2GF7A

Double tudor domain structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Jumonji domain-containing protein 2A
publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 21
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gf7A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gf7A02
4C5HA 3FLGA 2BIVA 3Q1JA 1WJSA 2E5QA 3LGLA 3PMTA 3UWNA 1MHNA 3ZEHA 5KE3A 4L59A 3ME9A 4E7HA 3F70A 4IUVA 4A4HA 2EFIA 2O4XB 4PLLA 3M9QA 4BACA 3MO8A 2L3RA 2K3XA 3LYIA 3NTHA 3OMGA 2B8AA 2GFUA 3C4SA 2FHDA 5IAYA 4A4EA 4IUQA 3MEWA 2RI3A 2D9TA 5CIUA 4IUTA 2EQMA 5KCHA 2HQEA 2YRVA 3LGFA 3CEYA 2O4XA 2XK0A 2R5AA 4E7JA 1G5VA 4FL6A 2X4YA 3PMIA 4LD6A 4QW2A 2R57A 3OYCA 2P0KA 2RJDA 2RHUA 5D6XA 3MP8A 2RHIA 3OYIA 4A4FA 2GF7A 4IKFA 1OZ2A 2BKDN 5KH6A 3OYBA 3OQ5A 4A4GA 2PQWA 2RHYA 4Q5WA 3OYLA 3PNWC 4QQDA 4IURA 5C0MA 4PL6A 3OYJA 2RJFA 3LLRA 4C5IA 2MWPA 1WJRA 3L2UA 3QJ6A 2XDPA 3OYEA 4BE0A 4E7IA 3L2RA 3H6ZA 2RI2A 2RI5A 3PFSA 3OYDA 3QKJA 4BD3A 2IG0A 2E6NA 4QQ6A 5D6WA 2QQRA 2DAQA 3MEAA 4NS5A 4EDUA 5J39A 1KHCA 4BDZA 4ZTFA 3OYKA 3MEUA 3MP1A 3MEVA 2DIGA 3O8VA 4FU6A 3OB9A 4IUUA 4E7LA 3OYAA 2R58A 3S6WA 2RJEA 4II1A 3OMCA 3P8HA 3S3OA 4B9WA 3E9FA 4UC4A 3S3MA 3OS0A 4QVZA 3DLMA 2RO0A 3H8ZA 4B9XA 5FROA 3OYMA 2M1HA 3META 4PLIA 3UT1A 4C5EA 2R5MA 3L42A 5J26A 4BE2A 2JTFA 2DIQA 4CRIA 4RG2A 3OA6A 4BDYA 3DB3A 3LH0A 5FRNA 3OS2A 2G3RA 1WGSA 4X34A 3S3NA 1OYXA 2EQUA 2K3YA 3QBYA 3GOXA 2F5KA 3BDLA 3L2WA 4N4IA 2NLUA 2RHXA 3ASKA 4HCZA 4QQGA 2BUDA 2LTOA 3DB4A 3OY9A 3L2VA 3QIIA 1N27A 4GY5A 4N4GA 4E7KA 2GFAA 3L2QA 4ZTJA 1OZ3A 3KUFA 5D6YA 2CKKA 2LDMA 1OI1A 2LRQA 3FEOA 3EAEA 2EKOA 5FRMA 2JZ2A 5M9OA 2WACA 3NTIA 2MWOA 4IUPA 3OYGA 1RI0A 3FC3A 4C5GA 2RHZA 3LX7A 4BE1A 3OYHA 1WJQA 2RJCA 5IN1A 3SD4A 2QQSA 2X4XA 4N4HA 2EQJA 3OYNA 5KE2A 2X4WA 4Z02A 2VYTA 2X35A 5KCOA 2M0OA 3E9GA 1H3ZA 2M16A 2LVMA 3OS1A 3MP6A 1XNIA 3NTKA 2HQXA 3OYFA 4OVAA 2EQKA 2L89A 1SSFA 2L8DA 3FDRA 3P8DA 5C6SA 2LCCA
chains in the Genus database with same CATH superfamily
2WSFE 3VV0A 3V7CA 4L59A 3ME9A 1D0YA 4M75A 3JCMP 3TVTA 2YT6A 1EZZB 4AMCA 5GAMg 3UA7A 1X6BA 4CQNA 1YITA 2ATCB 1B34A 3V7RA 2MI6A 1NPPA 4N0AA 5KYWB 1VQ4A 2X51A 4ESRA 2KXCA 1CKBA 3OQ5A 1H3HA 2E4HA 3OS5A 1YITT 4KBMB 1RADB 3VYGA 2MIOA 3PFSA 2D8HA 2B86A 1VQ4T 1TUCA 3QYHB 4BDZA 3MEAA 2XD0A 1ZUUA 3X24B 5DLOA 3ZJVA 2ABLA 4KGVB 1AZGB 1QVFP 3JCMg 2FL7A 1NM7A 5KYXB 3OS0A 1TWBA 4PLIA 4LDWA 2K5IA 1A0NB 5FTMA 2KI7A 1XTDA 2JTFA 4HVUA 4Y28E 4RTWA 3CD6A 1FMKA 1I0CA 1I9GA 4OGEA 2PJHB 1WPYA 3CCLA 1WI7A 2DFUA 1S72A 3V8JA 2RK1A 4D8DA 3CPWP 2DVJA 2RNAA 4R0KA 3TREA 4IIOA 3CD6T 4XTVA 3U23A 3L2ZA 4ELYC 3VS0A 3UF4A 3CCLT 1ZA1B 1JRIA 4FT4A 1S72T 3FC3A 1Y71A 3CC4Q 1Q7YU 4M77F 5IN1A 3FRNA 4N4HA 4C92F 1Z9ZA 3OYNA 2X4WA 3JCMX 1H92A 3QUIA 2HQXA 2H3EB 3V8LA 1BU1A 3CCRA 1XQHA 2ESWA 2Z0WA 4LDVA 4M75G 5LJ5h 3PMTA 4LN2A 4EMKB 4HXJA 1NPRA 1JXMA 3MO8A 2Y4XA 4OMQA 2LC4A 3CCRT 3C4SA 4OP0A 1YWPA 5CIUA 1M1FA 2EQMA 5GAMj 3CPWS 1RL2A 2XMFA 4FL6A 2RJDA 5I2MA 3I5RA 2P0PA 3RBBB 4A4FA 2M0YA 3QC8A 1AVZC 4KODA 3CBMA 2DD4A 4KGZB 5GAMd 3PNWC 5C0MA 2FPDA 3ZGZA 2YXYA 3OYEA 5FW9A 1UB4A 4CI0C 5GAN3 4ANJA 1VQ6Q 2IG0A 5DLQE 4TVRA 1AWOA 2HDAA 5J39A 4ZTFA 4M77C 2EWNA 4AFQC 3MP1A 1YIJQ 2AT1B 2NWMA 4HKEA 5GAOl 3S6WA 4C92C 1IGUA 2GNCA 4CC4B 5AT1B 2RO0A 1OPKA 3QDFA 4M7AD 1BCMA 3A5ZB 4MMLA 1EX4A 2LJ0A 1VIEA 1Q7YC 1QCNA 5HCKA 2RQRA 4JRPA 4PK4A 2E1HA 3EG2A 3TIWA 1KC8R 3JCMd 1J3TA 2PVGB 2KMTA 2F2WA 1YJ9Q 4B6MA 2LTOA 4OB2B 3OY9A 2JT4A 3M55A 4ZGJB 4E7KA 2F5TX 2IIMA 3QWYA 4LUDA 1CSKA 2QK0A 3CC4A 4E47A 2DERA 4IIMA 2PUKB 5LJ5g 3VRYA 2VVKA 3HU3A 1MMNA 1VYTA 4PJMA 1I8FA 2KGTA 2P0QA 5I11A 5GAOn 2D0QB 3CC4T 2KDSA 4J8OA 2ZPEB 5CCBA 2O4XB 4M77A 2JTEA 1KQ2A 4C0DC 3GP8A 4C92A 1G3TA 4A4EA 5LJ3h 2ECZA 1UFFA 4M4ZA 4QKUA 2YRVA 3CCJQ 1YJWQ 3QJYA 3JRZA 2R57A 1AWJA 2P0KA 4NL2A 2DEUA 2ZPBB 2KXDA 2RQTA 3QYGB 1GCPA 5KH6A 2JN0A 1QWEA 1SF9A 1WQWA 1GL5A 2DLPA 4Z89A 1M90U 4MZPA 2PUOB 1D1BA 2Y90A 1PWTA 3CMAQ 4E7IA 1I5LA 2QQ9A 2RI5A 1I1JA 2XHCA 3JCMb 1BK2A 3QSUA 1VQ6A 1Y96B 3CC2Q 2LZ6B 2C0TA 4KDIA 2BTTA 1M27C 4ATOA 4XTUA 4F14A 1YIJA 3H8ZA 4PNOA 3JB9D 2O88A 2ED1A 1PCXA 4GLMA 1BI0A 1VQ6T 3OS2A 2COZA 1YIJT 2J7IA 2CZ1B 3QBYA 1WNLA 2K3YA 1UJ0A 4XK8E 2GCXA 3FB9A 2DMOA 3EGDA 3VS3A 1JEGA 3SWNC 2O9VA 1N27A 4CC3A 1K8AC 1QDNA 2GFAA 3NFCA 3VS4A 1YJ9A 1CKAA 1UG1A 2CKKA 4BUGA 4X9CA 2MWOA 1RI0A 1BIBA 2KRSA 5DYIA 4BY6C 4DBRA 4M78D 2DK3A 3X25B 2EQJA 2LJ3A 2CYZB 4V2SA 1YJ9T 2LT4A 2M0OA 4JPBW 5LJ5j 2PVDB 1AEYA 4OVAA 2L8DA 1SSFA 3QO3A 3Q1JA 4M77G 3FIFA 5LJ3g 2EYYA 2PNIA 5GAOr 4C92G 1QVGS 5GAMf 4OB1B 2YRCA 5LJ5d 4DBQA 3KFVA 1M90C 2CP3A 1NG2A 3JAME 4HCKA 1N9SA 2D9TA 1K9MC 1D3BB 1VQMQ 1KG1A 2A3LA 3OYCA 2VV5A 4E7ZA 3CCJA 4C8QB 1KSWA 1LOJA 1GFCA 2QQBA 1C1AA 5CO7A 1WIEA 3OYLA 2OTJQ 2RJFA 4J6WA 4F04B 5I2SA 3CCJT 3SWNA 1VYUA 4C0DB 4F7UB 3QKJA 4QQ6A 2CS7A 3JCMf 5GMKm 3CMAA 2DIGA 2V8IA 3OB9A 2DYIA 1Z9QA 4M7DD 2GQIA 2KYBA 4J5YA 1E32A 2FPEA 3CC2A 2QGFB 3CMAT 1WX6A 5FTNA 4KUDK 2PZ1A 4P5NA 2O01E 1ZBXA 1VQKQ 3CC2T 2KE9A 8ATCB 4M7AC 1KQSA 4MZTA 2HBPA 1LJOA 4OMOA 2EJGA 2J6KA 3CPFA 2CZ7B 2JM9A 3HL8A 2J6FA 1G3WA 4RTXA 3FJPA 1JB0E 1R0CB 5D6YA 4JZ4A 1YJNQ 1R7RA 2NUTA 1AT1B 2JW4A 3LX7A 4BE1A 1ARKA 3M4YA 2E3IA 3WVDB 1VQNQ 1WHKA 4JJCA 5ECAA 4XU3A 1VQLQ 4Z88A 3CQTA 3SHWA 5EG2A 3FDRA 3M58A 1VQ8Q 5GAN5 1AWWA 1W2BA 4IUVA 5LJ3j 4FW2A 1OU9A 2DL4A 1PHTA 2CP2A 4A53A 1KIKA 3NTHA 2EJ9A 4MMKA 2HQEA 4OMFB 3MB5A 3UPUA 5LJ3d 5GAOp 1VQMA 1ZUKA 1E6GA 3MP8A 4FIBA 2RHIA 2JVVA 4M7AA 4RUGA 1GBQA 2DXBA 2EVRA 4JZ3A 3NHNA 4LDXA 3RERA 2EGCA 2RMOA 1VQMT 4BI8B 1IRXA 2AKKA 2XDPA 4M78F 2OTJA 2CUDA 4FW1A 3ZL7C 4BD3A 2JMCA 5IHNA 2DAQA 2LQ8A 3G71Q 1X6OA 3P8HA 2CREA 2FZCB 4FSXA 2OTJT 2YUJA 2FYKA 1IXDA 1PD0A 4J9BA 1SKUB 2DX1A 4C5EA 4BE2A 1NYGA 2A0FB 5FU6C 3LH0A 2LCLA 1C6VX 2FZGB 4KH0B 4ME7A 1VQKA 1OEBA 3EFOA 3JCMV 3QG1A 2DA9A 3JB9H 1FX7A 3DB4A 4AT1B 4OMPA 1M5Q1 3PVQA 1X75C 1MMAA 3MPUB 1OZ3A 1BI1A 1VQKT 2CT3A 3TQ7P 1BI3A 2JTMA 4DOWA 3PTAA 3A1PA 1AWXA 5LJ5f 1MUZA 1KD1U 4JJBA 1YJNA 3V7SA 3FPUA 2X4XA 4J6YA 1QCFA 5GAN7 2DXCA 1H3ZA 1VQNA 1K8AR 4M78C 3REBB 1Y7XA 4M7DF 1YJNT 3I5SA 1VQLA 1JJ2A 1EIFA 1BBZA 3CXCA 3PE0A 1WJSA 2E10A 4D8KA 1G2BA 1VQ8A 3BW1A 2JS0A 3VUZA 3GNFB 1IHWA 2BZXA 4PLLA 2L0AA 1VQNT 2AIRB 2HAXA 4XTWA 1VQLT 5KYWA 4M77E 4RCCA 2KRNA 2M51A 1VQ8T 2EGAA 2FB7A 4JRIA 4EIKA 1WXBA 4QW2A 3LWHA 2X3WD 3PMIA 4M7AG 3O5ZA 1RAHB 4JLGA 4PJJA 2MCNA 4XTZA 2DRMA 1RACB 2FO0A 4ORZA 4J7FA 4C8QD 4JUVA 1K9MR 3EG9A 1KK7A 2DKGA 2ZCFB 3M5AA 5CQXA 2YSQA 1UEBA 3C95A 3M0SA 1TTHB 1QP3A 2GTJA 2F2XA 1JQQA 1WZOA 4B9WA 4O6JA 3G71A 3S3MA 3DLMA 4PJOD 4AG2C 3OYMA 3V8KA 2OI3A 4M7DC 4BDYA 1OU8A 4RG2A 4ZGEB 1SPKA 1O9SA 5HK0A 1KD1C 4M78A 3GIBA 3G71T 1OYXA 3GOXA 1SHFA 3BDLA 3G6EQ 1RAFB 2K3BA 5GMKe 2NLUA 4QQGA 3H0HA 1ZLMA 4E2FB 1GFDA 3RKXA 1QKXA 2VGMA 1WQ7A 3REAB 1M3CA 1N5ZA 5KYYB 4PJLA 1KJWA 3HFOA 3WVEB 3OYHA 2V1RA 3BDUA 4QT7A 1T0HA 2JNGA 2NUZA 5CCAA 4M75B 5LJ3f 4E7SA 1AHJB 1NBEB 