2GF7A

Double tudor domain structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
b'QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Jumonji domain-containing protein 2A
publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 21
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gf7A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gf7A02
2GF7A 4FU6A 4BDYA 3UT1A 2EKOA 4BD3A 4UC4A 3L2VA 3OMGA 4X34A 3PMIA 3DB4A 4C5IA 4BDZA 3FC3A 4N4HA 3META 4Z02A 2DAQA 5D6WA 2IG0A 4IUTA 5FRMA 3OYKA 2MWPA 2RJDA 4LD6A 2DIQA 5C6SA 3LLRA 4ZTJA 3EAEA 4BE0A 2BIVA 3CEYA 5D6YA 2EQJA 4PLIA 3ZEHA 3L2QA 4FL6A 4PL6A 1OI1A 4EDUA 3OYEA 3OYDA 2LRQA 2XDPA 3LGLA 2M16A 3OS2A 4E7JA 2GFUA 3LYIA 4ZTFA 3OMCA 5M9OA 2RI2A 3F70A 2WACA 3NTHA 3QJ6A 3OYFA 3OQ5A 3ME9A 1H3ZA 2FHDA 3FLGA 2HQEA 3OB9A 4A4EA 3MEAA 3OY9A 3MEWA 2RHIA 4QQGA 4QQDA 1N27A 5KCHA 4L59A 2RJCA 4C5EA 5IN1A 5KE2A 5KCOA 1KHCA 3OYMA 1OYXA 3KUFA 3OYAA 3FEOA 3OYJA 3O8VA 2D9TA 3P8DA 2JTFA 3BDLA 2R57A 2RHXA 3QBYA 4IUVA 3UWNA 3PMTA 1MHNA 2LDMA 2BUDA 4IUPA 3H6ZA 2EQUA 3OS0A 2X35A 2R5MA 4BE1A 2BKDN 4E7LA 2CKKA 2MWOA 4NS5A 2EQKA 2F5KA 4PLLA 3OYGA 4QVZA 3MEUA 3LX7A 3E9GA 4C5HA 4IKFA 2L8DA 2HQXA 2RI3A 5D6XA 2O4XB 3E9FA 2DIGA 3L2UA 2K3XA 3S6WA 4IURA 3FDRA 1WJSA 4B9XA 5C0MA 5IAYA 3L2RA 2X4WA 5J26A 2R5AA 3QKJA 3QIIA 3LH0A 3DLMA 4E7IA 1XNIA 2G3RA 3S3NA 4IUQA 1WJQA 2P0KA 2RI5A 3OS1A 3PNWC 2L89A 2LCCA 1WJRA 3SD4A 2EQMA 3S3OA 4C5GA 3NTIA 1OZ2A 3OYHA 2RO0A 2QQSA 4BE2A 5FRNA 2PQWA 3L2WA 3OYLA 3MP8A 2E6NA 3OYNA 3OYCA 4RG2A 2VYTA 3H8ZA 3P8HA 3OYIA 4Q5WA 5KH6A 2QQRA 2JZ2A 2RHUA 4A4HA 3OYBA 2RJFA 3MP6A 4BACA 2O4XA 3GOXA 2YRVA 2M0OA 3OA6A 3MEVA 4A4GA 2LVMA 2L3RA 4E7HA 2R58A 2RJEA 4N4GA 3MP1A 3PFSA 4HCZA 4OVAA 3C4SA 4B9WA 5J39A 1SSFA 3Q1JA 2M1HA 2E5QA 4GY5A 3MO8A 4IUUA 5CIUA 2LTOA 3LGFA 4CRIA 2RHYA 1RI0A 4N4IA 2X4YA 3NTKA 2X4XA 1OZ3A 4QW2A 4E7KA 2RHZA 4QQ6A 3S3MA 2K3YA 1G5VA 5KE3A 4II1A 4A4FA 2GFAA 3DB3A 2NLUA 3L42A 3ASKA 2B8AA 3M9QA 2EFIA 2XK0A 1WGSA 5FROA
chains in the Genus database with same CATH superfamily
1T3LA 2HCKA 1X2QA 2CS7A 2FL7A 1W1FA 3CCVA 5FTJA 1GBRA 2MPXC 3G4SQ 4OMQA 1X75C 1AVZC 1PG5B 1YHQA 5J3BA 1ZHIA 2EQJA 2QG9B 3GNFB 4J6XA 2EIFA 3X24B 2EKHA 1UEBA 3CMAT 1TOVA 1PM3A 2FZKB 5A0DA 1IGQA 3PIPA 4HCKA 3M54A 2K57A 2RHIA 5GANj 5KCHA 4RMOA 3DKMA 4E47A 1QCSA 2RA2A 3OS0A 5CCBA 2CKKA 2KR3A 3LX7A 4DEYA 2KT8A 2DBKA 1U06A 1AWWA 2O4XB 2JXBA 2DIGA 4J9GA 3TCJA 2EYWA 3FDRA 1WJSA 4BUGA 4B9XA 1QCNA 2X4WA 2V8KA 4EMKC 2C0IA 2MCNA 4X9CA 4E7IA 4Y92A 1MMDA 4OGCA 5GANg 2RK1A 2I2LA 3MHXA 1GXIE 1U8RA 3PNWC 1WJRA 4FYVB 1ZUUA 1VQ4T 1M2VB 2CZ6B 2EGAA 2RO0A 2YWWA 3CXCP 1I5LA 3JB9F 2MM0A 5B6CA 4M7DD 5FTNA 3NMZC 1RAAB 5KH6A 3QWZA 3CBPA 1S1NA 4A4HA 4C8QA 1VQPQ 4KT0E 1WLPB 1OV3A 2B25A 4PKCC 1YIJT 3M53A 2AZVA 2KSSA 4LXCA 4ZGDB 2BE7D 4LDVA 2HKQB 3A8OB 2M1HA 4CI0C 3MO8A 2FEIA 1PRLC 3JCMd 1QVPA 3I9QA 4XTXA 5FWCA 1IREB 4II1A 1EFNA 4A4FA 2JJ9A 2LJ3A 2E70A 3VRZA 1RAHB 1M5Q1 3JAME 1UG1A 1G3SA 3MB5A 5IHIA 1TU0B 4C5IA 2XG8D 2GNCA 3META 3NGPA 2JTMA 1BI0A 4AMCA 2VKNA 1ZBJA 5D6YA 1Q81R 1ZSZB 2P4TA 1NEBA 3EGDB 2J05A 1AEYA 4M78F 1MGQA 1ZX6A 1RAFB 5GLFA 1D09B 2LQNA 2M9UA 4M77E 4E7JA 1OQKA 1M90R 3G1JA 4AG1C 2D8HA 2K9GA 2HQEA 2A37A 3MEAA 4A54A 2EBPA 2PNIA 4XK8E 4F04B 2QA4A 2DPPB 1B07A 5KE2A 5I11A 2GCXA 2VC8A 1AWOA 3O8VA 2M51A 4XAXB 2RHXA 2JS0A 1TUDA 4OMPA 1KD1C 1TXQA 1CSKA 4ZGEB 1U3OA 1WXTA 3GP8A 1AZGB 1G8XA 3CBOA 2GQIA 1YCSB 3L2RA 1IHVA 2R5AA 4M75D 1VQLT 1QW1A 3CF2A 2KY9A 4JRQA 3QSUA 2EVRA 2LT4A 3VS0A 4ARCA 4JRKA 5DYIA 2GTOA 1VQ9A 1M1KR 1WDXA 1TWBA 3BFMA 1BB9A 1VQNA 1OU8A 3H8ZA 1UGRB 2NUZA 2JNGA 1KQSA 3FRNA 2M0OA 1YITA 4MMLA 2DTOA 2R58A 4M7AE 1D1CA 3RBBB 1B7TA 2ZPFB 1MV3A 4GY5A 3ZJTA 1IB8A 1YBYA 5KYYA 3QYGB 1Q7YR 1JXOA 1VYUA 3X20B 1YJNA 5L8RE 3QQ8A 1WPYA 3CCQQ 2EWNA 4P5NA 1H3HA 2A3LA 5GJVB 4BDZA 