2 A;  2M0O A;  5CAI A;  3CCV T;  2HAX A;  3ZJV A;  1LJO A;  2QEX T;  1OYX A;  2D6F A;  3TCJ A;  4MZM A;  2K3Y A;  4L5G A;  3PIO A;  3UDC A;  1O75 A;  1VQN T;  5D6X A;  5A0L A;  4MZP A;  2V8I A;  3P8H A;  5CVI A;  3VUZ A;  4DOW A;  1NJI U;  1OI1 A;  2X4W A;  1IZ6 A;  4OB0 B;  3A8M B;  2WSC E;  3OA6 A;  5GAN j;  3F70 A;  1RL2 A;  3KUF A;  1YJW T;  4UC4 A;  1JB0 E;  2DXT A;  1QVF A;  3OYF A;  2YLC A;  5J26 A;  3C95 A;  3QYH B;  4PLL A;  1BIB A;  3JCM J;  3BY7 A;  2JV2 A;  2Y4Y A;  4FT2 A;  1M9S A;  3CCQ T;  2WSF E;  5LJ5 f;  4PJO G;  2E6Z A;  1N9R A;  1G3Y A;  3CC7 A;  3J7A F;  4J6W A;  4JLG A;  5CKF A;  3CPF A;  1KC8 U;  4M77 A;  1IRE B;  2VV5 A;  3T9N A;  1QVG S;  1M1K C;  4KDI A;  4BB7 A;  2LCC A;  2XK0 A;  3HP9 A;  2ZPG B;  3WXM B;  5GAN e;  1XQH A;  2RI5 A;  2RHU A;  5FTK A;  5LJ5 d;  3C94 A;  3OYY A;  1X75 C;  4II1 A;  1CZ4 A;  1KG1 A;  3JCM e;  3RES A;  4C0F A;  3OS2 A;  3L2W A;  1UB4 A;  4EPC A;  4JRP A;  1G3T A;  1KHI A;  2MI6 A;  3VJP A;  5KCO A;  4M77 F;  3G6E T;  4M75 F;  4C92 G;  3GP8 A;  2WSE E;  3FPR A;  2R5M A;  2R5A A;  5KH6 A;  3QDR B;  4M77 C;  3JB9 D;  4M78 F;  4M75 C;  2B8A A;  2BIV A;  5I2M A;  4OGC A;  2MM2 A;  4A4F A;  4XTU A;  2VXF A;  5CIU A;  5IAY A;  4OGE A;  5KCH A;  1YI2 T;  4N4I A;  5HK0 A;  2A3L A;  4XU0 A;  2K57 A;  5CKD A;  2E64 A;  4B9W A;  3PIP A;  5GAM j;  3VYH B;  1S72 T;  3QC8 A;  4JS4 A;  1O9S A;  2DD4 A;  2CZ1 B;  1Y96 B;  2BKD N;  1VQ7 A;  2KY9 A;  2QDY B;  4KT0 E;  2F5T X;  3E9G A;  3CPW A;  2FVU A;  4OVA A;  1M4Z A;  3NTK A;  3JCM f;  2CZ7 B;  2VGN A;  1W4S A;  2YVL A;  2ZZD A;  5GAN 5;  2XHC A;  3UT1 A;  2YLB A;  1VQ9 T;  2RHZ A;  2CZ6 B;  3OYA A;  3X25 B;  3OYH A;  3QQ8 A;  5GAN d;  4BDZ A;  5LJ3 f;  2QQR A;  5CKE A;  2RD1 A;  2RJC A;  2GQV A;  5GMK m;  1LNX A;  1WLF A;  4VUB A;  4X9D A;  3OYN A;  5CCA A;  2Q19 X;  1P92 A;  2HQE A;  5GAN 6;  3OW2 A;  3OSV A;  3JCM d;  3TIW A;  3JCM c;  4C0D B;  4BE1 A;  4P5N A;  4RG8 A;  5EG2 A;  3PGG A;  5GAN h;  3ZBD A;  2QQA A;  5GAN 7;  3SD4 A;  5GAM e;  4C5E