4XAXB 4F16A 3VS1A 2JMAA 3UWNA 1M2VA 5HKCA 3LW5E 1QVPA 2QEXQ 2A08A 2Q1AX 3EHQA 1M3BA 2MMPA 1B34B 4IUQA 4EMHA 3CCSQ 3RIRA 1CZ4A 2DPPB 4IUTA 3DLLA 3PIPA 1PG5B 2QGGA 4E7JA 3RDVA 2WSCE 4M7DA 2RQWA 1Q86U 1QVFS 2K5FA 4MZMA 2CP6A 2AKLA 4DBHA 2K79A 1X2QA 1OZ2A 2DF6A 2F1LA 1TXQA 4OF1A 2BZYA 2PQWA 4Q5WA 4KO8A 5CKHA 3L2UA 5FU7C 5GAN2 2LMJA 2A36A 2YLBA 1U06A 1ZSZC 5D6WA 4OMNA 1K9AA 4R56A 1E6HA 2X3XD 3OYKA 2GQVA 4DBFA 3QQ7A 2EJFA 4KUIA 2YUNA 3E19A 3RMSA 4JJNK 4FYYB 4M78G 2DEQA 5CK9A 3META 5GAN8 3CMEQ 5J26A 1M8VA 2DBKA 4J9CA 1UE9A 2DTIA 3RKWA 4RKUE 1YCSB 2DETA 4A54A 3CCQQ 5DY9A 3SEMA 3MJXA 4HCZA 2HNIA 2EW3A 4RMOA 2PWYA 1K0XA 3G6EA 4GY5A 2CSIA 4N4GA 5I21A 3HPWA 4LDUA 1XJWB 2EGEA 2LDMA 1N6AA 3FEOA 4O5VA 2WACA 3CPWA 4GLKA 3M59A 2ZPFB 1PKTA 1WJQA 2RJCA 3HFNA 2RPNA 3G6ET 4Z8AA 1F1BB 3QPHA 2QA4Q 5AYFA 4KDLA 2EKHA 5HY6A 1DJ7B 3TU4K 3KXTA 1I5OB 1OX8A 1VQOQ 4KH1B 1Q86C 2B25A 5KE3A 2DD5A 5CD1A 1ZSZA 3F70A 2ZPIB 3RR6A 2KK4A 3UATA 5CR2A 1E7OA 4AFZC 4JDSA 1TUGB 1VYVA 2QEXA 2FRWA 4M7DG 2VXEA 3OYYA 3CCSA 2DRKA 3HU1A 1TSFA 1VA7A 2L3QA 1SEMA 5GMKl 5GJWB 4HA8A 2EAYA 5KYUA 2QEXT 3M0TA 4IKFA 4PKCC 4A4GA 2KYMA 3CCST 4QQDA 2D0NA 1IO6A 5C1BA 2KSSA 4C5IA 3R6NA 4RG8A 4M7AE 2E64A 4XQ3A 3AT1B 1B7TA 2J06A 3GPLA 1OULA 2DTOA 3H0FA 1WHJA 2QQRA 3M0UA 3I56Q 1TS9A 4CC2A 1MMGA 1G3YA 2VASA 1PRMC 2DBMA 4RV0A 2FG0A 5A0LA 2CT4A 4FYWB 2P4RA 5FROA 2LT1A 4QVCA 3SDZA 4E6RA 2M1HA 4XU1A 4C0GA 3HKSA 3CMEA 5FU7B 3OW2P 5GANe 4X34A 2MM0A 2HZYA 2DYBA 1JXOA 2J05A 3EHRA 3VS6A 4N4IA 2RHXA 1YN8A 4EPCA 1YNZA 1K0SA 4LUEA 2ZPHB 3JB9J 3CMET 3CCQA 3I35A 2RK2A 2MPXC 2EKOA 1KD1R 1BCOA 3ER0A 1HD3A 5B6CA 3CCQT 2QQSA 3HSBA 1VQ7Q 4BB7A 5GMKh 1M4ZA 1T3LA 4HCBA 2DZCA 3VS5A 2XDDA 2VYTA 2X35A 1UDLA 3A8GB 5FWBA 4FCYA 2HEQA 3MP6A 1NE8A 4M77B 1JBMA 2L89A 3A8LB 2QA4A 4C92B 4E7HA 1MHNA 3HRUA 1VQOA 1OPLA 2QASA 3TSZA 4M75D 5EPPA 1IB8A 1SRLA 2K3XA 2VGNA 2QA4T 3OW2S 2RI3A 1QCOA 4LDYA 1VQOT 1QLYA 2XK0A 2PU9B 3CCMQ 1VQPQ 5GMKi 1KQSP 2GF7A 1AZEA 4PJOA 3M0PA 2BKDN 5KYNA 2YLCA 1X6GA 2RHYA 4M7AF 4IURA 4PL6A 1PSEA 2MWPA 4WCIA 1K4US 2QXFA 2RI2A 2K5LA 1PSFA 2OJ2A 1X43A 1EFNA 4NS5A 1O75A 2V8KA 4FU6A 4RTTA 5EQJB 3I56A 1YJWA 3ZJTA 5IT9E 4UC4A 3IQLA 3EG0A 1RAGB 2R5MA 2NUPA 3NMZC 2YDLA 3EGDB 2QYZA 4KGXB 3I56T 1YJWT 3FPRA 5D7UA 2DTHA 3JCMJ 1MMDA 4M78E 3L2WA 1QVGA 2COWA 5IXFA 4LD9K 4HT8A 3VU3C 1GRIA 5FLXE 3QIIA 2HKQB 4JS5A 1ZX6A 3OBWA 4OMMA 2HQHA 3M0QA 2XDBA 2KQWA 2OAUA 4J9HA 3QQ8A 2E3HA 3M54A 1UTIA 4OGCA 5GAN6 2OX7A 3EFRA 1U8RA 1T0JA 4J9EA 2YRDA 3FLGA 2K2MA 2DL3A 2E5QA 2O9SA 1UGSB 5A2QE 3HHTB 1Q7YR 1HK9A 5IH2A 2HBWA 3QDRB 2RD1A 2KNBB 2CDTA 1M2OA 3EGXA 1VQ9Q 5KCHA 2FZKB 2R5AA 1Q86R 2L2PA 5D6XA 3SWNB 4RCBA 4QVDA 1W6XA 3OYIA 5GJVB 1VUBA 4M7DE 3CCMA 1VQPA 4XTYA 2MM2A 3VYHB 3JB9F 2J6OA 2RN8A 2BE9B 2DE0X 1V29B 5A0DA 2LJ1A 4CC7A 4BY6B 2E5KA 3JCMc 3ZFJA 3CCMT 1VQPT 1YWOA 3MEUA 2PVOB 2G6FX 2KROA 4II1A 2VC8A 8AT1B 2YUQA 3S3OA 4LNPA 2KR3A 1MV0B 1MV3A 3PVLA 4XU2A 3UT1A 1UGRB 5FRNA 1GCQC 2CP0A 3CXCP 2G3RA 3SFMA 3C94A 1WXUA 2YVLA 3TEEA 3J81E 3SB2A 4DA4A 2D1XA 1UHCA 1G3SA 2NUTB 1NEGA 4ZGDB 2PTKA 1Q82U 4AFUC 3H0IA 3N5BB 2MF2A 4K11A 3EAEA 3G1JA 1MGQA 5GMKj 5GANh 3ZBDA 1HSQA 3RMQA 2M16A 1I4K1 1XNIA 3NTKA 1WFWA 3RKYA 2XG8D 4NOYA 1CR5A 1VQ5Q 2VWFA 4A4HA 4FT2A 1O54A 5DYGA 4DEXA 4C92D 1LCKA 2FHDA 3QHSA 5IAYA 1W1FA 3PT9A 2XI9A 2ZZDA 2YUPA 4M7AB 3LGFA 5A0GA 3JCMW 1NJIU 1VQ9A 1ZBJA 4XU0A 3OSVA 2ZPGB 4ELZC 1GCQA 1YFNA 2HSEB 2CGHA 1TU0B 3EFSA 1IZ6A 5FTLA 1VQ9T 3GLXA 1PRLC 1YBYA 5ERGB 2BZ8A 3M0RA 3E2UA 2IVWA 3H6ZA 1R0BG 3OYDA 3ZJUA 1UJYA 3JCMQ 4EDUA 1ZSGA 1XOVA 5CVIA 3JV3A 4D6WA 2R58A 4NL3A 2RJEA 1Q82C 2H3JA 4EMKC 1UGQB 2K4YA 2AK5A 2V8JA 3ULRB 1RLQC 2A7YA 1M90R 3L42A 1IHVA 1ZA2B 3EFOB 2CZ6B 4C0FA 2LQKA 5KYXA 3L1AA 1YCYA 4GBQA 4J83A 1WA7A 4J9DA 4OB0B 4X9DA 2LP5A 3M4GA 2GTOA 3VRZA 2D6FA 1I81A 2MK5A 5GANg 5FTJA 4RTUA 2OTLQ 3H41A 2BE7D 3CCEQ 1NLPC 2QTVA 4Y91A 2LRQA 3VKIA 5M9OA 2MOXA 2EQIA 3SD4A 1NLOC 4RTYA 3T9NA 3A98A 1PC0A 1VIFA 2K6DA 4JJDA 2EQKA 2NYSA 2VKNA 1NJIC 3P8DA 1LVKA 1V76A 3M56A 3LGLA 2HL5C 1VQ5A 2KAFA 2L3PA 2QG9B 1D0XA 2EYWA 1WDXA 2VXFA 3LYIA 3EGUA 3OMGA 5FU6B 2DJZA 1NZ9A 2YWWA 3HTRA 1YHQQ 4C8QE 4EMKA 3GNGA 1VQ5T 2X9HA 1BKBA 4FYVB 1UGPB 2LCSA 3EG9B 3AHUA 2DL8A 1HXDA 4HVWA 1ZC1A 1BIAA 4F7UE 3A8MB 3I9QA 1UECA 2EIFA 2LNVA 3C0CA 3OYJA 2KT8A 1MNEA 2JS2A 3PGGA 1WJRA 5IHIA 4PJOE 1WHHA 3QJ6A 3R6OA 1TG0A 1SG5A 4L6V5 2C0IA 1QCSA 3OYAA 4KRTA 3GF5A 4M78B 3JB9G 2RF0A 3E9FA 5J3BA 3LHDA 4Y92A 1B07A 3RESA 4PFZA 1S3SA 4OMLA 1ZUYA 3DB3A 1TUDA 4YTLA 1N8RU 3UA6A 4X1VA 1HYOA 1WGSA 2EQUA 1M1KU 3CCUQ 3G4SQ 1R77A 2BUDA 1K76A 2EYQA 4J9FA 3FJ5A 4MDWA 1SSHA 1WLFA 3L2QA 1BB9A 5GANj 4ZTJA 3QWZA 2XICA 3BE3A 3CC7Q 3QWXX 5HK3A 4MDXA 2DILA 1D09B 2KVQG 2I2LA 2OTLA 5GAN4 3CCEA 2RHZA 3EH2A 1HJDA 2H8HA 2QI2A 3MKDA 1QVFA 2JM8A 2ZGWA 1M3AA 2FVUA 5GANd 2X4JA 1M2VB 2OTLT 4HT9A 2SRCA 3CCET 3OYFA 5CKDA 5C6SA 2QDLA 1AD5A 2LNHB 1U5SA 2K9GA 2Y4YA 1Y0MA 4M7DB 4C8QF 2B8AA 2Q1DX 3MEWA 2ED0A 4F17A 2CH4W 1SHGA 4L5GA 2DM1A 2L5QA 3CEYA 2O4XA 1R8OB 3HU2A 2LQWA 1YHQA 2GGRA 2FPFA 2W10A 3A8HB 2YHTA 2M9UA 1X27A 2RHUA 5C18A 4F7UF 4JRQA 1H641 2VB6A 3D7SB 5GAOq 4PJOF 5LL6S 4ZNXA 1YHQT 3PIOA 2LX9A 4FYXB 2HKNA 1ABOA 3L2RA 1N8RC 1KFZA 1K73U 9ATCB 4PFPA 1IGQA 1M1KC 1PNJA 4VUBA 2C06A 1P92A 1QQJA 3A8OB 3MHXA 1WHLA 1RUWA 2EPDA 2FRYA 3OMCA 4J7IA 4DQ2A 1Q81U 2V26A 1UGVA 2SEMA 1K1ZA 2RA2A 3TSWA 1Y96A 2DIQA 2VUBA 4CRIA 1U1TA 3H9NA 3S3NA 2RQVA 3LGAA 4DOVA 2Q19X 3I55Q 4AQ7A 1Q82R 2LX7A 3X26B 4C8QC 3CCUA 1K8AU 3QZ9B 1SRMA 3G4SA 3G7ZA 5CQYA 2A37A 3EH1A 3RNJA 5FRMA 2LW6A 3NTIA 2IPOB 4AFSC 2CUBA 1M1GA 3CCUT 3CC7A 1QMCA 2JXBA 3G4ST 1LNXA 1U3OA 4PJOC 1KQ1A 4RTVA 5KCOA 1M9SA 1ZSZB 3E9GA 2KEAA 3OS1A 1ZQ1A 3URGA 1OX9A 3CC7T 4AG1C 4J6XA 3BY7A 2Q1CX 2E65A 4C5HA 1ACMB 2BIVA 2K7AA 1GXIE 2RM4A 2FEIA 4OB3B 3ZEHA 5L23A 5GAMe 1D1CA 1QKWA 1BI2A 2XIDA 1FWZA 3M9QA 5CCXA 4BACA 2LQNA 3DKMA 1K9MU 1VOMA 3HRSA 1K73C 4LE9A 1RABB 5L8RE 5KYUB 3C12A 1JO8A 1NJIR 2HD0A 1G5VA 4LD6A 3INZA 2DL7A 2QTXA 3OBYA 1Q81C 1D3BA 4JLIA 3NGPA 1QVGP 3OYBA 1G83A 1NEBA 2QAZA 3THKA 4C8QA 2DO3A 2OAWA 3JCMe 3JB9I 2ROTA 2W0ZA 1BYMA 1Y07A 2CH4A 3O8VA 4BI3A 4E7LA 1RAAB 4A4KA 4F7UA 2EBPA 4C0ZA 1FXXA 1M8MA 5CKBA 1X01A 1MNDA 4B9XA 1Y57A 3CCVQ 4KT0E 3KBGA 1QWFA 3LH5A 1TH7A 3OA6A 3UDCA 1NYFA 1WHGA 3WXMB 3CF2A 5GAOm 2JV2A 2F5KA 5GANf 1FMWA 2XKOC 1IREB 1X2KA 3CBOA 3I55A 3L2VA 3OW2A 1D0ZA 5FTKA 2AZVA 3KUFA 4KULA 2JZ2A 4IUPA 3OYGA 4JS4A 4C5GA 4ARCA 3I55T 2YUOA 4RTZA 4M75E 4XTXA 3J7AF 2P4TA 1W2BP 2F2VA 4Z02A 2DXTA 2GBQA 3NPFA 2HCKA 3QXEB 3VJPA 1KHCA 2DL5A 2RQUA 4R55A 1KQSS 2O2OA 4WTOB 1TOVA 3TCJA 1RAIB 4PFOA 2GFUA 2HMAA 3FPTA 2QDYB 2DXUA 4PJOB 4PJNA 1B3QA 1VQ7A 2ROLA 5DM7R 2JJ9A 2RB6A 1S1NA 1ABQA 2XU8A 1LPLA 4C8QG 4LXCA 3CBPA 2HSPA 3QZ5B 1VQ7T 3LLRA 1WYXA 1Q95G 3RUXA 2E6NA 1W2BS 1WHMA 4F7UG 1V1CA 1YI2Q 2NUPB 4IUUA 5CAIA 2E6ZA 2MYSA 4FSSA 4PJOG 2DNUA 4JRKA 1YP5A 4ZN3A 2M02A 2P84A 2DVEA 2I0NA 1N8RR 1RAEB 3CCVA 4ZN1A 2E70A 2DZ9A 2COYA 2K2VA 1M1KR 1JU5C 1N9RA 1PD1A 1CZ5A 3JSCA 1KC8U 3ASKA 3CCVT 1W4SA 1OQKA 2DJQA 3MCAB 1D1AA 2AZSA 1OOTA 3HP9A 2ZAEA 4J9IA 1PKSA 3M53A 5LJ5e 1GBRA 4M75F 4ARIA 3X20B 2Q18X 1JJ2P 5GLFA 3VS2A 5KE2A 1FMVA 2CZ0B 2A28A 2LVMA 1I07A 1FYNA 6AT1B 1UUEA 1WLPB 2LCCA 2RH2A 3HRTA 1ZHIA 1KHIA 3EGXB 3EG1A 2ENMA 2EFIA 3M57A 1U1SA 5IHKA 2L3RA 1M30A 2F69A 1YITQ 3E1SA 2KT1A 2O31A 2QQAA 1UHFA 2E41A 2CP5A 1QW1A 4WF2A 2X4YA 5IXBA 2L3SA 2MAMA 1VQ4Q 3X28B 5GAMh 5FWCA 2JUFA 3GBQA 3BFMA 1RI9A 7AT1B 4J9GA 4KLNA 1RLPC 4M77D 2WSEE 4HCCA 4BE0A 1K73R 1JJ2S 3CXCS 2E12A 4M75C 2K57A 1KC8C 2HL3A 3MEVA 1Q81R 1PM3A 4AS1A 4A63B 2V1QA 1YI2A 5I22A 2EYXA 4EMGA 4QVZA 2D8JA 3J80E 2KRMA 3CD6Q 3LWIA 2CSQA 3P8BB 3CCLQ 3JCMh 1H8KA 4N0AC 1S72Q 1YI2T 4DEYA 1X69A 1OV3A 3VUBA 4BI4A 5CKEA 2KBTA 5EC7A 1OI1A 4HVVA 1C0MA 4FM4B 5CKFA 3EG3A 1G8XA 2JOYA 1QP2A 2EYZA 4C92E 2CP7A 5KYYA 5LJ3e 1AOJA 1W70A 1T3SA 3VS7A 3CCRQ 3BQBA 3OSSC 2C0OA 2AHJB 2KY9A 1WXTA