5GAN7 1Y57A 2X9HA 1KIKA 1SPKA 4C92F 3SHWA 4F7UA 5LJ3h 5GMKh 1JEGA 3JCMV 1WHLA 4Z88A 3OMCA 3I55Q 2AKKA 3CPWP 4J9IA 1M8MA 1KG1A 1ZUKA 1QVGA 2ECZA 2V8IA 4N0AA 2OX7A 2KRSA 1WHHA 4C5EA 3PTAA 5LL6S 3QZ9B 4RTTA 1K8AU 4IUVA 3CCEA 2BUDA 3G7ZA 2DL7A 2YUNA 5LJ5j 3CMAQ 2L8DA 1UB4A 5EQJB 1RI9A 3L2UA 2K3XA 3S6WA 1M90U 4KLNA 3HHTB 1W6XA 4HA8A 4M7DG 3REBB 1KC8U 1I1JA 1XNIA 1QLYA 3X28B 3C95A 2CSIA 4AFUC 1Z9ZA 2MAMA 4JZ4A 2YT6A 4JPBW 4X1VA 1GCQC 1ZSZC 2AT1B 2KYMA 1EX4A 3QQ7A 3OYBA 3MCAB 5CQYA 5GMKm 3MJXA 2EGCA 2KDSA 1CKBA 3PFSA 1G3WA 3EHQA 3PGGA 1QP2A 4XU1A 1VQMT 2H3JA 1JU5C 4OB2B 2RD1A 5GMKi 1VQ4Q 1M9SA 3EGXB 3ASKA 1TH7A 3M9QA 1M1KU 1UJ0A 4D8DA 1HYOA 2DKGA 1YCYA 3OMGA 2ENMA 4J7IA 4N4HA 4Z02A 2FPFA 5FRMA 4M78D 5C6SA 1W4SA 4ZTJA 1C6VX 2KXCA 3EAEA 4C92C 2I0NA 2KI7A 1YIJQ 4PNOA 3R6NA 2OJ2A 2CP0A 4MZMA 3CC7A 4MMKA 3LGAA 3JSCA 1PRMC 4PJMA 4ZN1A 4GBQA 1Q7YU 4RTZA 5FWBA 1JO8A 1RACB 2E3HA 4KH1B 3X25B 5KYWA 1YJWT 5C18A 1RADB 3FPRA 5KYUB 5GAOl 3M0SA 1MHNA 2LDMA 4IUPA 3SB2A 5IXFA 4JRIA 2L3PA 4M7DB 4M75G 4ORZA 3A8MB 3CCMT 2KBTA 2W10A 1D0XA 2HQXA 3JCMh 1VYTA 2DEQA 4X9DA 1VQ6A 5IAYA 2QQAA 3CCVT 2JN0A 5DM7R 3S3NA 1YHQT 1Y71A 3GPLA 2L89A 3REAB 3NTIA 3OYLA 5GMKe 2FZGB 2BTTA 4RCBA 3OYCA 3OW2A 1SKUB 1E6GA 1HXDA 2QQRA 4FCYA 4YTLA 1YWPA 1I9GA 5KYNA 2CUDA 4F7UG 4BACA 4J9DA 4OVAA 2KAFA 1X69A 2KRMA 1VQLQ 1QVFP 2XICA 5GAN8 1RI0A 4N4IA 3V8KA 4LDYA 1LOJA 1W2BS 2Q1CX 4XU3A 3MKDA 3TU4K 2LJ1A 2XK0A 2CH4W 2LQWA 2BZ8A 3UT1A 1BCOA 4OB3B 4C92D 2PVGB 2PJHB 1G2BA 4PJOD 3A5ZB 4PJLA 4DQ2A 2KT1A 5I2SA 3M0QA 3VS6A 5A0GA 1NM7A 4PL6A 8AT1B 2M16A 4KGVB 2K7AA 5M9OA 2DL3A 1K8AC 2NWMA 3CMEA 3SFMA 4AFSC 1M1GA 2CZ0B 2ZPBB 3VS5A 2OTJA 2F2VA 4Y28E 1S72A 4KO8A 2XKOC 4M75B 1Q95G 4L59A 3RDVA 1UE9A 4J9CA 2R57A 4PJOA 1M90C 4A4KA 2VXFA 3FJ5A 2CP5A 2MI6A 1TG0A 4NL3A 1KC8C 2HD0A 1NPRA 1WI7A 2EJFA 1GBQA 4XU0A 5KYXB 1B34A 2HSPA 1X01A 4J83A 1CZ5A 4DOVA 1QWFA 3DLMA 1DJ7B 1BBZA 4IUQA 4BI3A 2LCCA 2EQMA 1NYGA 1KQ2A 2QEXA 2C06A 1ZQ1A 3J80E 2EPDA 1I8FA 2QA4T 1E6HA 5IXBA 2Q18X 3TIWA 4AFZC 5CAIA 3JCMX 5EPPA 2VGMA 1M1KC 1ZSGA 2DJQA 2QQ9A 2QDLA 3ZBDA 2LCLA 3O5ZA 2X4XA 5ECAA 2RHZA 3H9NA 2Q1DX 2GFAA 4M78G 1SG5A 1LNXA 4C0FA 1K73R 1GFCA 1LVKA 4M7DC 2QQBA 2YUQA 3RMSA 4JJDA 4M77A 4WCIA 3SWNB 2VWFA 2YXYA 1Q7YC 1AOJA 1WXUA 4BE0A 2BIVA 2GBQA 2LQ8A 3D7SB 1VQ9T 3PVQA 2ABLA 1VQNT 2L3QA 1VQMQ 2DA9A 3CCUQ 1D0YA 4F7UF 3HRSA 3ZJVA 3EG1A 3QJ6A 1KJWA 4OB1B 2HEQA 3I56A 4A4EA 3CCLA 4TVRA 4A63B 5GAMg 1BCMA 2DXTA 1NE8A 4DEXA 3UWNA 2FPDA 1QQJA 3VS1A 3G6EA 2CYZB 1Y96B 4QVDA 1HJDA 2WSEE 4DBFA 3HL8A 3QJYA 1YJNT 3M0PA 1QWEA 2RN8A 1FX7A 1N8RU 1TUCA 4IURA 1JJ2S 2LJ0A 4IIMA 2SRCA 2DTHA 1YJWQ 1R0BG 2MOXA 4VUBA 3OSSC 5CKFA 2QTVA 4M7AA 1H641 7AT1B 1R7RA 4C8QD 2FVUA 3CCMQ 1HD3A 4RCCA 1R8OB 1OU9A 2YRVA 4HVUA 4LNPA 2L3RA 2LQKA 3M4YA 3EHRA 1AD5A 3C4SA 1CR5A 4M78B 3HRUA 3CCVQ 1ZA2B 2KK4A 1O75A 2JTEA 4M75C 2LTOA 4HXJA 3CCET 5I22A 1YHQQ 4KBMB 1QKWA 1OZ3A 3C94A 3HTRA 4C92G 2X4JA 4PJOG 4FYYB 3V7CA 1D3BB 2GF7A 5GANh 4QKUA 3HU1A 3M57A 1ACMB 5CCAA 1U1SA 2OTLA 3HU2A 2NUTA 1LJOA 1NJIR 1AWJA 2Q1AX 2QI2A 4MZTA 4IUTA 3VKIA 4AG2C 2RJDA 3EH2A 1UHFA 3H0IA 1R77A 2DXUA 3CPWA 4PLIA 2DERA 1WLFA 3IQLA 2DD5A 4KRTA 2LC4A 4XTYA 3LYIA 2HZYA 2JS2A 4EMHA 2HAXA 4RTYA 1VQOA 3EG9A 1Q82R 3HP9A 4O5VA 2ESWA 3EH1A 4JUVA 1YWOA 3UA7A 1RAEB 1RAGB 3PVLA 3H0FA 3BY7A 4CQNA 2A36A 4A53A 1MMGA 2JTFA 2EW3A 4FYWB 1PHTA 2X3WD 5A0LA 2RF0A 1NLPC 1HSQA 3KFVA 4RTWA 2QXFA 1K76A 3VU3C 4J9EA 2YDLA 1JBMA 2P4RA 2V8JA 3QYHB 1VQ5A 1J3TA 4MDXA 2DD4A 2ZZDA 3VS4A 1YFNA 4AQ7A 2COWA 2YVLA 4JDSA 1AZEA 2AKLA 3SWNC 2ZPEB 3I35A 1UFFA 5FRNA 3CC7T 3V7SA 1EIFA 4JLGA 3SEMA 2RHUA 1PSFA 4ZN3A 4C92B 1TTHB 2J6OA 1VQKA 5GAMf 3Q1JA 2E5QA 2F69A 4JS5A 2A08A 5CIUA 1LPLA 1UTIA 2WSFE 3RNJA 3RUXA 5KE3A 4FSSA 2C0TA 2NLUA 3DB3A 1F1BB 2O88A 2KMTA 4ESRA 4DOWA 1VQ7A 1VQ6T 1X6OA 