A;  1XOV A;  1VQP T;  3MEV A;  3CCV A;  3HFN A;  5LJ3 d;  5GMK l;  3CF2 A;  2AHJ B;  2GFA A;  3MCA B;  2QEX A;  3QZ9 B;  4BDY A;  2IVW A;  1LOJ A;  3QG1 A;  3QO3 A;  3JCM X;  3AHU A;  4Z02 A;  1V29 B;  1N8R U;  3MEW A;  4QVD A;  2PU9 B;  1VQ6 T;  5LL6 S;  4EMK C;  2FHD A;  4LDX A;  4DA4 A;  4M7A F;  3RKX A;  3V8J A;  2L5Q A;  2ZPB B;  5DLO A;  2EJ9 A;  3JCM W;  1I81 A;  4BAC A;  2E1H A;  2QQS A;  3R6O A;  4MDW A;  1YJW A;  4XU2 A;  4RKU E;  2E6N A;  3RMS A;  4C8Q F;  1WJQ A;  2KMT A;  3M53 A;  3CXC S;  1VQO T;  3MO8 A;  5FTJ A;  2RHI A;  5D6W A;  1ZC1 A;  1VIE A;  3QQ7 A;  2PUO B;  4FM4 B;  2KK4 A;  2EQK A;  1NZ9 A;  2P0Q A;  2RHY A;  4JJN K;  1Y07 A;  2LT1 A;  4E7L A;  3LW5 E;  4M77 E;  1FWZ A;  2ZGW A;  3QYG B;  4M75 E;  4KBM B;  2DZC A;  2CGH A;  3CCQ A;  1O54 A;  4ARI A;  3FC3 A;  2OAU A;  2CZ0 B;  4V2S A;  2RM4 A;  5LJ5 j;  2E41 A;  2QQB A;  3JRZ A;  3M56 A;  4JDS A;  3S3M A;  2KSS A;  3V8L A;  1YJN T;  1WJS A;  2OTL T;  3L2Z A;  2DXC A;  5GAM d;  3GIB A;  3NFC A;  2DTH A;  2DTO A;  5C0M A;  3CMA T;  1QDN A;  4L6V 5;  3JB9 G;  3HHT B;  4J83 A;  2MWO A;  1M90 C;  1K73 C;  1NPP A;  2HBP A;  3HFO A;  4IUT A;  3OYB A;  2OTJ T;  4QQD A;  5A0G A;  2LQ8 A;  3M59 A;  4Y91 A;  4FSX A;  1M5Q 1;  2LDM A;  4J7I A;  3V7C A;  3JAM E;  4R55 A;  3G6E A;  1OZ3 A;  3NTH A;  1FXX A;  3MET A;  3MP6 A;  3PT9 A;  2DJZ A;  5HY6 A;  2E5Q A;  4FU6 A;  3ZEH A;  1WNL A;  3CCJ T;  3BFM A;  4A4H A;  2JN0 A;  2RK1 A;  4X9C A;  2R57 A;  3EFR A;  4XAX B;  2QTX A;  5LJ5 e;  1YIJ T;  3JB9 I;  1TH7 A;  2P0K A;  4RCB A;  2XDP A;  3GOX A;  1YI2 A;  2P0P A;  1VQM T;  4M77 D;  1S72 A;  3LGF A;  3MHX A;  2JZ2 A;  2DD5 A;  3QBY A;  5AYF A;  3V8K A;  4BI3 A;  4XTZ A;  4E7H A;  4JRK A;  2QA4 T;  2EIF A;  4M77 B;  4M75 B;  3CC4 A;  1YCY A;  4ZN3 A;  2D9T A;  5GAO n;  3HU3 A;  2QI2 A;  3M55 A;  4PJO F;  5DYG A;  2LTO A;  4C0G A;  3A5Z B;  1VQ9 A;  1BYM A;  4EMH A;  1QVG A;  4ELY C;  5CK9 A;  3UPU A;  5FTM A;  1NJI C;  1R7R A;  1I9G A;  4QVC A;  4HKE A;  1G3W A;  5LJ3 j;  3HU1 