chains in the Genus database with same CATH topology
4C92B 5GAN5 2WSFE 3VV0A 4E7HA 1MHNA 3V7CA 3HRUA 3ME9A 4L59A 1VQOA 1W2BA 4IUVA 4M75D 5LJ3j 5EPPA 2Y4YA 4M75A 3JCMP 4A53A 2K3XA 2VGNA 4M7DB 3NTHA 4C8QF 2B8AA 2Q1DX 2QA4T 3OW2S 3MEWA 2RI3A 5GAMg 2EJ9A 4LDYA 4L5GA 4MMKA 1VQOT 2HQEA 4CQNA 4OMFB 2L5QA 3MB5A 3UPUA 1YITA 3CEYA 2O4XA 1R8OB 2XK0A 3HU2A 5LJ3d 1YHQA 3A8HB 5GAOp 1VQMA 2YHTA 2M9UA 2PU9B 2RHUA 1B34A 3MP8A 4FIBA 2MI6A 3V7RA 4F7UF 2RHIA 1NPPA 4N0AA 5GMKi 1H641 5GAOq 4JRQA 2GF7A 2JVVA 1VQ4A 4PJOA 2BKDN 4M7AA 3OQ5A 4PJOF 3OS5A 2DXBA 1YITT 2YLCA 4M7AF 2RHYA 5LL6S 4LDXA 3RERA 4IURA 4KBMB 4PL6A 3PIOA 2LX9A 1VQMT 1YHQT 1PSEA 2MWPA 4BI8B 3VYGA 2XDPA 2QXFA 4M78F 3L2RA 2OTJA 1N8RC 2RI2A 1K73U 2K5LA 1PSFA 3PFSA 4BD3A 1VQ4T 3QYHB 4BDZA 1M1KC 2DAQA 3MEAA 4NS5A 3X24B 1O75A 2LQ8A 5DLOA 2XD0A 3ZJVA 4VUBA 2C06A 2V8KA 1P92A 3A8OB 3MHXA 4FU6A 5EQJB 1X6OA 3JCMg 2FL7A 3OMCA 3P8HA 4J7IA 4DQ2A 4FSXA 3I56A 5IT9E 1YJWA 4UC4A 1Q81U 2OTJT 2YUJA 2FYKA 3ZJTA 3OS0A 2RA2A 4PLIA 4LDWA 1Y96A 2R5MA 4C5EA 2K5IA 5FTMA 4BE2A 1XTDA 2JTFA 2DIQA 2VUBA 4Y28E 5FU6C 4CRIA 3CD6A 3LH0A 2LCLA 1I9GA 4OGEA 1U1TA 3I56T 1WPYA 1YJWT 2PJHB 3FPRA 2DTHA 3JCMJ 3CCLA 3S3NA 3LGAA 4ME7A 4DOVA 1VQKA 1S72A 2Q19X 3V8JA 4M78E 2RK1A 3L2WA 1QVGA 4AQ7A 3X26B 3JCMV 3TREA 4C8QC 4HT8A 4LD9K 3CCUA 3QG1A 3VU3C 1K8AU 5FLXE 1FX7A 4XTVA 3CD6T 3DB4A 3QZ9B 3JB9H 3QIIA 3G4SA 1M5Q1 3L2ZA 4ELYC 4JS5A 3G7ZA 5CQYA 3CCLT 1X75C 1JRIA 1BI1A 1OZ3A 3OBWA 4FT4A 1VQKT 1S72T 1BI3A 2JTMA 5FRMA 3FC3A 2LW6A 3NTIA 4DOWA 2XDBA 2KQWA 1Y71A 2OAUA 3PTAA 1Q7YU 4M77F 1M1GA 3CCUT 5LJ5f 3CC7A 1KD1U 5IN1A 1YJNA 3V7SA 3G4ST 3FRNA 3FPUA 2X4XA 4N4HA 4C92F 3QQ8A 3M54A 1LNXA 3OYNA 4PJOC 4OGCA 5GAN6 1KQ1A 3EFRA 2X4WA 4J6YA 1U8RA 5KCOA 3JCMX 1M9SA 3E9GA 5GAN7 2DXCA 3QUIA 1H3ZA 3OS1A 1ZQ1A 1VQNA 2HQXA 3URGA 4M78C 3CC7T 1Y7XA 3V8LA 4M7DF 1YJNT 1VQLA 2Q1CX 4J6XA 3BY7A 3CCRA 2E65A 1XQHA 1EIFA 1JJ2A 4LDVA 4C5HA 3FLGA 4M75G 2BIVA 5LJ5h 3CXCA 1WJSA 2E10A 2RM4A 2E5QA 3PMTA 4OB3B 3ZEHA 5GAMe 1UGSB 1GXIE 4EMKB 5A2QE 1VQ8A 1BI2A 2XIDA 3BW1A 3HHTB 1FWZA 3VUZA 3GNFB 4PLLA 1HK9A 1NPRA 3M9QA 2HAXA 4BACA 3MO8A 1VQNT 4XTWA 2Y4XA 5CCXA 3QDRB 2RD1A 2LC4A 1VQLT 3DKMA 3C4SA 4OP0A 3CCRT 1K9MU 5CIUA 3HRSA 4M77E 1M1FA 4RCCA 2EQMA 1K73C 5L8RE 3C12A 5KCHA 1VQ8T 5GAMj 4JRIA 2FB7A 3CPWS 1RL2A 2R5AA 2HD0A 1G5VA 4FL6A 4QW2A 3PMIA 4LD6A 3LWHA 3INZA 2QTXA 2RJDA 5I2MA 4M7AG 5D6XA 3OBYA 2P0PA 3SWNB 4RCBA 4QVDA 1Q81C 1D3BA 4JLIA 4JLGA 3OYIA 4XTZA 4A4FA 3QC8A 1VUBA 4KODA 4M7DE 3CCMA 1VQPA 4XTYA 3CBMA 3OYBA 2DD4A 5GAMd 2MM2A 3VYHB 3JB9F 3PNWC 4J7FA 5C0MA 4C8QD 4JUVA 4C8QA 3ZGZA 2DO3A 3OYEA 1UB4A 1V29B 5A0DA 4CI0C 5GAN3 4BY6B 3JCMe 3JB9I 2DKGA 2ZCFB 3JCMc 3M5AA 1BYMA 5CQXA 3ZFJA 2IG0A 1Y07A 4TVRA 1UEBA 5DLQE 3CCMT 3C95A 1VQPT 5J39A 4ZTFA 4M77C 2EWNA 3MEUA 3MP1A 3O8VA 4BI3A 4E7LA 1QP3A 4HKEA 5GAOl 3S6WA 2PVOB 4C92C 4II1A 2VC8A 4A4KA 4F7UA 3S3OA 4B9WA 4C0ZA 4O6JA 3G71A 3S3MA 1FXXA 5CKBA 1X01A 2RO0A 3DLMA 4B9XA 4PJOD 4M7AD 4KT0E 4XU2A 3OYMA 3KBGA 3V8KA 3UT1A 3A5ZB 4MMLA 4M7DC 1TH7A 4BDYA 1VIEA 4RG2A 4ZGEB 1UGRB 3OA6A 1Q7YC 1O9SA 4JRPA 5HK0A 1KD1C 4M78A 5FRNA 3UDCA 3GIBA 2E1HA 2G3RA 3WXMB 3SFMA 3C94A 3CF2A 2YVLA 3G71T 3TIWA 1OYXA 3TEEA 3GOXA 5GAOm 3JCMd 3J81E 2JV2A 2F5KA 5GANf 3SB2A 4DA4A 3BDLA 2PVGB 2XKOC 1IREB 2KMTA 1G3SA 5GMKe 2NLUA 4ZGDB 4QQGA 1Q82U 3CBOA 2LTOA 4OB2B 3OY9A 3I55A 3L2VA 3RKXA 3M55A 4ZGJB 3OW2A 4E7KA 5FTKA 3KUFA 3N5BB 2VGMA 2MF2A 2F5TX 1WQ7A 3EAEA 4KULA 2JZ2A 4IUPA 3OYGA 4JS4A 1MGQA 4C5GA 5GMKj 5GANh 3HFOA 3WVEB 3OYHA 4ARCA 3I55T 4M75E 3ZBDA 3CC4A 3BDUA 4XTXA 4E47A 3J7AF 2PUKB 2P4TA 5LJ5g 4Z02A 2DXTA 3RMQA 5IAYA 2JNGA 2M16A 5CCAA 1I4K1 1XNIA 3NTKA 4M75B 5LJ3f 3HU3A 3QXEB 1AHJB 3VJPA 1I8FA 2XG8D 3RKYA 4XAXB 4NOYA 2P0QA 1CR5A 1KHCA 5GAOn 2D0QB 3CC4T 2KDSA 4J8OA 4R55A 1KQSS 3UWNA 2ZPEB 5HKCA 4A4HA 4FT2A 5CCBA 3TCJA 2O4XB 4M77A 3LW5E 1O54A 5DYGA 1QVPA 1KQ2A 2Q1AX 4C92D 4C0DC 3GP8A 2GFUA 4C92A 2FHDA 1G3TA 1B34B 2MMPA 3QHSA 4IUQA 5LJ3h 4A4EA 4EMHA 3RIRA 1CZ4A 2DPPB 2QDYB 4IUTA 3DLLA 3PT9A 2XI9A 3PIPA 2DXUA 2YRVA 4PJOB 2ZZDA 4M7AB 3LGFA 3QJYA 3JRZA 5A0GA 4E7JA 3JCMW 1VQ7A 1NJIU 2WSCE 1VQ9A 2R57A 4M7DA 2P0KA 4XU0A 1Q86U 5DM7R 4NL2A 3OSVA 1QVFS 2K5FA 2ZPGB 2RB6A 4MZMA 4ELZC 2ZPBB 2XU8A 1OZ2A 3QYGB 4C8QG 2CGHA 2JN0A 3CBPA 3QZ5B 4OF1A 5KH6A 1WQWA 2PQWA 4Q5WA 4KO8A 3EFSA 1IZ6A 5CKHA 1M90U 4MZPA 2PUOB 1VQ9T 3LLRA 3GLXA 1VQ7T 5FTLA 2Y90A 5FU7C 3L2UA 1YBYA 4E7IA 5ERGB 3RUXA 5GAN2 1I5LA 2IVWA 3H6ZA 2QQ9A 2RI5A 3OYDA 2YLBA 3ZJUA 2XHCA 5D6WA 2E6NA 3JCMQ 1W2BS 4EDUA 3JCMb 4R56A 4F7UG 1XOVA 3OYKA 2GQVA 5CVIA 1VQ6A 1Y96B 4D6WA 3QSUA 3QQ7A 4IUUA 2EJFA 2E6ZA 2R58A 5CAIA 2RJEA 4NL3A 1Q82C 4PJOG 4KDIA 2H3JA 4JRKA 4KUIA 4ATOA 4XTUA 1YIJA 3E19A 4EMKC 3H8ZA 1UGQB 2K4YA 3RMSA 4PNOA 4JJNK 4ZN3A 2V8JA 3JB9D 4M78G 2DEQA 5CK9A 3META 5GAN8 2A7YA 1BI0A 3L42A 2DVEA 5J26A 4C0FA 2CZ6B 1VQ6T 3CCVA 2LQKA 1M8VA 4ZN1A 2E70A 2DZ9A 2K2VA 3L1AA 2DTIA 3OS2A 1YCYA 1N9RA 1YIJT 3RKWA 4J83A 2CZ1B 4RKUE 3QBYA 1WNLA 2K3YA 4OB0B 4X9DA 1CZ5A 3M4GA 4A54A 3JSCA 4XK8E 1KC8U 2GCXA 5DY9A 3FB9A 2D6FA 1I81A 3ASKA 4HCZA 2HNIA 4RMOA 3CCVT 1W4SA 2PWYA 3SWNC 5GANg 5FTJA 1N27A 4GY5A 5I21A 4N4GA 3G6EA 1K8AC 2GFAA 3HPWA 3MCAB 3NFCA 1QDNA 4LDUA 1YJ9A 4Y91A 3HP9A 2CKKA 2LDMA 1N6AA 2LRQA 3FEOA 4X9CA 4BUGA 3M53A 4O5VA 3VKIA 2WACA 5M9OA 2MWOA 4GLKA 3M59A 1RI0A 5LJ5e 3CPWA 2ZPFB 1BIBA 4M75F 5DYIA 4ARIA 1WJQA 2RJCA 3HFNA 3X20B 4BY6C 3SD4A 2Q18X 4M78D 3G6ET 2DK3A 3T9NA 3X25B 2EQJA 5GLFA 2CYZB 4V2SA 1VIFA 1YJ9T 5KE2A 2CZ0B 2LT4A 3QPHA 2M0OA 5AYFA 2LVMA 5LJ5j 4KDLA 5HY6A 2PVDB 1DJ7B 3TU4K 4OVAA 2EQKA 2L8DA 1SSFA 3KXTA 1NJIC 3P8DA 2LCCA 1Q86C 3QO3A 3M56A 2RH2A 3Q1JA 4M77G 3FIFA 2B25A 3HRTA 2DD5A 3LGLA 1ZHIA 5KE3A 1KHIA 5LJ3g 5CD1A 5GAOr 3F70A 4C92G 2ZPIB 1QVGS 2EFIA 3M57A 5GAMf 4OB1B 2KAFA 2KK4A 1VQ5A 5LJ5d 1U1SA 5CR2A 2L3RA 2F69A 1M90C 3LYIA 5C18A 2VXFA 3OMGA 4JDSA 5FU6B 2DJZA 3JAME 3E1SA 1N9SA 1NZ9A 