2K4YA 4C0GA 2VUBA 1YJ9A 9ATCB 5D6WA 1GFDA 4RKUE 3LLRA 1OOTA 2QA4Q 3CC2A 1G3TA 2XHCA 4EDUA 3EFOA 3OS2A 3EG0A 1KFZA 5AT1B 5LJ3j 2DTIA 4OMMA 5GMKj 2D6FA 4C0DC 4EMKA 1SRLA 1EZZB 2HBWA 3RKXA 1SEMA 3KUFA 1KK7A 1N8RC 5GANf 1UGSB 2JVVA 1YNZA 3PMTA 1MMAA 4M78C 4PJOF 2X35A 3VS7A 1AT1B 2EQKA 3E19A 4HVWA 1OPKA 3TQ7P 1VQ9Q 1JB0E 5D6XA 2CP6A 1VQNQ 2DILA 4JJBA 5KYXA 4J9FA 4J9BA 4M4ZA 4R56A 5C0MA 2QDYB 3QIIA 3LH0A 3CC4A 1WJQA 2QGGA 2P0KA 4C8QG 2COYA 5FW9A 4C5GA 1T3SA 2V1QA 1WYXA 1Q81U 2VYTA 2D0QB 3QHSA 4RTUA 2DYBA 2YHTA 3M0UA 3CMET 3QDRB 3C0CA 3AT1B 1YJNQ 1QVFA 3ZJUA 2OTJT 5GAN6 3FB9A 1S72T 1FMWA 4A4GA 2LVMA 3HFOA 3UATA 1RUWA 4M7DE 1UJYA 2DRKA 2CREA 1C0MA 2EQIA 4QW2A 4JRPA 4PFPA 2K3YA 3V7RA 2F2XA 2P0QA 1D1BA 2M0YA 2NUPA 4EMGA 5LJ5g 1PWTA 2PU9B 3L2VA 3DB4A 1V1CA 5CQXA 3QG1A 5GAOq 3CD6A 5GAN5 3OYKA 1VQ8A 5FU7B 2K5FA 2ROLA 2XMFA 4IIOA 3ZEHA 2QEXT 4FL6A 5GAMd 1W2BP 1VA7A 4WF2A 3CCEQ 4LE9A 5CVIA 3RMQA 4BY6B 4V2SA 1AHJB 3ZFJA 3FLGA 1H8KA 3C12A 3OYJA 2ATCB 2J6KA 2D9TA 2JM8A 1PSEA 2DO3A 2DLPA 3GLXA 4PJOC 3CQTA 3H41A 1CZ4A 4BE1A 3A8GB 2L3SA 3OYGA 4C8QB 2DJZA 2RI3A 2RH2A 2A7YA 4LDWA 5GAN3 2WSCE 3QKJA 4FIBA 4KDLA 2RK2A 2K6DA 2EAYA 3JCMJ 1KQSP 2E12A 1H92A 2PQWA 2YLBA 2VB6A 5GANd 2QK0A 5GJWB 3CBMA 3VUZA 1M2OA 4M7AF 2FRWA 5GAOm 3QWXX 1Y0MA 3J81E 4M75E 2LP5A 3GNGA 3I56T 4E6RA 2P0PA 2O4XA 4KUDK 2PZ1A 3CCLT 1KHIA 2E3IA 4N4GA 2QASA 3VUBA 3VYHB 3JCMQ 3G6ET 4OMOA 2RHYA 4AT1B 3T9NA 2KE9A 1OEBA 4ZGJB 4QQ6A 1M2VA 3S3MA 5LJ3e 3VS3A 3CC7Q 2P84A 1MV0B 5I21A 4BDYA 4BB7A 4UC4A 3HRTA 4X34A 2E4HA 4KDIA 2AK5A 4Z89A 2NYSA 3HSBA 4C8QF 3G71A 2HKNA 4F7UE 3VJPA 2LW6A 3WVDB 4OGEA 1T0JA 2DF6A 3L2QA 2HSEB 1I5OB 2DYIA 1WA7A 4RTVA 3WVEB 2PUKB 4F17A 2GGRA 2EYYA 2YRCA 2XDPA 2K3BA 5DLOA 1E7OA 1UECA 3QUIA 4J9HA 2GFUA 1WIEA 3LW5E 4C0ZA 3OYFA 3ME9A 2MM2A 2FHDA 2OI3A 4R0KA 4QQDA 1VQ6Q 2EGEA 3FEOA 4ATOA 5D7UA 1RLQC 3JB9I 1GCQA 2COZA 3M58A 1IHWA 3DLLA 1ZSZA 1N9RA 4FM4B 3EGDA 4KH0B 2MWOA 1QKXA 1NEGA 3CCSA 1UUEA 5CO7A 3U23A 1NPPA 4J6WA 5LJ5f 2OTLT 2DZCA 2DETA 3CCRA 1SF9A 2KEAA 1Q81C 2PTKA 1X43A 1TS9A 2RQUA 4B6MA 5KYYB 4L6V5 1KQSS 3NFCA 2X51A 5FU7C 5A2QE 1JXMA 1VQOT 2CT3A 4WTOB 2F2WA 1JJ2P 5DY9A 4BY6C 5C1BA 3CXCA 1K9MR 1O54A 2KXDA 3L2ZA 4PFZA 1UHCA 4RUGA 3LWIA 1SSFA 4CC4B 3THKA 4DA4A 4F7UB 4FYXB 4KGZB 4JZ3A 2IVWA 4XTVA 3FPUA 2HNIA 2JUFA 4D6WA 1YI2A 2K5LA 5CR2A 5CKEA 1P92A 1I81A 4M77D 2KRNA 3CMEQ 2YUPA 4C8QC 3SDZA 1VQ5T 4ZNXA 4JJNK 2OTJQ 3M56A 2RQWA 2CUBA 1S72Q 3CCJA 3CEYA 2FZCB 1QVGS 1GCPA 4XTZA 3JCMb 3CCUA 1C1AA 3OBWA 1BK2A 2E64A 4J5YA 1MMNA 3QDFA 1RLPC 2ZPIB 3VRYA 3JCMe 1QDNA 1UGVA 3FIFA 3RERA 2K2MA 3ZL7C 3G4SA 1ARKA 2CZ1B 4M78E 2A28A 1N27A 1B3QA 1VQKT 1KSWA 2KROA 1TUGB 4R55A 4JJCA 1PC0A 4ARIA 3E1SA 2MF2A 1Q86R 2DL5A 4BI8B 2X3XD 2R5MA 4KUIA 1ZUYA 4E7LA 3VYGA 4NS5A 5FLXE 1BI1A 3TSZA 2QEXQ 1NYFA 1MNDA 1K9AA 5HY6A 3EFRA 3E9FA 4HT9A 4GLMA 1QMCA 1VQ7T 1YN8A 1YJWA 1FYNA 1YITT 1YJ9T 3CC2T 3OS1A 1SHGA 5GAN4 2KGTA 2MMPA 2RB6A 3HU3A 4M7AD 3JV3A 2L5QA 3VV0A 3P8BB 1NG2A 3MP8A 4RTXA 5I2MA 3TSWA 4HVVA 1M30A 3OYIA 1K4US 2ZPGB 4K11A 2AIRB 3M0RA 1M3AA 2CSQA 3TREA 2VVKA 1TSFA 2OAWA 8ATCB 5GAMh 4Y91A 2RM4A 2LCSA 3MP6A 4OB0B 3MEVA 4E7HA 1WHKA 4OP0A 5LJ5d 2PVOB 2Y4XA 1PD0A 2FB7A 3J7AF 2CP3A 4FW1A 1X6BA 4C0DB 2O9SA 2EFIA 1H3ZA 4JS4A 3N5BB 1VQPA 2SEMA 5KYWB 1SHFA 1SRMA 3FC3A 2KVQG 1VUBA 2IG0A 4MZPA 3OS5A 3I56Q 3CC4T 1NZ9A 2MWPA 4DBRA 3CCLQ 1K9MU 2FO0A 1M4ZA 3RESA 2D0NA 1K0XA 1ABOA 3RR6A 3OYDA 3LGLA 3G6EQ 5DLQE 2RMOA 2K5IA 3F70A 4C92E 3EGXA 2MK5A 5FTMA 2OAUA 1Z9QA 4PJOE 2RQRA 1M8VA 4QQGA 2DXCA 3LWHA 5GAOr 1WZOA 3RIRA 3P8DA 2E5KA 3M4GA 4XU2A 4HCCA 5CK9A 2F5TX 5EG2A 2EQUA 2JMCA 5L23A 4PLLA 1IZ6A 4LUDA 4C5HA 1WHMA 3UPUA 4IKFA 2LNHB 2LT1A 1QCFA 4XTWA 1ABQA 2EJ9A 2CDTA 4J6YA 2DVEA 2PVDB 5GAOn 1K73U 3CD6T 1OX9A 4N0AC 3OW2S 1VQ8T 2G3RA 2B86A 3ZGZA 3M55A 3SD4A 4J7FA 