A;  2LX9 A;  3OYK A;  4IUP A;  3LLR A;  4OF1 A;  2LW6 A;  3WVD B;  4RCC A;  4TVR A;  4M75 A;  3LH0 A;  1VQP A;  3EAE A;  4C0Z A;  3GPL A;  1B34 A;  3OB9 A;  2DIQ A;  3URG A;  3WVE B;  4HT8 A;  3ME9 A;  1BI2 A;  3X28 B;  2RK2 A;  2PVO B;  3A8O B;  4M78 A;  4JS5 A;  3M57 A;  5CCB A;  3JCM b;  3OYE A;  5LJ5 g;  2LC4 A;  2K4Y A;  3JCM V;  3CCE T;  4PKC C;  4M7D E;  1Y7X A;  3C4S A;  3S6W A;  4IKF A;  1KQS S;  1VQ6 A;  2Y4X A;  1Q81 U;  2Q1A X;  1KC8 C;  3CD6 T;  2XKO C;  3CCU T;  3G71 T;  1QCS A;  4LDU A;  2CYZ B;  2ZPE B;  1YHQ T;  3HRU A;  2I2L A;  2RJE A;  4AS1 A;  5LJ5 h;  3LGL A;  4NOY A;  3CCS A;  3OYJ A;  4BE0 A;  2CKK A;  2L89 A;  4N4G A;  3HPW A;  4QQ6 A;  1VQO A;  4ME7 A;  3PMT A;  4OB1 B;  3V7S A;  3X26 B;  5LJ3 e;  4J6X A;  5J39 A;  3QWZ A;  5EQJ B;  4EMK B;  4F7U A;  5D6Y A;  1YJ9 T;  3LWH A;  3A8G B;  3FB9 A;  3TU4 K;  3BQB A;  3DKM A;  4M78 C;  5C18 A;  4C5I A;  2EAY A;  2PQW A;  2DKG A;  2E65 A;  4EDU A;  1Q86 U;  4ZTJ A;  4AQ7 A;  1QVP A;  1K9M U;  3M54 A;  2ZCF B;  1YJN A;  2OTL A;  4BY6 C;  3C12 A;  3H6Z A;  3KXT A;  4M7D A;  1YIT T;  4F7U F;  2GCX A;  4JUV A;  1ZBX A;  4NS5 A;  5CKB A;  3CMA A;  3ZJT A;  2NLU A;  4IUR A;  4OB2 B;  4R56 A;  4EMK A;  3JCM P;  5GAN g;  5ERG B;  1N6A A;  2OTJ A;  2IG0 A;  4HCC A;  2RJD A;  2RO0 A;  3QPH A;  2E12 A;  4M7A A;  4M77 G;  3JCM g;  3CBO A;  1UEB A;  3QII A;  4M75 G;  1WQW A;  5FRO A;  4ZN1 A;  5GAN 8;  3OYI A;  1I5L A;  3PTA A;  2GFU A;  4LDY A;  3DB3 A;  3HU2 A;  4M7D F;  4IUU A;  1U1T A;  4QQG A;  4C8Q A;  5FLX E;  5LJ3 g;  2RI3 A;  3JCM h;  1YIJ A;  2EKO A;  2RI2 A;  5GAN 2;  2KDS A;  5IN1 A;  3L2Q A;  4Y28 E;  2K5I A;  5J3B A;  3CXC A;  4ZGJ B;  4M7D C;  3LGA A;  1VQM A;  5FRM A;  1WJR A;  5GAO p;  3MEU A;  1VQN A;  3SWN A;  3CCL T;  3ZJU A;  4GY5 A;  2RJF A;  5LJ3 h;  3E1S A;  2QA4 A;  5CR2 A;  1KD1 U;  4KDL A;  1G3S A;  2EJF A;  2PVD B;  4D6W A;  4L59 A;  4J5Y A;  5CKH A;  3E19 A;  4LD9 K;  5FTL A;  3OY9 A;  1W2B S;  4MML A;  2X4Y A;  4M7A C;  4ZTF A;  3L2V A;  1VQL T;  4CQN