2D9TA 2QEXA 1K9MC 1D3BB 2QQAA 4C8QE 4EMKA 4M7DG 2E41A 2VXEA 1KG1A 3OYYA 3GNGA 1VQ5T 1QW1A 3CCSA 1BKBA 2A3LA 4WF2A 3HU1A 3OYCA 2VV5A 2X4YA 2MAMA 5GMKl 3CCJA 3X28B 4HA8A 1UGPB 4C8QB 5GAMh 1LOJA 2JUFA 3AHUA 2EAYA 1HXDA 2QEXT 2QQBA 4IKFA 5CO7A 4PKCC 3BFMA 1ZC1A 1BIAA 4F7UE 4A4GA 4KLNA 3A8MB 2EIFA 2LNVA 4QQDA 3OYLA 3CCST 4M77D 3OYJA 5C1BA 2RJFA 2KSSA 3PGGA 2WSEE 4J6WA 1WJRA 4C5IA 4PJOE 5I2SA 3QJ6A 4RG8A 3CCJT 4BE0A 3SWNA 3R6OA 1JJ2S 4HCCA 4M7AE 4C0DB 2E64A 4XQ3A 4F7UB 3CXCS 3QKJA 3GPLA 2DTOA 4QQ6A 2CS7A 2E12A 2QQRA 4L6V5 3JCMf 5GMKm 4M75C 2K57A 3CMAA 1KC8C 1QCSA 3MEVA 2DIGA 2V8IA 3OB9A 3OYAA 1G3YA 4M7DD 3GF5A 4J5YA 4RV0A 4AS1A 1E32A 1YI2A 4M78B 3JB9G 4EMGA 3E9FA 5J3BA 5A0LA 3CC2A 3LHDA 4QVZA 5FROA 2LT1A 4QVCA 3J80E 3SDZA 3LWIA 3CMAT 5FTNA 2M1HA 4XU1A 3RESA 4KUDK 1S3SA 4C0GA 3P8BB 3HKSA 4P5NA 3JCMh 2O01E 3FPTA 1ZBXA 3DB3A 4YTLA 4N0AC 1N8RU 3CMEA 1YI2T 5FU7B 5GANe 1WGSA 4X34A 3CC2T 2MM0A 2EQUA 1KQSA 1M1KU 4M7AC 4MZTA 2HBPA 1LJOA 4N4IA 2RHXA 2EJGA 4EPCA 3CPFA 2BUDA 2CZ7B 3HL8A 2ZPHB 2EYQA 3VUBA 3JB9J 1G3WA 4MDWA 4BI4A 3FJPA 3CMET 3CCQA 5CKEA 1WLFA 3L2QA 5GANj 4ZTJA 1JB0E 3QWZA 2XICA 5D6YA 2RK2A 1OI1A 5HK3A 4MDXA 2EKOA 2KVQG 2OTLA 2I2LA 1R7RA 5GAN4 3CCEA 2RHZA 3LX7A 4BE1A 3ER0A 4FM4B 3M4YA 2QI2A 5B6CA 3CCQT 2QQSA 1QVFA 5CKFA 3HSBA 2ZGWA 3WVDB 2FVUA 4BB7A 5GMKh 5GANd 1M4ZA 2JOYA 1QP2A 4HCBA 2DZCA 2X4JA 2XDDA 2VYTA 2X35A 3A8GB 4XU3A 4C92E 5LJ3e 2OTLT 4HT9A 3MP6A 3CCET 1NE8A 3OYFA 3OSSC 3BQBA 4M77B 2AHJB 1JBMA 2L89A 5EG2A 2KY9A 3FDRA 3A8LB 3M58A 5CKDA 5C6SA 2QA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5H A;  3FLG A;  2BIV A;  3Q1J A;  1WJS A;  2E5Q A;  3LGL A;  3PMT A;  3UWN A;  1MHN A;  3ZEH A;  5KE3 A;  4L59 A;  3ME9 A;  4E7H A;  3F70 A;  4IUV A;  4A4H A;  2EFI A;  2O4X B;  4PLL A;  3M9Q A;  4BAC A;  3MO8 A;  2L3R A;  2K3X A;  3LYI A;  3NTH A;  3OMG A;  2B8A A;  2GFU A;  3C4S A;  2FHD A;  5IAY A;  4A4E A;  4IUQ A;  3MEW A;  2RI3 A;  2D9T A;  5CIU A;  4IUT A;  2EQM A;  5KCH A;  2HQE A;  2YRV A;  3LGF A;  3CEY A;  2O4X A;  2XK0 A;  2R5A A;  4E7J A;  1G5V A;  4FL6 A;  2X4Y A;  3PMI A;  4LD6 A;  4QW2 A;  2R57 A;  3OYC A;  2P0K A;  2RJD A;  2RHU A;  5D6X A;  3MP8 A;  2RHI A;  3OYI A;  4A4F A;  2GF7 A;  4IKF A;  1OZ2 A;  2BKD N;  5KH6 A;  3OYB A;  3OQ5 A;  4A4G A;  2PQW A;  2RHY A;  4Q5W A;  3OYL A;  3PNW C;  4QQD A;  4IUR A;  5C0M A;  4PL6 A;  3OYJ A;  2RJF A;  3LLR A;  4C5I A;  2MWP A;  1WJR A;  3L2U A;  3QJ6 A;  2XDP A;  3OYE A;  4BE0 A;  4E7I A;  3L2R A;  3H6Z A;  2RI2 A;  2RI5 A;  3PFS A;  3OYD A;  3QKJ A;  4BD3 A;  2IG0 A;  2E6N A;  4QQ6 A;  5D6W A;  2QQR A;  2DAQ A;  3MEA A;  4NS5 A;  4EDU A;  5J39 A;  1KHC A;  4BDZ A;  4ZTF A;  3OYK A;  3MEU A;  3MP1 A;  3MEV A;  2DIG A;  3O8V A;  4FU6 A;  3OB9 A;  4IUU A;  4E7L A;  3OYA A;  2R58 A;  3S6W A;  2RJE A;  4II1 A;  3OMC A;  3P8H A;  3S3O A;  4B9W A;  3E9F A;  4UC4 A;  3S3M A;  3OS0 A;  4QVZ A;  3DLM A;  2RO0 A;  3H8Z A;  4B9X A;  5FRO A;  3OYM A;  2M1H A;  3MET A;  4PLI A;  3UT1 A;  4C5E A;  2R5M A;  3L42 A;  5J26 A;  4BE2 A;  2JTF A;  2DIQ A;  4CRI A;  4RG2 A;  3OA6 A;  4BDY A;  3DB3 A;  3LH0 A;  5FRN A;  3OS2 A;  2G3R A;  1WGS A;  4X34 A;  3S3N A;  1OYX A;  2EQU A;  2K3Y A;  3QBY A;  3GOX A;  2F5K A;  3BDL A;  3L2W A;  4N4I A;  2NLU A;  2RHX A;  3ASK A;  4HCZ A;  4QQG A;  2BUD A;  2LTO A;  3DB4 A;  3OY9 A;  3L2V A;  3QII A;  1N27 A;  4GY5 A;  4N4G A;  4E7K A;  2GFA A;  3L2Q A;  4ZTJ A;  1OZ3 A;  3KUF A;  5D6Y A;  2CKK A;  2LDM A;  1OI1 A;  2LRQ A;  3FEO A;  3EAE A;  2EKO A;  5FRM A;  2JZ2 A;  5M9O A;  2WAC A;  3NTI A;  2MWO A;  4IUP A;  3OYG A;  1RI0 A;  3FC3 A;  4C5G A;  2RHZ A;  3LX7 A;  4BE1 A;  3OYH A;  1WJQ A;  2RJC A;  5IN1 A;  3SD4 A;  2QQS A;  2X4X A;  4N4H A;  2EQJ A;  3OYN A;  5KE2 A;  2X4W A;  4Z02 A;  2VYT A;  2X35 A;  5KCO A;  2M0O A;  3E9G A;  1H3Z A;  2M16 A;  2LVM A;  3OS1 A;  3MP6 A;  1XNI A;  3NTK A;  2HQX A;  3OYF A;  4OVA A;  2EQK A;  2L89 A;  1SSF A;  2L8D A;  3FDR A;  3P8D A;  5C6S A;  2LCC A; 
#chains in the Genus database with same CATH topology
 2WSF E;  3VV0 A;  3V7C A;  4L59 A;  3ME9 A;  1D0Y A;  4M75 A;  3JCM P;  3TVT A;  2YT6 A;  1EZZ B;  4AMC A;  5GAM g;  3UA7 A;  1X6B A;  4CQN A;  1YIT A;  2ATC B;  1B34 A;  3V7R A;  2MI6 A;  1NPP A;  4N0A A;  5KYW B;  1VQ4 A;  2X51 A;  4ESR A;  2KXC A;  1CKB A;  3OQ5 A;  1H3H A;  2E4H A;  3OS5 A;  1YIT T;  4KBM B;  1RAD B;  3VYG A;  2MIO A;  3PFS A;  2D8H A;  2B86 A;  1VQ4 T;  1TUC A;  3QYH B;  4BDZ A;  3MEA A;  2XD0 A;  1ZUU A;  3X24 B;  5DLO A;  3ZJV A;  2ABL A;  4KGV B;  1AZG B;  1QVF P;  3JCM g;  2FL7 A;  1NM7 A;  5KYX B;  3OS0 A;  1TWB A;  4PLI A;  4LDW A;  2K5I A;  1A0N B;  5FTM A;  2KI7 A;  1XTD A;  2JTF A;  4HVU A;  4Y28 E;  4RTW A;  3CD6 A;  1FMK A;  1I0C A;  1I9G A;  4OGE A;  2PJH B;  1WPY A;  3CCL A;  1WI7 A;  2DFU A;  1S72 A;  3V8J A;  2RK1 A;  4D8D A;  3CPW P;  2DVJ A;  2RNA A;  4R0K A;  3TRE A;  4IIO A;  3CD6 T;  4XTV A;  3U23 A;  3L2Z A;  4ELY C;  3VS0 A;  3UF4 A;  3CCL T;  1ZA1 B;  1JRI A;  4FT4 A;  1S72 T;  3FC3 A;  1Y71 A;  3CC4 Q;  1Q7Y U;  4M77 F;  5IN1 A;  3FRN A;  4N4H A;  4C92 F;  1Z9Z A;  3OYN A;  2X4W A;  3JCM X;  1H92 A;  3QUI A;  2HQX A;  2H3E B;  3V8L A;  1BU1 A;  3CCR A;  1XQH A;  2ESW A;  2Z0W A;  4LDV A;  4M75 G;  5LJ5 h;  3PMT A;  4LN2 A;  4EMK B;  4HXJ A;  1NPR A;  1JXM A;  3MO8 A;  2Y4X A;  4OMQ A;  2LC4 A;  3CCR T;  3C4S A;  4OP0 A;  1YWP A;  5CIU A;  1M1F A;  2EQM A;  5GAM j;  3CPW S;  1RL2 A;  2XMF A;  4FL6 A;  2RJD A;  5I2M A;  3I5R A;  2P0P A;  3RBB B;  4A4F A;  2M0Y A;  3QC8 A;  1AVZ C;  4KOD A;  3CBM A;  2DD4 A;  4KGZ B;  5GAM d;  3PNW C;  5C0M A;  2FPD A;  3ZGZ A;  2YXY A;  3OYE A;  5FW9 A;  1UB4 A;  4CI0 C;  5GAN 3;  4ANJ A;  1VQ6 Q;  2IG0 A;  5DLQ E;  4TVR A;  1AWO A;  2HDA A;  5J39 A;  4ZTF A;  4M77 C;  2EWN A;  4AFQ C;  3MP1 A;  1YIJ Q;  2AT1 B;  2NWM A;  4HKE A;  5GAO l;  3S6W A;  4C92 C;  1IGU A;  2GNC A;  4CC4 B;  5AT1 B;  2RO0 A;  1OPK A;  3QDF A;  4M7A D;  1BCM A;  3A5Z B;  4MML A;  1EX4 A;  2LJ0 A;  1VIE A;  1Q7Y C;  1QCN A;  5HCK A;  2RQR A;  4JRP A;  4PK4 A;  2E1H A;  3EG2 A;  3TIW A;  1KC8 R;  3JCM d;  1J3T A;  2PVG B;  2KMT A;  2F2W A;  1YJ9 Q;  4B6M A;  2LTO A;  4OB2 B;  3OY9 A;  2JT4 A;  3M55 A;  4ZGJ B;  4E7K A;  2F5T X;  2IIM A;  3QWY A;  4LUD A;  1CSK A;  2QK0 A;  3CC4 A;  4E47 A;  2DER A;  4IIM A;  2PUK B;  5LJ5 g;  3VRY A;  2VVK A;  3HU3 A;  1MMN A;  1VYT A;  4PJM A;  1I8F A;  2KGT A;  2P0Q A;  5I11 A;  5GAO n;  2D0Q B;  3CC4 T;  2KDS A;  4J8O A;  2ZPE B;  5CCB A;  2O4X B;  4M77 A;  2JTE A;  1KQ2 A;  4C0D C;  3GP8 A;  4C92 A;  1G3T A;  4A4E A;  5LJ3 h;  2ECZ A;  1UFF A;  4M4Z A;  4QKU A;  2YRV A;  3CCJ Q;  1YJW Q;  3QJY A;  3JRZ A;  2R57 A;  1AWJ A;  2P0K A;  4NL2 A;  2DEU A;  2ZPB B;  2KXD A;  2RQT A;  3QYG B;  1GCP A;  5KH6 A;  2JN0 A;  1QWE A;  1SF9 A;  