5KYUA 2QQSA 1Q86U 4M7DA 1JQQA 1X27A 1OX8A 2DFUA 1MNEA 2RJFA 4NOYA 2O9VA 2Y4YA 3OA6A 3KXTA 1U5SA 1K8AR 3PE0A 3UDCA 1WHGA 2OTLQ 2BZXA 2DMOA 1V29B 2Q19X 1M1FA 1D1AA 4HKEA 4M77G 1PKSA 4QT7A 2RQVA 4E7KA 1BI3A 2M02A 3V8LA 1WGSA 1A0NB 2Z0WA 3MPUB 3NPFA 1KC8R 3HFNA 4Z8AA 4BD3A 5HKCA 1VQOQ 3QO3A 1W2BA 2MIOA 2E6ZA 4PJOB 1WFWA 2L0AA 5IT9E 2YUOA 2O01E 5FU6C 1WXBA 3PT9A 5IHKA 5FTLA 1X2KA 3OYEA 1E32A 3CCQA 4FSXA 3EGUA 1B34B 5GAMe 2WACA 3URGA 2JM9A 2DM1A 2HDAA 3OB9A 4KULA 2EJGA 3OYMA 2RJCA 5IN1A 1WHJA 3JB9H 1VQ5Q 3QBYA 1UGQB 2HQHA 1VYVA 3X26B 2DVJA 2F1LA 3CXCS 1PCXA 3A8HB 2BKDN 3I55A 3ULRB 2RNAA 4LN2A 2D8JA 1OULA 4M7AG 2DK3A 2FPEA 2KNBB 1I4K1 1M27C 5IH2A 3G71T 4M75A 2ZGWA 2RI5A 1NJIU 3GIBA 1VQKQ 4L5GA 4D8KA 2DL4A 2DXBA 1HK9A 3CMAA 2L2PA 2XI9A 2E6NA 3OYNA 5HCKA 3JRZA 3P8HA 4ELZC 4Q5WA 4EIKA 2JV2A 2LX7A 2JZ2A 4JLIA 1GL5A 3GF5A 4DBHA 5GANe 2DNUA 4M77B 2YLCA 5LJ3g 3A8LB 3GOXA 1VOMA 3LH5A 1Q82U 3RKYA 1VQ7Q 2RJEA 2ED0A 1T0HA 3QZ5B 1YITQ 1YJ9Q 5CD1A 4ELYC 1BYMA 2X4YA 3NTKA 4C8QE 1PKTA 3CC2Q 1NLOC 1AWXA 2XDDA 1G5VA 3CCST 2K2VA 1K9MC 4FU6A 2LZ6B 3QPHA 3CCRT 1BU1A 1ZA1B 3E2UA 2J06A 1N9SA 4RG8A 2Y90A 3UF4A 2KQWA 3GBQA 2DAQA 3L1AA 3LHDA 6AT1B 4LD6A 4ANJA 1QCOA 1N6AA 2XDBA 3WXMB 1NBEB 1FXXA 1VQ4A 4AS1A 5HK3A 2KYBA 1OI1A 2VXEA 2EYZA 3I5SA 4ZTFA 3V8JA 3I5RA 3JCMW 1M3BA 2QTXA 4GLKA 1VIFA 3OY9A 3MEWA 2E10A 2DX1A 4FT4A 3JB9D 2ZPHB 4E7SA 1YIJA 1KHCA 1OYXA 2V1RA 4LDXA 3SWNA 2XIDA 4M77F 2DL8A 3BDLA 4XQ3A 3CC4Q 2CT4A 5GMKl 1ZBXA 4M7AB 5LJ5h 3H6ZA 1PNJA 1KQ1A 3JCMc 3BE3A 1K73C 2DBMA 1YI2T 2F5KA 2K79A 4QVZA 4MDWA 4HCBA 4LUEA 3QWYA 1QP3A 2YUJA 1IGUA 1XOVA 1D0ZA 4PFOA 1Q86C 4OMNA 2QGFB 3HPWA 4ME7A 2JW4A 3CCJT 3S3OA 3AHUA 3OYHA 1JJ2A 3CCUT 1PD1A 3M0TA 1G83A 1Y96A 3FPTA 2NUTB 3G4ST 5CCXA 3BDUA 2FRYA 4F14A 2BE9B 2IIMA 2FG0A 1K1ZA 4B9WA 1FMKA 3CD6Q 1I07A 1IO6A 4CC3A 1VQ8Q 3JB9J 3LGFA 1MUZA 3M59A 3FJPA 4PK4A 2HMAA 3EG9B 5FROA 3TEEA 1FWZA 2GQVA 2CP7A 3CPWS 1XJWB 2EKOA 3BQBA 3PMIA 4HT8A 2ROTA 2LMJA 3JCMg 3UA6A 2VGNA 1VQLA 2ZAEA 2DIQA 3OYYA 4M78A 2EYXA 3INZA 1ZC1A 2HL3A 2JMAA 4BI4A 4PJNA 3EG3A 2RI2A 3NTHA 2V26A 1KD1R 1D3BA 1X6GA 5LJ3f 1YP5A 2DEUA 1UDLA 5FTKA 3TVTA 4DBQA 1VIEA 4M77C 4O6JA 1WQ7A 1QVGP 1K0SA 2PWYA 4CC7A 5AYFA 2J6FA 3ER0A 1FMVA 5CKBA 2E1HA 2E65A 3MEUA 1CKAA 3E9GA 3PIOA 1VQPT 1NJIC 1JRIA 1R0CB 2BZYA 2ED1A 2LNVA 3A1PA 2RQTA 4OF1A 2XU8A 3EFSA 3KBGA 2D1XA 2FYKA 5GAOp 2YSQA 4BE2A 1GRIA 3QXEB 3L2WA 2CZ7B 5CKHA 1Q82C 2DZ9A 4J8OA 4FT2A 2H3EB 3M5AA 2AZSA 4M7DF 1IRXA 2RPNA 2JOYA 1S3SA 2O31A 5J39A 4HCZA 4KGXB 3G71Q 4IUUA 5HK0A 5LJ5e 3EFOB 4EPCA 4F16A 3EG2A 2CGHA 1N8RR 5IHNA 1BI2A 4E7ZA 1RAIB 3L42A 1WX6A 2B8AA 4M7AC 2G6FX 4EMKB 2CP2A 4OMLA 1UGPB 2ZCFB 1N5ZA 2DRMA 1BKBA 3HKSA 3OBYA 3QC8A 2XD0A 2CH4A 4C92A 1XTDA 2VASA 4XTUA 2HL5C 2LRQA 3JB9G 2YRDA 3JCMP 4E2FB 1U1TA 2H8HA 3BW1A 1SSHA 2MYSA 1V76A 5CKDA 1OPLA 5EC7A 2EYQA 3OQ5A 4AFQC 3CCSQ 1G3YA 2GTJA 3H0HA 2VV5A 4QVCA 4RV0A 5KCOA 1I0CA 3CCRQ 3OYAA 2W0ZA 2DE0X 5DYGA 1VQMA 1BIAA 1BIBA 2O2OA 2JT4A 1ZLMA 5ERGB 2QAZA 5J26A 2AHJB 1WQWA 2J7IA 1KD1U 1RL2A 3A98A 3JCMf 1WNLA 4LD9K 5LJ3d 4NL2A 2E41A 1W70A 4M75F 2PUOB 1OZ2A 2IPOB 4LDUA 1QVFS 4PJJA 1IXDA 2C0OA 3RKWA 3CCQT 4OMFB 5GAN2 4RG2A 4FW2A 2NUPB 4CC2A 1LCKA 1O9SA 1YI2Q 2A0FB 2QYZA 2HBPA 3R6OA 5GAMj 1M3CA 1Y07A 5FU6B 3OW2P 3MP1A 3VS2A 3NHNA 4CRIA 3CCJQ 3CPFA 3OSVA 3I55T 4KODA 1XQHA 3CCMA 1RABB 1Y7XA 2LX9A
chains in the Genus database with same CATH topology