A;  3CC7 T;  3E9F A;  1EIF A;  4JLI A;  4PL6 A;  2O01 E;  3P8B B;  3Q1J A;  3HKS A;  1BI0 A;  4C8Q C;  4B9X A;  3QKJ A;  3RKW A;  1CR5 A;  4HA8 A;  3PNW C;  5DM7 R;  4XTW A;  5CO7 A;  5M9O A;  1Y71 A;  2DK3 A;  2XU8 A;  2JOY A;  2ZPF B;  1Q82 U;  2FL7 A;  3I55 T;  2MWP A;  3SWN C;  2Q1C X;  3OYD A;  1JJ2 S;  1QP2 A;  3FLG A;  3VUB A;  4JRQ A;  3MP1 A;  4M78 E;  2Q1D X;  2VGM A;  2VXE A;  2P4T A;  2LRQ A;  3RMQ A;  4ZGE B;  3M4G A;  2DEQ A;  2EYQ A;  3FDR A;  2DXB A;  2LVM A;  4Q5W A;  2EQU A;  1WQ7 A;  4QW2 A;  5CQY A;  3RKY A;  5GAM g;  2K3X A;  3X24 B;  5GLF A;  1MGQ A;  1ZQ1 A;  5DY9 A;  4KO8 A;  4CI0 C;  3CCE A;  4E7K A;  3OS5 A;  1Q7Y U;  5A0D A;  1FX7 A;  3HRS A;  3QZ5 B;  3MB5 A;  3CD6 A;  1SSF A;  5GAM h;  3G71 A;  3CCU A;  2EWN A;  1YHQ A;  5EPP A;  2DZ9 A;  1K8A U;  5FU7 C;  3CBP A;  4FL6 A;  4A54 A;  2G3R A;  2VYT A;  4A4G A;  4F7U E;  3MEA A;  3KBG A;  3CCR T;  3VV0 A;  2K2V A;  3OYG A;  1VQ7 T;  2YHT A;  3M9Q A;  4C5H A;  1E32 A;  2YUJ A;  4NL3 A;  3O8V A;  1YJ9 A;  4PJO A;  4DOV A;  2DXU A;  2KQW A;  5FRN A;  3M58 A;  5DYI A;  3OMC A;  1R8O B;  3CEY A;  4M75 D;  1YBY A;  4E7I A;  1UGQ B;  1QW1 A;  2DIG A;  3L1A A;  4LDV A;  1N27 A;  2JUF A;  4NL2 A;  2EFI A;  3UWN A;  3CME T;  4BE2 A;  4PNO A;  1KQ2 A;  4M78 D;  3JB9 H;  2VUB A;  2R58 A;  2FB7 A;  2V8J A;  3ZFJ A;  1VQ5 T;  1B34 B;  2PUK B;  2MF2 A;  3OBW A;  3H8Z A;  2HNI A;  3PMI A;  3VU3 C;  2VC8 A;  2XI9 A;  2EJG A;  2F69 A;  4M78 B;  3L2U A;  1YIT A;  1D3B A;  3FRN A;  4M7A E;  2MAM A;  2M9U A;  4BUG A;  4MDX A;  4J7F A;  4CRI A;  5C1B A;  5CCX A;  2XG8 D;  3P8D A;  3QJY A;  3SB2 A;  1I4K 1;  1U1S A;  2DO3 A;  4C92 A;  3LX7 A;  1VQ8 T;  5HKC A;  3G4S T;  2C06 A;  1JBM A;  3M4Y A;  4BY6 B;  5I21 A;  2MM0 A;  4C8Q E;  1KQS A;  3FJP A;  2FYK A;  5CQX A;  2JNG A;  4RG2 A;  4MMK A;  1VQK T;  3J80 E;  3OSS C;  5DLQ E;  3S3O A;  3HL8 A;  4F7U B;  1UGP B;  4O6J A;  3OYL A;  1BI3 A;  1VQ4 T;  2D0Q B;  1HK9 A;  2LNV A;  2EQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...