1WQW A;  1GL5 A;  2DLP A;  4Z89 A;  1M90 U;  4MZP A;  2PUO B;  1D1B A;  2Y90 A;  1PWT A;  3CMA Q;  4E7I A;  1I5L A;  2QQ9 A;  2RI5 A;  1I1J A;  2XHC A;  3JCM b;  1BK2 A;  3QSU A;  1VQ6 A;  1Y96 B;  3CC2 Q;  2LZ6 B;  2C0T A;  4KDI A;  2BTT A;  1M27 C;  4ATO A;  4XTU A;  4F14 A;  1YIJ A;  3H8Z A;  4PNO A;  3JB9 D;  2O88 A;  2ED1 A;  1PCX A;  4GLM A;  1BI0 A;  1VQ6 T;  3OS2 A;  2COZ A;  1YIJ T;  2J7I A;  2CZ1 B;  3QBY A;  1WNL A;  2K3Y A;  1UJ0 A;  4XK8 E;  2GCX A;  3FB9 A;  2DMO A;  3EGD A;  3VS3 A;  1JEG A;  3SWN C;  2O9V A;  1N27 A;  4CC3 A;  1K8A C;  1QDN A;  2GFA A;  3NFC A;  3VS4 A;  1YJ9 A;  1CKA A;  1UG1 A;  2CKK A;  4BUG A;  4X9C A;  2MWO A;  1RI0 A;  1BIB A;  2KRS A;  5DYI A;  4BY6 C;  4DBR A;  4M78 D;  2DK3 A;  3X25 B;  2EQJ A;  2LJ3 A;  2CYZ B;  4V2S A;  1YJ9 T;  2LT4 A;  2M0O A;  4JPB W;  5LJ5 j;  2PVD B;  1AEY A;  4OVA A;  2L8D A;  1SSF A;  3QO3 A;  3Q1J A;  4M77 G;  3FIF A;  5LJ3 g;  2EYY A;  2PNI A;  5GAO r;  4C92 G;  1QVG S;  5GAM f;  4OB1 B;  2YRC A;  5LJ5 d;  4DBQ A;  3KFV A;  1M90 C;  2CP3 A;  1NG2 A;  3JAM E;  4HCK A;  1N9S A;  2D9T A;  1K9M C;  1D3B B;  1VQM Q;  1KG1 A;  2A3L A;  3OYC A;  2VV5 A;  4E7Z A;  3CCJ A;  4C8Q B;  1KSW A;  1LOJ A;  1GFC A;  2QQB A;  1C1A A;  5CO7 A;  1WIE A;  3OYL A;  2OTJ Q;  2RJF A;  4J6W A;  4F04 B;  5I2S A;  3CCJ T;  3SWN A;  1VYU A;  4C0D B;  4F7U B;  3QKJ A;  4QQ6 A;  2CS7 A;  3JCM f;  5GMK m;  3CMA A;  2DIG A;  2V8I A;  3OB9 A;  2DYI A;  1Z9Q A;  4M7D D;  2GQI A;  2KYB A;  4J5Y A;  1E32 A;  2FPE A;  3CC2 A;  2QGF B;  3CMA T;  1WX6 A;  5FTN A;  4KUD K;  2PZ1 A;  4P5N A;  2O01 E;  1ZBX A;  1VQK Q;  3CC2 T;  2KE9 A;  8ATC B;  4M7A C;  1KQS A;  4MZT A;  2HBP A;  1LJO A;  4OMO A;  2EJG A;  2J6K A;  3CPF A;  2CZ7 B;  2JM9 A;  3HL8 A;  2J6F A;  1G3W A;  4RTX A;  3FJP A;  1JB0 E;  1R0C B;  5D6Y A;  4JZ4 A;  1YJN Q;  1R7R A;  2NUT A;  1AT1 B;  2JW4 A;  3LX7 A;  4BE1 A;  1ARK A;  3M4Y A;  2E3I A;  3WVD B;  1VQN Q;  1WHK A;  4JJC A;  5ECA A;  4XU3 A;  1VQL Q;  4Z88 A;  3CQT A;  3SHW A;  5EG2 A;  3FDR A;  3M58 A;  1VQ8 Q;  5GAN 5;  1AWW A;  1W2B A;  4IUV A;  5LJ3 j;  4FW2 A;  1OU9 A;  2DL4 A;  1PHT A;  2CP2 A;  4A53 A;  1KIK A;  3NTH A;  2EJ9 A;  4MMK A;  2HQE A;  4OMF B;  3MB5 A;  3UPU A;  5LJ3 d;  5GAO p;  1VQM A;  1ZUK A;  1E6G A;  3MP8 A;  4FIB A;  2RHI A;  2JVV A;  4M7A A;  4RUG A;  1GBQ A;  2DXB A;  2EVR A;  4JZ3 A;  3NHN A;  4LDX A;  3RER A;  2EGC A;  2RMO A;  1VQM T;  4BI8 B;  1IRX A;  2AKK A;  2XDP A;  4M78 F;  2OTJ A;  2CUD A;  4FW1 A;  3ZL7 C;  4BD3 A;  2JMC A;  5IHN A;  2DAQ A;  2LQ8 A;  3G71 Q;  1X6O A;  3P8H A;  2CRE A;  2FZC B;  4FSX A;  2OTJ T;  2YUJ A;  2FYK A;  1IXD A;  1PD0 A;  4J9B A;  1SKU B;  2DX1 A;  4C5E A;  4BE2 A;  1NYG A;  2A0F B;  5FU6 C;  3LH0 A;  2LCL A;  1C6V X;  2FZG B;  4KH0 B;  4ME7 A;  1VQK A;  1OEB A;  3EFO A;  3JCM V;  3QG1 A;  2DA9 A;  3JB9 H;  1FX7 A;  3DB4 A;  4AT1 B;  4OMP A;  1M5Q 1;  3PVQ A;  1X75 C;  1MMA A;  3MPU B;  1OZ3 A;  1BI1 A;  1VQK T;  2CT3 A;  3TQ7 P;  1BI3 A;  2JTM A;  4DOW A;  3PTA A;  3A1P A;  1AWX A;  5LJ5 f;  1MUZ A;  1KD1 U;  4JJB A;  1YJN A;  3V7S A;  3FPU A;  2X4X A;  4J6Y A;  1QCF A;  5GAN 7;  2DXC A;  1H3Z A;  1VQN A;  1K8A R;  4M78 C;  3REB B;  1Y7X A;  4M7D F;  1YJN T;  3I5S A;  1VQL A;  1JJ2 A;  1EIF A;  1BBZ A;  3CXC A;  3PE0 A;  1WJS A;  2E10 A;  4D8K A;  1G2B A;  1VQ8 A;  3BW1 A;  2JS0 A;  3VUZ A;  3GNF B;  1IHW A;  2BZX A;  4PLL A;  2L0A A;  1VQN T;  2AIR B;  2HAX A;  4XTW A;  1VQL T;  5KYW A;  4M77 E;  4RCC A;  2KRN A;  2M51 A;  1VQ8 T;  2EGA A;  2FB7 A;  4JRI A;  4EIK A;  1WXB A;  4QW2 A;  3LWH A;  2X3W D;  3PMI A;  4M7A G;  3O5Z A;  1RAH B;  4JLG A;  4PJJ A;  2MCN A;  4XTZ A;  2DRM A;  1RAC B;  2FO0 A;  4ORZ A;  4J7F A;  4C8Q D;  4JUV A;  1K9M R;  3EG9 A;  1KK7 A;  2DKG A;  2ZCF B;  3M5A A;  5CQX A;  2YSQ A;  1UEB A;  3C95 A;  3M0S A;  1TTH B;  1QP3 A;  2GTJ A;  2F2X A;  1JQQ A;  1WZO A;  4B9W A;  4O6J A;  3G71 A;  3S3M A;  3DLM A;  4PJO D;  4AG2 C;  3OYM A;  3V8K A;  2OI3 A;  4M7D C;  4BDY A;  1OU8 A;  4RG2 A;  4ZGE B;  1SPK A;  1O9S A;  5HK0 A;  1KD1 C;  4M78 A;  3GIB A;  3G71 T;  1OYX A;  3GOX A;  1SHF A;  3BDL A;  3G6E Q;  1RAF B;  2K3B A;  5GMK e;  2NLU A;  4QQG A;  3H0H A;  1ZLM A;  4E2F B;  1GFD A;  3RKX A;  1QKX A;  2VGM A;  1WQ7 A;  3REA B;  1M3C A;  1N5Z A;  5KYY B;  4PJL A;  1KJW A;  3HFO A;  3WVE B;  3OYH A;  2V1R A;  3BDU A;  4QT7 A;  1T0H A;  2JNG A;  2NUZ A;  5CCA A;  4M75 B;  5LJ3 f;  4E7S A;  1AHJ B;  1NBE B;  4XAX B;  4F16 A;  3VS1 A;  2JMA A;  3UWN A;  1M2V A;  5HKC A;  3LW5 E;  1QVP A;  2QEX Q;  2A08 A;  2Q1A X;  3EHQ A;  1M3B A;  2MMP A;  1B34 B;  4IUQ A;  4EMH A;  3CCS Q;  3RIR A;  1CZ4 A;  2DPP B;  4IUT A;  3DLL A;  3PIP A;  1PG5 B;  2QGG A;  4E7J A;  3RDV A;  2WSC E;  4M7D A;  2RQW A;  1Q86 U;  1QVF S;  2K5F A;  4MZM A;  2CP6 A;  2AKL A;  4DBH A;  2K79 A;  1X2Q A;  1OZ2 A;  2DF6 A;  2F1L A;  1TXQ A;  4OF1 A;  2BZY A;  2PQW A;  4Q5W A;  4KO8 A;  5CKH A;  3L2U A;  5FU7 C;  5GAN 2;  2LMJ A;  2A36 A;  2YLB A;  1U06 A;  1ZSZ C;  5D6W A;  4OMN A;  1K9A A;  4R56 A;  1E6H A;  2X3X D;  3OYK A;  2GQV A;  4DBF A;  3QQ7 A;  2EJF A;  4KUI A;  2YUN A;  3E19 A;  3RMS A;  4JJN K;  4FYY B;  4M78 G;  2DEQ A;  5CK9 A;  3MET A;  5GAN 8;  3CME Q;  5J26 A;  1M8V A;  2DBK A;  4J9C A;  1UE9 A;  2DTI A;  3RKW A;  4RKU E;  1YCS B;  2DET A;  4A54 A;  3CCQ Q;  5DY9 A;  3SEM A;  3MJX A;  4HCZ A;  2HNI A;  2EW3 A;  4RMO A;  2PWY A;  1K0X A;  3G6E A;  4GY5 A;  2CSI A;  4N4G A;  5I21 A;  3HPW A;  4LDU A;  1XJW B;  2EGE A;  2LDM A;  1N6A A;  3FEO A;  4O5V A;  2WAC A;  3CPW A;  4GLK A;  3M59 A;  2ZPF B;  1PKT A;  1WJQ A;  2RJC A;  3HFN A;  2RPN A;  3G6E T;  4Z8A A;  1F1B B;  3QPH A;  2QA4 Q;  5AYF A;  4KDL A;  2EKH A;  5HY6 A;  1DJ7 B;  3TU4 K;  3KXT A;  1I5O B;  1OX8 A;  1VQO Q;  4KH1 B;  1Q86 C;  2B25 A;  5KE3 A;  2DD5 A;  5CD1 A;  1ZSZ A;  3F70 A;  2ZPI B;  3RR6 A;  2KK4 A;  3UAT A;  5CR2 A;  1E7O A;  4AFZ C;  4JDS A;  1TUG B;  1VYV A;  2QEX A;  2FRW A;  4M7D G;  2VXE A;  3OYY A;  3CCS A;  2DRK A;  3HU1 A;  1TSF A;  1VA7 A;  2L3Q A;  1SEM A;  5GMK l;  5GJW B;  4HA8 A;  2EAY A;  5KYU A;  2QEX T;  3M0T A;  4IKF A;  4PKC C;  4A4G A;  2KYM A;  3CCS T;  4QQD A;  2D0N A;  1IO6 A;  5C1B A;  2KSS A;  4C5I A;  3R6N A;  4RG8 A;  4M7A E;  2E64 A;  4XQ3 A;  3AT1 B;  1B7T A;  2J06 A;  3GPL A;  1OUL A;  2DTO A;  3H0F A;  1WHJ A;  2QQR A;  3M0U A;  3I56 Q;  1TS9 A;  4CC2 A;  1MMG A;  1G3Y A;  2VAS A;  1PRM C;  2DBM A;  4RV0 A;  2FG0 A;  5A0L A;  2CT4 A;  4FYW B;  2P4R A;  5FRO A;  2LT1 A;  4QVC A;  3SDZ A;  4E6R A;  2M1H A;  4XU1 A;  4C0G A;  3HKS A;  3CME A;  5FU7 B;  3OW2 P;  5GAN e;  4X34 A;  2MM0 A;  2HZY A;  2DYB A;  1JXO A;  2J05 A;  3EHR A;  3VS6 A;  4N4I A;  2RHX A;  1YN8 A;  4EPC A;  1YNZ A;  1K0S A;  4LUE A;  2ZPH B;  3JB9 J;  