5LJ5g 4EMGA 1CZ5A 3UT1A 3HFNA 4BD3A 4OB3B 2PU9B 3L2VA 5HKCA 2CS7A 2FL7A 3DB4A 5CQXA 4C92D 3QG1A 5GAOq 2PVGB 3CCVA 2PJHB 5FTJA 3QO3A 1W2BA 3CD6A 4PJOD 3A5ZB 5GAN5 3OYKA 1X75C 2E6ZA 4DQ2A 1VQ8A 4PJOB 1YHQA 5J3BA 5IT9E 1ZHIA 5FU7B 2K5FA 2O01E 5I2SA 2EQJA 5FU6C 3ZEHA 3GNFB 5A0GA 4J6XA 3PT9A 2EIFA 2QEXT 4FL6A 4PL6A 3X24B 3CMAT 1UEBA 5GAMd 3OYEA 1E32A 5FTLA 3CCQA 2M16A 4WF2A 4FSXA 5CVIA 3RMQA 4BY6B 1B34B 5A0DA 4V2SA 1AHJB 5GAMe 5M9OA 3ZFJA 2WACA 3PIPA 1K8AC 3CMEA 3M54A 3SFMA 3URGA 1M1GA 2CZ0B 2ZPBB 3FLGA 2OTJA 3OB9A 2K57A 2Q18X 4KULA 2RHIA 4Y28E 5GANj 1S72A 4KO8A 2EJGA 2XKOC 4M75B 3C12A 5KCHA 3DKMA 4L59A 2RJCA 4RMOA 5IN1A 3OYMA 4E47A 3OYJA 2D9TA 3JB9H 1QCSA 3QBYA 2R57A 4PJOA 1PSEA 1UGQB 2RA2A 2DO3A 3GLXA 3X26B 4A4KA 1M90C 2VXFA 4PJOC 3CXCS 3OS0A 1CZ4A 3A8HB 5CCBA 2MI6A 4BE1A 2BKDN 3A8GB 4NL3A 2CKKA 2HD0A 3I55A 1KC8C 1NPRA 3OYGA 3LX7A 4C8QB 2DJZA 2RI3A 2EJFA 4XU0A 1B34A 2O4XB 2DIGA 3TCJA 2RH2A 2DK3A 4M7AG 3FDRA 1WJSA 1X01A 4BUGA 4B9XA 2A7YA 2X4WA 2V8KA 4EMKC 1I4K1 4LDWA 4J83A 2WSCE 4DOVA 5GAN3 3QKJA 4FIBA 4X9CA 3DLMA 1DJ7B 3G71T 4OGCA 5GANg 4E7IA 4KDLA 2RK2A 4IUQA 4M75A 2RK1A 2ZGWA 2I2LA 2RI5A 3MHXA 1U8RA 1GXIE 4BI3A 2EAYA 3PNWC 1NJIU 2LCCA 1WJRA 3GIBA 3JCMJ 2EQMA 1VQ4T 2E12A 2CZ6B 2RO0A 4L5GA 1I5LA 2MM0A 1KQ2A 3JB9F 2QEXA 2PQWA 2DXBA 2YLBA 1HK9A 3CMAA 2C06A 5B6CA 4M7DD 2XI9A 2E6NA 5GANd 3OYNA 5FTNA 3CBMA 3JRZA 3P8HA 3VUZA 4Q5WA 4ELZC 5KH6A 2JV2A 1ZQ1A 4M7AF 3CD6T 2JZ2A 4JLIA 3J80E 5GAOm 3CBPA 3GF5A 5GANe 3QWZA 3J81E 4M75E 1I8FA 4A4HA 4C8QA 4M77B 3GNGA 3I56T 2YLCA 2P0PA 3A8LB 2O4XA 5LJ3g 3GOXA 4KUDK 2QA4T 4KT0E 3CCLT 2B25A 1Q82U 4PKCC 3RKYA 1KHIA 3M53A 2RJEA 4N4GA 2KSSA 5CAIA 3JCMX 4ZGDB 3TIWA 5EPPA 2VGMA 1M1KC 3QZ5B 4LDVA 2QQ9A 3VUBA 3A8OB 2M1HA 4CI0C 3MO8A 3VYHB 3ZBDA 4ELYC 3JCMQ 2LCLA 3G6ET 5CD1A 2RHYA 3JCMd 3T9NA 1BYMA 2X4YA 3NTKA 2X4XA 1QVPA 4C8QE 3QC8A 4ZGJB 2RHZA 4QQ6A 2XDDA 5LJ3e 3S3MA 1G5VA 2Q1DX 4XTXA 1IREB 4II1A 4A4FA 2GFAA 4M78G 3CCST 1LNXA 4C0FA 5I21A 2K2VA 2E70A 1K9MC 4FU6A 4BDYA 4BB7A 4M7DC 1M5Q1 3JAME 3QPHA 2QQBA 4UC4A 3HRTA 1G3SA 3CCRT 3MB5A 4X34A 4RG8A 1N9SA 4KDIA 2Y90A 3RMSA 4C5IA 4M77A 2XG8D 2KQWA 3SWNB 3META 3HSBA 4C8QF 3G71A 2DAQA 3L1AA 4F7UE 3LHDA 2JTMA 1BI0A 4LD6A 3VJPA 1Q7YC 2LW6A 4BE0A 3WVDB 1N6AA 2BIVA 5D6YA 2XDBA 3WXMB 4OGEA 1FXXA 2P4TA 2LQ8A 3L2QA 1VQ4A 4AS1A 5HK3A 1VQ9T 3WVEB 2PUKB 1OI1A 2VXEA 4M78F 1MGQA 2XDPA 1VQNT 5DLOA 5GLFA 4M77E 4E7JA 2M9UA 3QUIA 2GFUA 3LW5E 4ZTFA 3V8JA 4C0ZA 4F7UF 3HRSA 3ZJVA 3JCMW 3QJ6A 3OYFA 3ME9A 2QTXA 2MM2A 2FHDA 4GLKA 4OB1B 2HQEA 3I56A 1VIFA 3MEAA 4A4EA 3OY9A 3MEWA 2E10A 4A54A 4XK8E 4QQDA 4FT4A 2QA4A 2DPPB 3JB9D 2ZPHB 4TVRA 5KE2A 1YIJA 3CCLA 1KHCA 2GCXA 1OYXA 5GAMg 4LDXA 2VC8A 3SWNA 2XIDA 2DXTA 3FEOA 3O8VA 4M77F 4XAXB 1NE8A 4ATOA 3BDLA 2RHXA 3UWNA 4XQ3A 3JB9I 5GMKl 1ZBXA 3M58A 4M7AB 3G6EA 3DLLA 2CYZB 3H6ZA 5LJ5h 1N9RA 1KQ1A 1Y96B 4QVDA 3JCMc 4FM4B 1K73C 1KD1C 2WSEE 2MWOA 3HL8A 2F5KA 3QJYA 1YI2T 4QVZA 1YJNT 4ZGEB 3CCSA 4MDWA 5CO7A 1FX7A 3GP8A 1N8RU 1NPPA 4HCBA 3CBOA 1QP3A 4J6WA 5LJ5f 2OTLT 4IURA 2DZCA 1JJ2S 2YUJA 3CCRA 3L2RA 2R5AA 4M75D 1XOVA 1Q81C 1VQLT 1Q86C 1QW1A 3CF2A 3HPWA 2KY9A 4JRQA 4ME7A 3CCJT 2DTHA 3QSUA 2LT4A 3S3OA 3AHUA 4L6V5 3OYHA 1JJ2A 4JRKA 4VUBA 3CCUT 1KQSS 1VQ9A 5DYIA 4ARCA 3OSSC 5CKFA 3NFCA 4M7AA 3BFMA 1H641 5FU7C 1VQNA 1Y96A 5A2QE 3H8ZA 1R7RA 4C8QD 1VQOT 1UGRB 3FPTA 2FVUA 3G4ST 2JNGA 4RCCA 5CCXA 3BDUA 5DY9A 1KQSA 1R8OB 4BY6C 3FRNA 2YRVA 2M0OA 5C1BA 3CXCA 1YITA 2L3RA 2LQKA 3L2ZA 1O54A 4MMLA 2DTOA 2R58A 3M4YA 4B9WA 4M7AE 3C4SA 1CR5A 4M78B 3HRUA 3LWIA 1SSFA 2ZPFB 2KK4A 4GY5A 3ZJTA 1YBYA 1O75A 4M75C 2LTOA 3JB9J 3LGFA 4DA4A 3CCET 4F7UB 4KBMB 1OZ3A 3C94A 3M59A 3QYGB 3FJPA 4C92G 2IVWA 4XTVA 2XD0A 3FPUA 2HNIA 2JUFA 4D6WA 2X4JA 4PJOG 1YI2A 3X20B 3V7CA 5L8RE 3TEEA 5FROA 1YJNA 1WPYA 3QQ8A 1D3BB 1FWZA 2GQVA 2K5LA 5CR2A 5CKEA 2GF7A 5GANh 1P92A 1I81A 2EWNA 4P5NA 3CPWS 3HU1A 2EKOA 3BQBA 4M77D 2A3LA 3M57A 5CCAA 1U1SA 2OTLA 3HU2A 1LJOA 3PMIA 4C8QC 2Q1AX 4BDZA 4HT8A 3SDZA 2QI2A 5GAN7 1VQ5T 3JCMg 1VQLA 2VGNA 4JJNK 4MZTA 4IUTA 3M56A 3VKIA 2RJDA 2DIQA 3OYYA 2DXUA 3CCJA 3CEYA 3CPWA 4PLIA 4M78A 4C92F 1QVGS 4XTZA 3INZA 1WLFA 1ZC1A 3JCMb 3CCUA 2DD5A 4BI4A 3OBWA 2E64A 4F7UA 4J5YA 5LJ3h 2LC4A 5GMKh 2ZPIB 