3CME T;  3CCQ A;  3I35 A;  2RK2 A;  2MPX C;  2EKO A;  1KD1 R;  1BCO A;  3ER0 A;  1HD3 A;  5B6C A;  3CCQ T;  2QQS A;  3HSB A;  1VQ7 Q;  4BB7 A;  5GMK h;  1M4Z A;  1T3L A;  4HCB A;  2DZC A;  3VS5 A;  2XDD A;  2VYT A;  2X35 A;  1UDL A;  3A8G B;  5FWB A;  4FCY A;  2HEQ A;  3MP6 A;  1NE8 A;  4M77 B;  1JBM A;  2L89 A;  3A8L B;  2QA4 A;  4C92 B;  4E7H A;  1MHN A;  3HRU A;  1VQO A;  1OPL A;  2QAS A;  3TSZ A;  4M75 D;  5EPP A;  1IB8 A;  1SRL A;  2K3X A;  2VGN A;  2QA4 T;  3OW2 S;  2RI3 A;  1QCO A;  4LDY A;  1VQO T;  1QLY A;  2XK0 A;  2PU9 B;  3CCM Q;  1VQP Q;  5GMK i;  1KQS P;  2GF7 A;  1AZE A;  4PJO A;  3M0P A;  2BKD N;  5KYN A;  2YLC A;  1X6G A;  2RHY A;  4M7A F;  4IUR A;  4PL6 A;  1PSE A;  2MWP A;  4WCI A;  1K4U S;  2QXF A;  2RI2 A;  2K5L A;  1PSF A;  2OJ2 A;  1X43 A;  1EFN A;  4NS5 A;  1O75 A;  2V8K A;  4FU6 A;  4RTT A;  5EQJ B;  3I56 A;  1YJW A;  3ZJT A;  5IT9 E;  4UC4 A;  3IQL A;  3EG0 A;  1RAG B;  2R5M A;  2NUP A;  3NMZ C;  2YDL A;  3EGD B;  2QYZ A;  4KGX B;  3I56 T;  1YJW T;  3FPR A;  5D7U A;  2DTH A;  3JCM J;  1MMD A;  4M78 E;  3L2W A;  1QVG A;  2COW A;  5IXF A;  4LD9 K;  4HT8 A;  3VU3 C;  1GRI A;  5FLX E;  3QII A;  2HKQ B;  4JS5 A;  1ZX6 A;  3OBW A;  4OMM A;  2HQH A;  3M0Q A;  2XDB A;  2KQW A;  2OAU A;  4J9H A;  3QQ8 A;  2E3H A;  3M54 A;  1UTI A;  4OGC A;  5GAN 6;  2OX7 A;  3EFR A;  1U8R A;  1T0J A;  4J9E A;  2YRD A;  3FLG A;  2K2M A;  2DL3 A;  2E5Q A;  2O9S A;  1UGS B;  5A2Q E;  3HHT B;  1Q7Y R;  1HK9 A;  5IH2 A;  2HBW A;  3QDR B;  2RD1 A;  2KNB B;  2CDT A;  1M2O A;  3EGX A;  1VQ9 Q;  5KCH A;  2FZK B;  2R5A A;  1Q86 R;  2L2P A;  5D6X A;  3SWN B;  4RCB A;  4QVD A;  1W6X A;  3OYI A;  5GJV B;  1VUB A;  4M7D E;  3CCM A;  1VQP A;  4XTY A;  2MM2 A;  3VYH B;  3JB9 F;  2J6O A;  2RN8 A;  2BE9 B;  2DE0 X;  1V29 B;  5A0D A;  2LJ1 A;  4CC7 A;  4BY6 B;  2E5K A;  3JCM c;  3ZFJ A;  3CCM T;  1VQP T;  1YWO A;  3MEU A;  2PVO B;  2G6F X;  2KRO A;  4II1 A;  2VC8 A;  8AT1 B;  2YUQ A;  3S3O A;  4LNP A;  2KR3 A;  1MV0 B;  1MV3 A;  3PVL A;  4XU2 A;  3UT1 A;  1UGR B;  5FRN A;  1GCQ C;  2CP0 A;  3CXC P;  2G3R A;  3SFM A;  3C94 A;  1WXU A;  2YVL A;  3TEE A;  3J81 E;  3SB2 A;  4DA4 A;  2D1X A;  1UHC A;  1G3S A;  2NUT B;  1NEG A;  4ZGD B;  2PTK A;  1Q82 U;  4AFU C;  3H0I A;  3N5B B;  2MF2 A;  4K11 A;  3EAE A;  3G1J A;  1MGQ A;  5GMK j;  5GAN h;  3ZBD A;  1HSQ A;  3RMQ A;  2M16 A;  1I4K 1;  1XNI A;  3NTK A;  1WFW A;  3RKY A;  2XG8 D;  4NOY A;  1CR5 A;  1VQ5 Q;  2VWF A;  4A4H A;  4FT2 A;  1O54 A;  5DYG A;  4DEX A;  4C92 D;  1LCK A;  2FHD A;  3QHS A;  5IAY A;  1W1F A;  3PT9 A;  2XI9 A;  2ZZD A;  2YUP A;  4M7A B;  3LGF A;  5A0G A;  3JCM W;  1NJI U;  1VQ9 A;  1ZBJ A;  4XU0 A;  3OSV A;  2ZPG B;  4ELZ C;  1GCQ A;  1YFN A;  2HSE B;  2CGH A;  1TU0 B;  3EFS A;  1IZ6 A;  5FTL A;  1VQ9 T;  3GLX A;  1PRL C;  1YBY A;  5ERG B;  2BZ8 A;  3M0R A;  3E2U A;  2IVW A;  3H6Z A;  1R0B G;  3OYD A;  3ZJU A;  1UJY A;  3JCM Q;  4EDU A;  1ZSG A;  1XOV A;  5CVI A;  3JV3 A;  4D6W A;  2R58 A;  4NL3 A;  2RJE A;  1Q82 C;  2H3J A;  4EMK C;  1UGQ B;  2K4Y A;  2AK5 A;  2V8J A;  3ULR B;  1RLQ C;  2A7Y A;  1M90 R;  3L42 A;  1IHV A;  1ZA2 B;  3EFO B;  2CZ6 B;  4C0F A;  2LQK A;  5KYX A;  3L1A A;  1YCY A;  4GBQ A;  4J83 A;  1WA7 A;  4J9D A;  4OB0 B;  4X9D A;  2LP5 A;  3M4G A;  2GTO A;  3VRZ A;  2D6F A;  1I81 A;  2MK5 A;  5GAN g;  5FTJ A;  4RTU A;  2OTL Q;  3H41 A;  2BE7 D;  3CCE Q;  1NLP C;  2QTV A;  4Y91 A;  2LRQ A;  3VKI A;  5M9O A;  2MOX A;  2EQI A;  3SD4 A;  1NLO C;  4RTY A;  3T9N A;  3A98 A;  1PC0 A;  1VIF A;  2K6D A;  4JJD A;  2EQK A;  2NYS A;  2VKN A;  1NJI C;  3P8D A;  1LVK A;  1V76 A;  3M56 A;  3LGL A;  2HL5 C;  1VQ5 A;  2KAF A;  2L3P A;  2QG9 B;  1D0X A;  2EYW A;  1WDX A;  2VXF A;  3LYI A;  3EGU A;  3OMG A;  5FU6 B;  2DJZ A;  1NZ9 A;  2YWW A;  3HTR A;  1YHQ Q;  4C8Q E;  4EMK A;  3GNG A;  1VQ5 T;  2X9H A;  1BKB A;  4FYV B;  1UGP B;  2LCS A;  3EG9 B;  3AHU A;  2DL8 A;  1HXD A;  4HVW A;  1ZC1 A;  1BIA A;  4F7U E;  3A8M B;  3I9Q A;  1UEC A;  2EIF A;  2LNV A;  3C0C A;  3OYJ A;  2KT8 A;  1MNE A;  2JS2 A;  3PGG A;  1WJR A;  5IHI A;  4PJO E;  1WHH A;  3QJ6 A;  3R6O A;  1TG0 A;  1SG5 A;  4L6V 5;  2C0I A;  1QCS A;  3OYA A;  4KRT A;  3GF5 A;  4M78 B;  3JB9 G;  2RF0 A;  3E9F A;  5J3B A;  3LHD A;  4Y92 A;  1B07 A;  3RES A;  4PFZ A;  1S3S A;  4OML A;  1ZUY A;  3DB3 A;  1TUD A;  4YTL A;  1N8R U;  3UA6 A;  4X1V A;  1HYO A;  1WGS A;  2EQU A;  1M1K U;  3CCU Q;  3G4S Q;  1R77 A;  2BUD A;  1K76 A;  2EYQ A;  4J9F A;  3FJ5 A;  4MDW A;  1SSH A;  1WLF A;  3L2Q A;  1BB9 A;  5GAN j;  4ZTJ A;  3QWZ A;  2XIC A;  3BE3 A;  3CC7 Q;  3QWX X;  5HK3 A;  4MDX A;  2DIL A;  1D09 B;  2KVQ G;  2I2L A;  2OTL A;  5GAN 4;  3CCE A;  2RHZ A;  3EH2 A;  1HJD A;  2H8H A;  2QI2 A;  3MKD A;  1QVF A;  2JM8 A;  2ZGW A;  1M3A A;  2FVU A;  5GAN d;  2X4J A;  1M2V B;  2OTL T;  4HT9 A;  2SRC A;  3CCE T;  3OYF A;  5CKD A;  5C6S A;  2QDL A;  1AD5 A;  2LNH B;  1U5S A;  2K9G A;  2Y4Y A;  1Y0M A;  4M7D B;  4C8Q F;  2B8A A;  2Q1D X;  3MEW A;  2ED0 A;  4F17 A;  2CH4 W;  1SHG A;  4L5G A;  2DM1 A;  2L5Q A;  3CEY A;  2O4X A;  1R8O B;  3HU2 A;  2LQW A;  1YHQ A;  2GGR A;  2FPF A;  2W10 A;  3A8H B;  2YHT A;  2M9U A;  1X27 A;  2RHU A;  5C18 A;  4F7U F;  4JRQ A;  1H64 1;  2VB6 A;  3D7S B;  5GAO q;  4PJO F;  5LL6 S;  4ZNX A;  1YHQ T;  3PIO A;  2LX9 A;  4FYX B;  2HKN A;  1ABO A;  3L2R A;  1N8R C;  1KFZ A;  1K73 U;  9ATC B;  4PFP A;  1IGQ A;  1M1K C;  1PNJ A;  4VUB A;  2C06 A;  1P92 A;  1QQJ A;  3A8O B;  3MHX A;  1WHL A;  1RUW A;  2EPD A;  2FRY A;  3OMC A;  4J7I A;  4DQ2 A;  1Q81 U;  2V26 A;  1UGV A;  2SEM A;  1K1Z A;  2RA2 A;  3TSW A;  1Y96 A;  2DIQ A;  2VUB A;  4CRI A;  1U1T A;  3H9N A;  3S3N A;  2RQV A;  3LGA A;  4DOV A;  2Q19 X;  3I55 Q;  4AQ7 A;  1Q82 R;  2LX7 A;  3X26 B;  4C8Q C;  3CCU A;  1K8A U;  3QZ9 B;  1SRM A;  3G4S A;  3G7Z A;  5CQY A;  2A37 A;  3EH1 A;  3RNJ A;  5FRM A;  2LW6 A;  3NTI A;  2IPO B;  4AFS C;  2CUB A;  1M1G A;  3CCU T;  3CC7 A;  1QMC A;  2JXB A;  3G4S T;  1LNX A;  1U3O A;  4PJO C;  1KQ1 A;  4RTV A;  5KCO A;  1M9S A;  1ZSZ B;  3E9G A;  2KEA A;  3OS1 A;  1ZQ1 A;  3URG A;  1OX9 A;  3CC7 T;  4AG1 C;  4J6X A;  3BY7 A;  2Q1C X;  2E65 A;  4C5H A;  1ACM B;  2BIV A;  2K7A A;  1GXI E;  2RM4 A;  2FEI A;  4OB3 B;  3ZEH A;  5L23 A;  5GAM e;  1D1C A;  1QKW A;  1BI2 A;  2XID A;  1FWZ A;  3M9Q A;  5CCX A;  4BAC A;  2LQN A;  3DKM A;  1K9M U;  1VOM A;  3HRS A;  1K73 C;  4LE9 A;  1RAB B;  5L8R E;  5KYU B;  3C12 A;  1JO8 A;  1NJI R;  2HD0 A;  1G5V A;  4LD6 A;  3INZ A;  2DL7 A;  2QTX A;  3OBY A;  1Q81 C;  1D3B A;  4JLI A;  3NGP A;  1QVG P;  3OYB A;  1G83 A;  1NEB A;  2QAZ A;  3THK A;  4C8Q A;  2DO3 A;  2OAW A;  3JCM e;  3JB9 I;  2ROT A;  2W0Z A;  1BYM A;  1Y07 A;  2CH4 A;  3O8V A;  4BI3 A;  4E7L A;  1RAA B;  4A4K A;  4F7U A;  2EBP A;  4C0Z A;  1FXX A;  1M8M A;  5CKB A;  1X01 A;  1MND A;  4B9X A;  1Y57 A;  3CCV Q;  4KT0 E;  3KBG A;  1QWF A;  3LH5 A;  1TH7 A;  3OA6 A;  3UDC A;  1NYF A;  1WHG A;  3WXM B;  3CF2 A;  5GAO m;  2JV2 A;  2F5K A;  5GAN f;  1FMW A;  2XKO C;  1IRE B;  1X2K A;  3CBO A;  3I55 A;  3L2V A;  3OW2 A;  1D0Z A;  5FTK A;  2AZV A;  3KUF A;  4KUL A;  2JZ2 A;  4IUP A;  3OYG A;  4JS4 A;  4C5G A;  4ARC A;  3I55 T;  2YUO A;  4RTZ A;  4M75 E;  4XTX A;  3J7A F;  2P4T A;  1W2B P;  2F2V A;  4Z02 A;  2DXT A;  2GBQ A;  3NPF A;  2HCK A;  3QXE B;  3VJP A;  1KHC A;  2DL5 A;  2RQU A;  4R55 A;  1KQS S;  2O2O A;  4WTO B;  1TOV A;  3TCJ A;  1RAI B;  4PFO A;  2GFU A;  2HMA A;  3FPT A;  2QDY B;  2DXU A;  4PJO B;  4PJN A;  1B3Q A;  1VQ7 A;  2ROL A;  5DM7 R;  2JJ9 A;  2RB6 A;  1S1N A;  1ABQ A;  2XU8 A;  1LPL A;  4C8Q G;  4LXC A;  3CBP A;  2HSP A;  3QZ5 B;  1VQ7 T;  3LLR A;  1WYX A;  1Q95 G;  3RUX A;  2E6N A;  1W2B S;  1WHM A;  4F7U G;  1V1C A;  1YI2 Q;  2NUP B;  4IUU A;  5CAI A;  2E6Z A;  2MYS A;  4FSS A;  4PJO G;  2DNU A;  4JRK A;  1YP5 A;  4ZN3 A;  2M02 A;  2P84 A;  2DVE A;  2I0N A;  1N8R R;  1RAE B;  3CCV A;  4ZN1 A;  2E70 A;  2DZ9 A;  2COY A;  2K2V A;  1M1K R;  1JU5 C;  1N9R A;  1PD1 A;  1CZ5 A;  3JSC A;  1KC8 U;  3ASK A;  3CCV T;  1W4S A;  1OQK A;  2DJQ A;  3MCA B;  1D1A A;  2AZS A;  1OOT A;  3HP9 A;  2ZAE A;  4J9I A;  1PKS A;  3M53 A;  5LJ5 e;  1GBR A;  4M75 F;  4ARI A;  3X20 B;  2Q18 X;  1JJ2 P;  5GLF A;  3VS2 A;  5KE2 A;  1FMV A;  2CZ0 B;  2A28 A;  2LVM A;  1I07 A;  1FYN A;  6AT1 B;  1UUE A;  1WLP B;  2LCC A;  2RH2 A;  3HRT A;  1ZHI A;  1KHI A;  3EGX B;  3EG1 A;  2ENM A;  2EFI A;  3M57 A;  1U1S A;  5IHK A;  2L3R A;  1M30 A;  2F69 A;  1YIT Q;  3E1S A;  2KT1 A;  2O31 A;  2QQA A;  1UHF A;  2E41 A;  2CP5 A;  1QW1 A;  4WF2 A;  2X4Y A;  5IXB A;  2L3S A;  2MAM A;  1VQ4 Q;  3X28 B;  5GAM h;  5FWC A;  2JUF A;  3GBQ A;  3BFM A;  1RI9 A;  7AT1 B;  4J9G A;  4KLN A;  1RLP C;  4M77 D;  2WSE E;  4HCC A;  4BE0 A;  1K73 R;  1JJ2 S;  3CXC S;  2E12 A;  4M75 C;  2K57 A;  1KC8 C;  2HL3 A;  3MEV A;  1Q81 R;  1PM3 A;  4AS1 A;  4A63 B;  2V1Q A;  1YI2 A;  5I22 A;  2EYX A;  4EMG A;  4QVZ A;  2D8J A;  3J80 E;  2KRM A;  3CD6 Q;  3LWI A;  2CSQ A;  3P8B B;  3CCL Q;  3JCM h;  1H8K A;  4N0A C;  1S72 Q;  1YI2 T;  4DEY A;  1X69 A;  1OV3 A;  3VUB A;  4BI4 A;  5CKE A;  2KBT A;  5EC7 A;  1OI1 A;  4HVV A;  1C0M A;  4FM4 B;  5CKF A;  3EG3 A;  1G8X A;  2JOY A;  1QP2 A;  2EYZ A;  4C92 E;  2CP7 A;  5KYY A;  5LJ3 e;  1AOJ A;  1W70 A;  1T3S A;  3VS7 A;  3CCR Q;  3BQB A;  3OSS C;  2C0O A;  2AHJ B;  2KY9 A;  1WXT A; 
#chains in the Genus database with same CATH homology
 4C92 B;  5GAN 5;  2WSF E;  3VV0 A;  4E7H A;  1MHN A;  3V7C A;  3HRU A;  3ME9 A;  4L59 A;  1VQO A;  1W2B A;  4IUV A;  4M75 D;  5LJ3 j;  5EPP A;  2Y4Y A;  4M75 A;  3JCM P;  4A53 A;  2K3X A;  2VGN A;  4M7D B;  3NTH A;  4C8Q F;  2B8A A;  2Q1D X;  2QA4 T;  3OW2 S;  3MEW A;  2RI3 A;  5GAM g;  2EJ9 A;  4LDY A;  4L5G A;  4MMK A;  1VQO T;  2HQE A;  4CQN A;  4OMF B;  2L5Q A;  3MB5 A;  3UPU A;  1YIT A;  3CEY A;  2O4X A;  1R8O B;  2XK0 A;  3HU2 A;  5LJ3 d;  1YHQ A;  3A8H B;  5GAO p;  1VQM A;  2YHT A;  2M9U A;  2PU9 B;  2RHU A;  1B34 A;  3MP8 A;  4FIB A;  2MI6 A;  3V7R A;  4F7U F;  2RHI A;  1NPP A;  4N0A A;  5GMK i;  1H64 1;  5GAO q;  4JRQ A;  2GF7 A;  2JVV A;  1VQ4 A;  4PJO A;  2BKD N;  4M7A A;  3OQ5 A;  4PJO F;  3OS5 A;  2DXB A;  1YIT T;  2YLC A;  4M7A F;  2RHY A;  5LL6 S;  4LDX A;  3RER A;  4IUR A;  4KBM B;  4PL6 A;  3PIO A;  2LX9 A;  1VQM T;  1YHQ T;  1PSE A;  2MWP A;  4BI8 B;  3VYG A;  2XDP A;  2QXF A;  4M78 F;  3L2R A;  2OTJ A;  1N8R C;  2RI2 A;  1K73 U;  2K5L A;  1PSF A;  3PFS A;  4BD3 A;  1VQ4 T;  3QYH B;  4BDZ A;  1M1K C;  2DAQ A;  3MEA A;  4NS5 A;  3X24 B;  1O75 A;  2LQ8 A;  5DLO A;  2XD0 A;  3ZJV A;  4VUB A;  2C06 A;  2V8K A;  1P92 A;  3A8O B;  3MHX A;  4FU6 A;  5EQJ B;  1X6O A;  3JCM g;  2FL7 A;  3OMC A;  3P8H A;  4J7I A;  4DQ2 A;  4FSX A;  3I56 A;  5IT9 E;  1YJW A;  4UC4 A;  1Q81 U;  2OTJ T;  2YUJ A;  2FYK A;  3ZJT A;  3OS0 A;  2RA2 A;  4PLI A;  4LDW A;  1Y96 A;  2R5M A;  4C5E A;  2K5I A;  5FTM A;  4BE2 A;  1XTD A;  2JTF A;  2DIQ A;  2VUB A;  4Y28 E;  5FU6 C;  4CRI A;  3CD6 A;  3LH0 A;  2LCL A;  1I9G A;  4OGE A;  1U1T A;  3I56 T;  1WPY A;  1YJW T;  2PJH B;  3FPR A;  2DTH A;  3JCM J;  3CCL A;  3S3N A;  3LGA A;  4ME7 A;  4DOV A;  1VQK A;  1S72 A;  2Q19 X;  3V8J A;  4M78 E;  2RK1 A;  3L2W A;  1QVG A;  4AQ7 A;  3X26 B;  3JCM V;  3TRE A;  4C8Q C;  4HT8 A;  4LD9 K;  3CCU A;  3QG1 A;  3VU3 C;  1K8A U;  5FLX E;  1FX7 A;  4XTV A;  3CD6 T;  3DB4 A;  3QZ9 B;  3JB9 H;  3QII A;  3G4S A;  1M5Q 1;  3L2Z A;  4ELY C;  4JS5 A;  3G7Z A;  5CQY A;  3CCL T;  1X75 C;  1JRI A;  1BI1 A;  1OZ3 A;  3OBW A;  4FT4 A;  1VQK T;  1S72 T;  1BI3 A;  2JTM A;  5FRM A;  3FC3 A;  2LW6 A;  3NTI A;  4DOW A;  2XDB A;  2KQW A;  1Y71 A;  2OAU A;  3PTA A;  1Q7Y U;  4M77 F;  1M1G A;  3CCU T;  5LJ5 f;  3CC7 A;  1KD1 U;  5IN1 A;  1YJN A;  3V7S A;  3G4S T;  3FRN A;  3FPU A;  2X4X A;  4N4H A;  4C92 F;  3QQ8 A;  3M54 A;  1LNX A;  3OYN A;  4PJO C;  4OGC A;  5GAN 6;  1KQ1 A;  3EFR A;  2X4W A;  4J6Y A;  1U8R A;  5KCO A;  3JCM X;  1M9S A;  3E9G A;  5GAN 7;  2DXC A;  3QUI A;  1H3Z A;  3OS1 A;  1ZQ1 A;  1VQN A;  2HQX A;  3URG A;  4M78 C;  3CC7 T;  1Y7X A;  3V8L A;  4M7D F;  1YJN T;  1VQL A;  2Q1C X;  4J6X A;  3BY7 A;  3CCR A;  2E65 A;  1XQH A;  1EIF A;  1JJ2 A;  4LDV A;  4C5H A;  3FLG A;  4M75 G;  2BIV A;  5LJ5 h;  3CXC A;  1WJS A;  2E10 A;  2RM4 A;  2E5Q A;  3PMT A;  4OB3 B;  3ZEH A;  5GAM e;  1UGS B;  1GXI E;  4EMK B;  5A2Q E;  1VQ8 A;  1BI2 A;  2XID A;  3BW1 A;  3HHT B;  1FWZ A;  3VUZ A;  3GNF B;  4PLL A;  1HK9 A;  1NPR A;  3M9Q A;  2HAX A;  4BAC A;  3MO8 A;  1VQN T;  4XTW A;  2Y4X A;  5CCX A;  3QDR B;  2RD1 A;  2LC4 A;  1VQL T;  3DKM A;  3C4S A;  4OP0 A;  3CCR T;  1K9M U;  5CIU A;  3HRS A;  4M77 E;  1M1F A;  4RCC A;  2EQM A;  1K73 C;  5L8R E;  3C12 A;  5KCH A;  1VQ8 T;  5GAM j;  4JRI A;  2FB7 A;  3CPW S;  1RL2 A;  2R5A A;  2HD0 A;  1G5V A;  4FL6 A;  4QW2 A;  3PMI A;  4LD6 A;  3LWH A;  3INZ A;  2QTX A;  2RJD A;  5I2M A;  4M7A G;  5D6X A;  3OBY A;  2P0P A;  3SWN B;  4RCB A;  4QVD A;  1Q81 C;  1D3B A;  4JLI A;  4JLG A;  3OYI A;  4XTZ A;  4A4F A;  3QC8 A;  1VUB A;  4KOD A;  4M7D E;  3CCM A;  1VQP A;  4XTY A;  3CBM A;  3OYB A;  2DD4 A;  5GAM d;  2MM2 A;  3VYH B;  3JB9 F;  3PNW C;  4J7F A;  5C0M A;  4C8Q D;  4JUV A;  4C8Q A;  3ZGZ A;  2DO3 A;  3OYE A;  1UB4 A;  1V29 B;  5A0D A;  4CI0 C;  5GAN 3;  4BY6 B;  3JCM e;  3JB9 I;  2DKG A;  2ZCF B;  3JCM c;  3M5A A;  1BYM A;  5CQX A;  3ZFJ A;  2IG0 A;  1Y07 A;  4TVR A;  1UEB A;  5DLQ E;  3CCM T;  3C95 A;  1VQP T;  5J39 A;  4ZTF A;  4M77 C;  2EWN A;  3MEU A;  3MP1 A;  3O8V A;  4BI3 A;  4E7L A;  1QP3 A;  4HKE A;  5GAO l;  3S6W A;  2PVO B;  4C92 C;  4II1 A;  2VC8 A;  4A4K A;  4F7U