4XTYA 3LYIA 3JCMV 3OMCA 4EMHA 3JCMe 2RI2A 2HAXA 1VQOA 1QDNA 3NTHA 3FIFA 3HP9A 4O5VA 1QVGA 3RERA 1KG1A 1D3BA 3G4SA 4JUVA 2CZ1B 2V8IA 4M78E 4N0AA 5LJ3f 1N27A 4C5EA 3PTAA 1VQKT 3BY7A 5FTKA 1VIEA 4M77C 4O6JA 5LL6S 4CQNA 3QZ9B 4R55A 1WQ7A 4A53A 1K8AU 2JTFA 4IUVA 4ARIA 3CCEA 2PWYA 3E1SA 2BUDA 2MF2A 3G7ZA 5AYFA 5A0LA 4BI8B 2R5MA 4KUIA 4E7LA 3ER0A 3VYGA 5LJ5j 4NS5A 5CKBA 5FLXE 1BI1A 2E1HA 2E65A 3MEUA 3E9GA 3PIOA 1VQPT 2L8DA 1UB4A 5HY6A 1NJIC 3EFRA 5EQJB 3E9FA 3L2UA 1JRIA 4HT9A 2K3XA 1VQ7T 3S6WA 2QXFA 1M90U 2LNVA 4KLNA 3HHTB 3VU3C 4HA8A 4M7DG 1JBMA 4OF1A 1YITT 2V8JA 2XU8A 3EFSA 3QYHB 1YJ9T 1YJWA 1XNIA 1KC8U 1VQ5A 3KBGA 2DD4A 4MDXA 3X28B 2FYKA 2ZZDA 3CC2T 3OS1A 4AQ7A 5GAN4 3C95A 2YVLA 2MMPA 2RB6A 4JDSA 5GAOp 3SWNC 3HU3A 2ZPEB 4M7AD 4BE2A 2L5QA 3VV0A 2MAMA 5FRNA 3CC7T 3QXEB 3V7SA 3P8BB 3L2WA 2CZ7B 5CKHA 3MP8A 5I2MA 1Q82C 2DZ9A 1EIFA 3OYIA 4J8OA 2ZPGB 4FT2A 4JLGA 3QQ7A 3M5AA 3TREA 5GAMh 2RHUA 4M7DF 4Y91A 2RM4A 1PSFA 3OYBA 3MCAB 5CQYA 3MP6A 4ZN3A 5GMKm 4OB0B 4C92B 3MEVA 2KDSA 2JOYA 4E7HA 1S3SA 4OP0A 5J39A 5LJ5d 3PFSA 4HCZA 1VQKA 2PVOB 2Y4XA 1G3WA 5GAMf 3Q1JA 4IUUA 2E5QA 3PGGA 2F69A 4JS5A 5HK0A 2FB7A 5CIUA 1QP2A 4XU1A 5LJ5e 2H3JA 1VQMT 2WSFE 4EPCA 3J7AF 2CGHA 4OB2B 2RD1A 5GMKi 3RUXA 5KE3A 1M9SA 1BI2A 4C0DB 3DB3A 2NLUA 3L42A 3ASKA 1TH7A 2B8AA 2EFIA 3M9QA 4M7AC 1H3ZA 4JS4A 1M1KU 3N5BB 4EMKB 1VQPA 2KMTA 1UGPB 2DKGA 2ZCFB 4DOWA 1YCYA 1VQ7A 1VQ6T 1X6OA 3OMGA 1BKBA 4J7IA 2K4YA 3HKSA 3FC3A 2KVQG 4N4HA 4Z02A 2VUBA 4C0GA 3OBYA 1YJ9A 1VUBA 5D6WA 2IG0A 4MZPA 3OS5A 4C92A 3CC4T 1NZ9A 2MWPA 4M78D 1XTDA 4RKUE 1W4SA 5C6SA 3LLRA 4ZTJA 3EAEA 4C92C 3CC2A 1K9MU 1M4ZA 4PNOA 1G3TA 3RESA 2XHCA 4MZMA 4XTUA 1YIJT 4EDUA 3CC7A 4MMKA 2LRQA 3OYDA 3LGAA 3LGLA 3JB9G 3JSCA 3OS2A 3JCMP 4ZN1A 1U1TA 5DLQE 3BW1A 5LJ3j 1Q7YU 2K5IA 2DTIA 3F70A 5CKDA 4C92E 5GMKj 5FTMA 2D6FA 2EYQA 3OQ5A 2OAUA 4C0DC 4EMKA 4PJOE 1G3YA 2VV5A 3RKXA 1M8VA 4QQGA 2DXCA 3X25B 3LWHA 4QVCA 1YJWT 5KCOA 4RV0A 5C18A 3FPRA 3KUFA 3OYAA 5GAOr 5GAOl 3RIRA 1N8RC 5GANf 1UGSB 2JVVA 3P8DA 4XU2A 3M4GA 4HCCA 5DYGA 5CK9A 3PMTA 1MHNA 2F5TX 1VQMA 5EG2A 2LDMA 4IUPA 3SB2A 4JRIA 1BIAA 4M78C 2EQUA 4PJOF 2X35A 4M7DB 4M75G 3A8MB 1BIBA 4PLLA 2EQKA 1IZ6A 3E19A 3CCMT 1JB0E 3UPUA 4C5HA 4IKFA 2HQXA 5D6XA 3JCMh 5ERGB 2DEQA 2LT1A 4X9DA 4XTWA 4R56A 1VQ6A 2EJ9A 5C0MA 5IAYA 5FRMA 2QDYB 2QQAA 4J6YA 5J26A 2DVEA 2JN0A 2AHJB 2PVDB 5GAOn 3CCVT 1WQWA 5DM7R 1K73U 1KD1U 3QIIA 1RL2A 3LH0A 4N0AC 3OW2S 1VQ8T 3JCMf 2G3RA 3S3NA 3CC4A 1WJQA 2P0KA 1WNLA 4C8QG 1Y71A 1YHQT 3GPLA 3M55A 4LD9K 5LJ3d 4NL2A 3ZGZA 2L89A 3SD4A 2E41A 4J7FA 4M75F 2PUOB 1OZ2A 3NTIA 4LDUA 4C5GA 1QVFS 2QQSA 3OYLA 5GMKe 3RKWA 3CCQT 1Q81U 4OMFB 5GAN2 4RCBA 3OYCA 4RG2A 2VYTA 3OW2A 2D0QB 1Q86U 4M7DA 1HXDA 2QQRA 3QHSA 2YHTA 1O9SA 3CMET 4YTLA 3QDRB 1I9GA 4F7UG 1QVFA 3ZJUA 2RJFA 4NOYA 4BACA 5GAN6 2HBPA 3R6OA 5GAMj 2OTJT 2Y4YA 3KXTA 1Y07A 3FB9A 3OA6A 1S72T 4A4GA 2LVMA 5FU6B 3UDCA 3MP1A 4OVAA 3HFOA 1V29B 2Q19X 2KAFA 1M1FA 4M7DE 2XICA 5GAN8 4HKEA 4M77G 4CRIA 1RI0A 4N4IA 3V8KA 4LDYA 1LOJA 4QW2A 4JRPA 3CPFA 3OSVA 3I55T 4E7KA 4KODA 2K3YA 1BI3A 1W2BS 2Q1CX 1XQHA 4XU3A 3V7RA 3TU4K 3V8LA 3CCMA 2XK0A 1WGSA 2P0QA 1Y7XA 2LX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF7 A;  4FU6 A;  4BDY A;  3UT1 A;  2EKO A;  4BD3 A;  4UC4 A;  3L2V A;  3OMG A;  4X34 A;  3PMI A;  3DB4 A;  4C5I A;  4BDZ A;  3FC3 A;  4N4H A;  3MET A;  4Z02 A;  2DAQ A;  5D6W A;  2IG0 A;  4IUT A;  5FRM A;  3OYK A;  2MWP A;  2RJD A;  4LD6 A;  2DIQ A;  5C6S A;  3LLR A;  4ZTJ A;  3EAE A;  4BE0 A;  2BIV A;  3CEY A;  5D6Y A;  2EQJ A;  4PLI A;  3ZEH A;  3L2Q A;  4FL6 A;  4PL6 A;  1OI1 A;  4EDU A;  3OYE A;  3OYD A;  2LRQ A;  2XDP A;  3LGL A;  2M16 A;  3OS2 A;  4E7J A;  2GFU A;  3LYI A;  4ZTF A;  3OMC A;  5M9O A;  2RI2 A;  3F70 A;  2WAC A;  3NTH A;  3QJ6 A;  3OYF A;  3OQ5 A;  3ME9 A;  1H3Z A;  2FHD A;  3FLG A;  2HQE A;  3OB9 A;  4A4E A;  3MEA A;  3OY9 A;  3MEW A;  2RHI A;  4QQG A;  4QQD A;  1N27 A;  5KCH A;  4L59 A;  2RJC A;  4C5E A;  5IN1 A;  5KE2 A;  5KCO A;  1KHC A;  3OYM A;  1OYX A;  3KUF A;  3OYA A;  3FEO A;  3OYJ A;  3O8V A;  2D9T A;  3P8D A;  2JTF A;  3BDL A;  2R57 A;  2RHX A;  3QBY A;  4IUV A;  3UWN A;  3PMT A;  1MHN A;  2LDM A;  2BUD A;  4IUP A;  3H6Z A;  2EQU A;  3OS0 A;  2X35 A;  2R5M A;  4BE1 A;  2BKD N;  4E7L A;  2CKK A;  2MWO A;  4NS5 A;  2EQK A;  2F5K A;  4PLL A;  3OYG A;  4QVZ A;  3MEU A;  3LX7 A;  3E9G A;  4C5H A;  4IKF A;  2L8D A;  2HQX A;  2RI3 A;  5D6X A;  2O4X B;  3E9F A;  2DIG A;  3L2U A;  2K3X A;  3S6W A;  4IUR A;  3FDR A;  1WJS A;  4B9X A;  5C0M A;  5IAY A;  3L2R A;  2X4W A;  5J26 A;  2R5A A;  3QKJ A;  3QII A;  3LH0 A;  3DLM A;  4E7I A;  1XNI A;  2G3R A;  3S3N A;  4IUQ A;  1WJQ A;  2P0K A;  2RI5 A;  3OS1 A;  3PNW C;  2L89 A;  2LCC A;  1WJR A;  3SD4 A;  2EQM A;  3S3O A;  4C5G A;  3NTI A;  1OZ2 A;  3OYH A;  2RO0 A;  2QQS A;  4BE2 A;  5FRN A;  2PQW A;  3L2W A;  3OYL A;  3MP8 A;  2E6N A;  3OYN A;  3OYC A;  4RG2 A;  2VYT A;  3H8Z A;  3P8H A;  3OYI A;  4Q5W A;  5KH6 A;  2QQR A;  2JZ2 A;  2RHU A;  4A4H A;  3OYB A;  2RJF A;  3MP6 A;  4BAC A;  2O4X A;  3GOX A;  2YRV A;  2M0O A;  3OA6 A;  3MEV A;  4A4G A;  2LVM A;  2L3R A;  4E7H A;  2R58 A;  2RJE A;  4N4G A;  3MP1 A;  3PFS A;  4HCZ A;  4OVA A;  3C4S A;  4B9W A;  5J39 A;  1SSF A;  3Q1J A;  2M1H A;  2E5Q A;  4GY5 A;  3MO8 A;  4IUU A;  5CIU A;  2LTO A;  3LGF A;  4CRI A;  2RHY A;  1RI0 A;  4N4I A;  2X4Y A;  3NTK A;  2X4X A;  1OZ3 A;  4QW2 A;  4E7K A;  2RHZ A;  4QQ6 A;  3S3M A;  2K3Y A;  1G5V A;  5KE3 A;  4II1 A;  4A4F A;  2GFA A;  3DB3 A;  2NLU A;  3L42 A;  3ASK A;  2B8A A;  3M9Q A;  2EFI A;  2XK0 A;  1WGS A;  5FRO A; 
#chains in the Genus database with same CATH topology
 1T3L A;  2HCK A;  1X2Q A;  2CS7 A;  2FL7 A;  1W1F A;  3CCV A;  5FTJ A;  1GBR A;  2MPX C;  3G4S Q;  4OMQ A;  1X75 C;  1AVZ C;  1PG5 B;  1YHQ A;  5J3B A;  1ZHI A;  2EQJ A;  2QG9 B;  3GNF B;  4J6X A;  2EIF A;  3X24 B;  2EKH A;  1UEB A;  3CMA T;  1TOV A;  1PM3 A;  2FZK B;  5A0D A;  1IGQ A;  3PIP A;  4HCK A;  3M54 A;  2K57 A;  2RHI A;  5GAN j;  5KCH A;  4RMO A;  3DKM A;  4E47 A;  1QCS A;  2RA2 A;  3OS0 A;  5CCB A;  2CKK A;  2KR3 A;  3LX7 A;  4DEY A;  2KT8 A;  2DBK A;  1U06 A;  1AWW A;  2O4X B;  2JXB A;  2DIG A;  4J9G A;  3TCJ A;  2EYW A;  3FDR A;  1WJS A;  4BUG A;  4B9X A;  1QCN A;  2X4W A;  2V8K A;  4EMK C;  2C0I A;  2MCN A;  4X9C A;  4E7I A;  4Y92 A;  1MMD A;  4OGC A;  5GAN g;  2RK1 A;  2I2L A;  3MHX A;  1GXI E;  1U8R A;  3PNW C;  1WJR A;  4FYV B;  1ZUU A;  1VQ4 T;  1M2V B;  2CZ6 B;  2EGA A;  2RO0 A;  2YWW A;  3CXC P;  1I5L A;  3JB9 F;  2MM0 A;  5B6C A;  4M7D D;  5FTN A;  3NMZ C;  1RAA B;  5KH6 A;  3QWZ A;  3CBP A;  1S1N A;  4A4H A;  4C8Q A;  1VQP Q;  4KT0 E;  1WLP B;  1OV3 A;  2B25 A;  4PKC C;  1YIJ T;  3M53 A;  2AZV A;  2KSS A;  4LXC A;  4ZGD B;  2BE7 D;  4LDV A;  2HKQ B;  3A8O B;  2M1H A;  4CI0 C;  3MO8 A;  2FEI A;  1PRL C;  3JCM d;  1QVP A;  3I9Q A;  4XTX A;  5FWC A;  1IRE B;  4II1 A;  1EFN A;  4A4F A;  2JJ9 A;  2LJ3 A;  2E70 A;  3VRZ A;  1RAH B;  1M5Q 1;  3JAM E;  1UG1 A;  1G3S A;  3MB5 A;  5IHI A;  1TU0 B;  4C5I A;  2XG8 D;  2GNC A;  3MET A;  3NGP A;  2JTM A;  1BI0 A;  4AMC A;  2VKN A;  1ZBJ A;  5D6Y A;  1Q81 R;  1ZSZ B;  2P4T A;  1NEB A;  3EGD B;  2J05 A;  1AEY A;  4M78 F;  1MGQ A;  1ZX6 A;  1RAF B;  5GLF A;  1D09 B;  2LQN A;  2M9U A;  4M77 E;  4E7J A;  1OQK A;  1M90 R;  3G1J A;  4AG1 C;  2D8H A;  2K9G A;  2HQE A;  2A37 A;  3MEA A;  4A54 A;  2EBP A;  2PNI A;  4XK8 E;  4F04 B;  2QA4 A;  2DPP B;  1B07 A;  5KE2 A;  5I11 A;  2GCX A;  2VC8 A;  1AWO A;  3O8V A;  2M51 A;  4XAX B;  2RHX A;  2JS0 A;  1TUD A;  4OMP A;  1KD1 