A;  3S3O A;  4B9W A;  4C0Z A;  4O6J A;  3G71 A;  3S3M A;  1FXX A;  5CKB A;  1X01 A;  2RO0 A;  3DLM A;  4B9X A;  4PJO D;  4M7A D;  4KT0 E;  4XU2 A;  3OYM A;  3KBG A;  3V8K A;  3UT1 A;  3A5Z B;  4MML A;  4M7D C;  1TH7 A;  4BDY A;  1VIE A;  4RG2 A;  4ZGE B;  1UGR B;  3OA6 A;  1Q7Y C;  1O9S A;  4JRP A;  5HK0 A;  1KD1 C;  4M78 A;  5FRN A;  3UDC A;  3GIB A;  2E1H A;  2G3R A;  3WXM B;  3SFM A;  3C94 A;  3CF2 A;  2YVL A;  3G71 T;  3TIW A;  1OYX A;  3TEE A;  3GOX A;  5GAO m;  3JCM d;  3J81 E;  2JV2 A;  2F5K A;  5GAN f;  3SB2 A;  4DA4 A;  3BDL A;  2PVG B;  2XKO C;  1IRE B;  2KMT A;  1G3S A;  5GMK e;  2NLU A;  4ZGD B;  4QQG A;  1Q82 U;  3CBO A;  2LTO A;  4OB2 B;  3OY9 A;  3I55 A;  3L2V A;  3RKX A;  3M55 A;  4ZGJ B;  3OW2 A;  4E7K A;  5FTK A;  3KUF A;  3N5B B;  2VGM A;  2MF2 A;  2F5T X;  1WQ7 A;  3EAE A;  4KUL A;  2JZ2 A;  4IUP A;  3OYG A;  4JS4 A;  1MGQ A;  4C5G A;  5GMK j;  5GAN h;  3HFO A;  3WVE B;  3OYH A;  4ARC A;  3I55 T;  4M75 E;  3ZBD A;  3CC4 A;  3BDU A;  4XTX A;  4E47 A;  3J7A F;  2PUK B;  2P4T A;  5LJ5 g;  4Z02 A;  2DXT A;  3RMQ A;  5IAY A;  2JNG A;  2M16 A;  5CCA A;  1I4K 1;  1XNI A;  3NTK A;  4M75 B;  5LJ3 f;  3HU3 A;  3QXE B;  1AHJ B;  3VJP A;  1I8F A;  2XG8 D;  3RKY A;  4XAX B;  4NOY A;  2P0Q A;  1CR5 A;  1KHC A;  5GAO n;  2D0Q B;  3CC4 T;  2KDS A;  4J8O A;  4R55 A;  1KQS S;  3UWN A;  2ZPE B;  5HKC A;  4A4H A;  4FT2 A;  5CCB A;  3TCJ A;  2O4X B;  4M77 A;  3LW5 E;  1O54 A;  5DYG A;  1QVP A;  1KQ2 A;  2Q1A X;  4C92 D;  4C0D C;  3GP8 A;  2GFU A;  4C92 A;  2FHD A;  1G3T A;  1B34 B;  2MMP A;  3QHS A;  4IUQ A;  5LJ3 h;  4A4E A;  4EMH A;  3RIR A;  1CZ4 A;  2DPP B;  2QDY B;  4IUT A;  3DLL A;  3PT9 A;  2XI9 A;  3PIP A;  2DXU A;  2YRV A;  4PJO B;  2ZZD A;  4M7A B;  3LGF A;  3QJY A;  3JRZ A;  5A0G A;  4E7J A;  3JCM W;  1VQ7 A;  1NJI U;  2WSC E;  1VQ9 A;  2R57 A;  4M7D A;  2P0K A;  4XU0 A;  1Q86 U;  5DM7 R;  4NL2 A;  3OSV A;  1QVF S;  2K5F A;  2ZPG B;  2RB6 A;  4MZM A;  4ELZ C;  2ZPB B;  2XU8 A;  1OZ2 A;  3QYG B;  4C8Q G;  2CGH A;  2JN0 A;  3CBP A;  3QZ5 B;  4OF1 A;  5KH6 A;  1WQW A;  2PQW A;  4Q5W A;  4KO8 A;  3EFS A;  1IZ6 A;  5CKH A;  1M90 U;  4MZP A;  2PUO B;  1VQ9 T;  3LLR A;  3GLX A;  1VQ7 T;  5FTL A;  2Y90 A;  5FU7 C;  3L2U A;  1YBY A;  4E7I A;  5ERG B;  3RUX A;  5GAN 2;  1I5L A;  2IVW A;  3H6Z A;  2QQ9 A;  2RI5 A;  3OYD A;  2YLB A;  3ZJU A;  2XHC A;  5D6W A;  2E6N A;  3JCM Q;  1W2B S;  4EDU A;  3JCM b;  4R56 A;  4F7U G;  1XOV A;  3OYK A;  2GQV A;  5CVI A;  1VQ6 A;  1Y96 B;  4D6W A;  3QSU A;  3QQ7 A;  4IUU A;  2EJF A;  2E6Z A;  2R58 A;  5CAI A;  2RJE A;  4NL3 A;  1Q82 C;  4PJO G;  4KDI A;  2H3J A;  4JRK A;  4KUI A;  4ATO A;  4XTU A;  1YIJ A;  3E19 A;  4EMK C;  3H8Z A;  1UGQ B;  2K4Y A;  3RMS A;  4PNO A;  4JJN K;  4ZN3 A;  2V8J A;  3JB9 D;  4M78 G;  2DEQ A;  5CK9 A;  3MET A;  5GAN 8;  2A7Y A;  1BI0 A;  3L42 A;  2DVE A;  5J26 A;  4C0F A;  2CZ6 B;  1VQ6 T;  3CCV A;  2LQK A;  1M8V A;  4ZN1 A;  2E70 A;  2DZ9 A;  2K2V A;  3L1A A;  2DTI A;  3OS2 A;  1YCY A;  1N9R A;  1YIJ T;  3RKW A;  4J83 A;  2CZ1 B;  4RKU E;  3QBY A;  1WNL A;  2K3Y A;  4OB0 B;  4X9D A;  1CZ5 A;  3M4G A;  4A54 A;  3JSC A;  4XK8 E;  1KC8 U;  2GCX A;  5DY9 A;  3FB9 A;  2D6F A;  1I81 A;  3ASK A;  4HCZ A;  2HNI A;  4RMO A;  3CCV T;  1W4S A;  2PWY A;  3SWN C;  5GAN g;  5FTJ A;  1N27 A;  4GY5 A;  5I21 A;  4N4G A;  3G6E A;  1K8A C;  2GFA A;  3HPW A;  3MCA B;  3NFC A;  1QDN A;  4LDU A;  1YJ9 A;  4Y91 A;  3HP9 A;  2CKK A;  2LDM A;  1N6A A;  2LRQ A;  3FEO A;  4X9C A;  4BUG A;  3M53 A;  4O5V A;  3VKI A;  2WAC A;  5M9O A;  2MWO A;  4GLK A;  3M59 A;  1RI0 A;  5LJ5 e;  3CPW A;  2ZPF B;  1BIB A;  4M75 F;  5DYI A;  4ARI A;  1WJQ A;  2RJC A;  3HFN A;  3X20 B;  4BY6 C;  3SD4 A;  2Q18 X;  4M78 D;  3G6E T;  2DK3 A;  3T9N A;  3X25 B;  2EQJ A;  5GLF A;  2CYZ B;  4V2S A;  1VIF A;  1YJ9 T;  5KE2 A;  2CZ0 B;  2LT4 A;  3QPH A;  2M0O A;  5AYF A;  2LVM A;  5LJ5 j;  4KDL A;  5HY6 A;  2PVD B;  1DJ7 B;  3TU4 K;  4OVA A;  2EQK A;  2L8D A;  1SSF A;  3KXT A;  1NJI C;  3P8D A;  2LCC A;  1Q86 C;  3QO3 A;  3M56 A;  2RH2 A;  3Q1J A;  4M77 G;  3FIF A;  2B25 A;  3HRT A;  2DD5 A;  3LGL A;  1ZHI A;  5KE3 A;  1KHI A;  5LJ3 g;  5CD1 A;  5GAO r;  3F70 A;  4C92 G;  2ZPI B;  1QVG S;  2EFI A;  3M57 A;  5GAM f;  4OB1 B;  2KAF A;  2KK4 A;  1VQ5 A;  5LJ5 d;  1U1S A;  5CR2 A;  2L3R A;  2F69 A;  1M90 C;  3LYI A;  5C18 A;  2VXF A;  3OMG A;  4JDS A;  5FU6 B;  2DJZ A;  3JAM E;  3E1S A;  1N9S A;  1NZ9 A;  2D9T A;  2QEX A;  1K9M C;  1D3B B;  2QQA A;  4C8Q E;  4EMK A;  4M7D G;  2E41 A;  2VXE A;  1KG1 A;  3OYY A;  3GNG A;  1VQ5 T;  1QW1 A;  3CCS A;  1BKB A;  2A3L A;  4WF2 A;  3HU1 A;  3OYC A;  2VV5 A;  2X4Y A;  2MAM A;  5GMK l;  3CCJ A;  3X28 B;  4HA8 A;  1UGP B;  4C8Q B;  5GAM h;  1LOJ A;  2JUF A;  3AHU A;  2EAY A;  1HXD A;  2QEX T;  2QQB A;  4IKF A;  5CO7 A;  4PKC C;  3BFM A;  1ZC1 A;  1BIA A;  4F7U E;  4A4G A;  4KLN A;  3A8M B;  2EIF A;  2LNV A;  4QQD A;  3OYL A;  3CCS T;  4M77 D;  3OYJ A;  5C1B A;  2RJF A;  2KSS A;  3PGG A;  2WSE E;  4J6W A;  1WJR A;  4C5I A;  4PJO E;  5I2S A;  3QJ6 A;  4RG8 A;  3CCJ T;  4BE0 A;  3SWN A;  3R6O A;  1JJ2 S;  4HCC A;  4M7A E;  4C0D B;  2E64 A;  4XQ3 A;  4F7U B;  3CXC S;  3QKJ A;  3GPL A;  2DTO A;  4QQ6 A;  2CS7 A;  2E12 A;  2QQR A;  4L6V 5;  3JCM f;  5GMK m;  4M75 C;  2K57 A;  3CMA A;  1KC8 C;  1QCS A;  3MEV A;  2DIG A;  2V8I A;  3OB9 A;  3OYA A;  1G3Y A;  4M7D D;  3GF5 A;  4J5Y A;  4RV0 A;  4AS1 A;  1E32 A;  1YI2 A;  4M78 B;  3JB9 G;  4EMG A;  3E9F A;  5J3B A;  5A0L A;  3CC2 A;  3LHD A;  4QVZ A;  5FRO A;  2LT1 A;  4QVC A;  3J80 E;  3SDZ A;  3LWI A;  3CMA T;  5FTN A;  2M1H A;  4XU1 A;  3RES A;  4KUD K;  1S3S A;  4C0G A;  3P8B B;  3HKS A;  4P5N A;  3JCM h;  2O01 E;  3FPT A;  1ZBX A;  3DB3 A;  4YTL A;  4N0A C;  1N8R U;  3CME A;  1YI2 T;  5FU7 B;  5GAN e;  1WGS A;  4X34 A;  3CC2 T;  2MM0 A;  2EQU A;  1KQS A;  1M1K U;  4M7A C;  4MZT A;  2HBP A;  1LJO A;  4N4I A;  2RHX A;  2EJG A;  4EPC A;  3CPF A;  2BUD A;  2CZ7 B;  3HL8 A;  2ZPH B;  2EYQ A;  3VUB A;  3JB9 J;  1G3W A;  4MDW A;  4BI4 A;  3FJP A;  3CME T;  3CCQ A;  5CKE A;  1WLF A;  3L2Q A;  5GAN j;  4ZTJ A;  1JB0 E;  3QWZ A;  2XIC A;  5D6Y A;  2RK2 A;  1OI1 A;  5HK3 A;  4MDX A;  2EKO A;  2KVQ G;  2OTL A;  2I2L A;  1R7R A;  5GAN 4;  3CCE A;  2RHZ A;  3LX7 A;  4BE1 A;  3ER0 A;  4FM4 B;  3M4Y A;  2QI2 A;  5B6C A;  3CCQ T;  2QQS A;  1QVF A;  5CKF A;  3HSB A;  2ZGW A;  3WVD B;  2FVU A;  4BB7 A;  5GMK h;  5GAN d;  1M4Z A;  2JOY A;  1QP2 A;  4HCB A;  2DZC A;  2X4J A;  2XDD A;  2VYT A;  2X35 A;  3A8G B;  4XU3 A;  4C92 E;  5LJ3 e;  2OTL T;  4HT9 A;  3MP6 A;  3CCE T;  1NE8 A;  3OYF A;  3OSS C;  3BQB A;  4M77 B;  2AHJ B;  1JBM A;  2L89 A;  5EG2 A;  2KY9 A;  3FDR A;  3A8L B;  3M58 A;  5CKD A;  5C6S A;  2QA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...