C;  1TXQ A;  1CSK A;  4ZGE B;  1U3O A;  1WXT A;  3GP8 A;  1AZG B;  1G8X A;  3CBO A;  2GQI A;  1YCS B;  3L2R A;  1IHV A;  2R5A A;  4M75 D;  1VQL T;  1QW1 A;  3CF2 A;  2KY9 A;  4JRQ A;  3QSU A;  2EVR A;  2LT4 A;  3VS0 A;  4ARC A;  4JRK A;  5DYI A;  2GTO A;  1VQ9 A;  1M1K R;  1WDX A;  1TWB A;  3BFM A;  1BB9 A;  1VQN A;  1OU8 A;  3H8Z A;  1UGR B;  2NUZ A;  2JNG A;  1KQS A;  3FRN A;  2M0O A;  1YIT A;  4MML A;  2DTO A;  2R58 A;  4M7A E;  1D1C A;  3RBB B;  1B7T A;  2ZPF B;  1MV3 A;  4GY5 A;  3ZJT A;  1IB8 A;  1YBY A;  5KYY A;  3QYG B;  1Q7Y R;  1JXO A;  1VYU A;  3X20 B;  1YJN A;  5L8R E;  3QQ8 A;  1WPY A;  3CCQ Q;  2EWN A;  4P5N A;  1H3H A;  2A3L A;  5GJV B;  4BDZ A;  5GAN 7;  1Y57 A;  2X9H A;  1KIK A;  1SPK A;  4C92 F;  3SHW A;  4F7U A;  5LJ3 h;  5GMK h;  1JEG A;  3JCM V;  1WHL A;  4Z88 A;  3OMC A;  3I55 Q;  2AKK A;  3CPW P;  4J9I A;  1M8M A;  1KG1 A;  1ZUK A;  1QVG A;  2ECZ A;  2V8I A;  4N0A A;  2OX7 A;  2KRS A;  1WHH A;  4C5E A;  3PTA A;  5LL6 S;  3QZ9 B;  4RTT A;  1K8A U;  4IUV A;  3CCE A;  2BUD A;  3G7Z A;  2DL7 A;  2YUN A;  5LJ5 j;  3CMA Q;  2L8D A;  1UB4 A;  5EQJ B;  1RI9 A;  3L2U A;  2K3X A;  3S6W A;  1M90 U;  4KLN A;  3HHT B;  1W6X A;  4HA8 A;  4M7D G;  3REB B;  1KC8 U;  1I1J A;  1XNI A;  1QLY A;  3X28 B;  3C95 A;  2CSI A;  4AFU C;  1Z9Z A;  2MAM A;  4JZ4 A;  2YT6 A;  4JPB W;  4X1V A;  1GCQ C;  1ZSZ C;  2AT1 B;  2KYM A;  1EX4 A;  3QQ7 A;  3OYB A;  3MCA B;  5CQY A;  5GMK m;  3MJX A;  2EGC A;  2KDS A;  1CKB A;  3PFS A;  1G3W A;  3EHQ A;  3PGG A;  1QP2 A;  4XU1 A;  1VQM T;  2H3J A;  1JU5 C;  4OB2 B;  2RD1 A;  5GMK i;  1VQ4 Q;  1M9S A;  3EGX B;  3ASK A;  1TH7 A;  3M9Q A;  1M1K U;  1UJ0 A;  4D8D A;  1HYO A;  2DKG A;  1YCY A;  3OMG A;  2ENM A;  4J7I A;  4N4H A;  4Z02 A;  2FPF A;  5FRM A;  4M78 D;  5C6S A;  1W4S A;  4ZTJ A;  1C6V X;  2KXC A;  3EAE A;  4C92 C;  2I0N A;  2KI7 A;  1YIJ Q;  4PNO A;  3R6N A;  2OJ2 A;  2CP0 A;  4MZM A;  3CC7 A;  4MMK A;  3LGA A;  3JSC A;  1PRM C;  4PJM A;  4ZN1 A;  4GBQ A;  1Q7Y U;  4RTZ A;  5FWB A;  1JO8 A;  1RAC B;  2E3H A;  4KH1 B;  3X25 B;  5KYW A;  1YJW T;  5C18 A;  1RAD B;  3FPR A;  5KYU B;  5GAO l;  3M0S A;  1MHN A;  2LDM A;  4IUP A;  3SB2 A;  5IXF A;  4JRI A;  2L3P A;  4M7D B;  4M75 G;  4ORZ A;  3A8M B;  3CCM T;  2KBT A;  2W10 A;  1D0X A;  2HQX A;  3JCM h;  1VYT A;  2DEQ A;  4X9D A;  1VQ6 A;  5IAY A;  2QQA A;  3CCV T;  2JN0 A;  5DM7 R;  3S3N A;  1YHQ T;  1Y71 A;  3GPL A;  2L89 A;  3REA B;  3NTI A;  3OYL A;  5GMK e;  2FZG B;  2BTT A;  4RCB A;  3OYC A;  3OW2 A;  1SKU B;  1E6G A;  1HXD A;  2QQR A;  4FCY A;  4YTL A;  1YWP A;  1I9G A;  5KYN A;  2CUD A;  4F7U G;  4BAC A;  4J9D A;  4OVA A;  2KAF A;  1X69 A;  2KRM A;  1VQL Q;  1QVF P;  2XIC A;  5GAN 8;  1RI0 A;  4N4I A;  3V8K A;  4LDY A;  1LOJ A;  1W2B S;  2Q1C X;  4XU3 A;  3MKD A;  3TU4 K;  2LJ1 A;  2XK0 A;  2CH4 W;  2LQW A;  2BZ8 A;  3UT1 A;  1BCO A;  4OB3 B;  4C92 D;  2PVG B;  2PJH B;  1G2B A;  4PJO D;  3A5Z B;  4PJL A;  4DQ2 A;  2KT1 A;  5I2S A;  3M0Q A;  3VS6 A;  5A0G A;  1NM7 A;  4PL6 A;  8AT1 B;  2M16 A;  4KGV B;  2K7A A;  5M9O A;  2DL3 A;  1K8A C;  2NWM A;  3CME A;  3SFM A;  4AFS C;  1M1G A;  2CZ0 B;  2ZPB B;  3VS5 A;  2OTJ A;  2F2V A;  4Y28 E;  1S72 A;  4KO8 A;  2XKO C;  4M75 B;  1Q95 G;  4L59 A;  3RDV A;  1UE9 A;  4J9C A;  2R57 A;  4PJO A;  1M90 C;  4A4K A;  2VXF A;  3FJ5 A;  2CP5 A;  2MI6 A;  1TG0 A;  4NL3 A;  1KC8 C;  2HD0 A;  1NPR A;  1WI7 A;  2EJF A;  1GBQ A;  4XU0 A;  5KYX B;  1B34 A;  2HSP A;  1X01 A;  4J83 A;  1CZ5 A;  4DOV A;  1QWF A;  3DLM A;  1DJ7 B;  1BBZ A;  4IUQ A;  4BI3 A;  2LCC A;  2EQM A;  1NYG A;  1KQ2 A;  2QEX A;  2C06 A;  1ZQ1 A;  3J80 E;  2EPD A;  1I8F A;  2QA4 T;  1E6H A;  5IXB A;  2Q18 X;  3TIW A;  4AFZ C;  5CAI A;  3JCM X;  5EPP A;  2VGM A;  1M1K C;  1ZSG A;  2DJQ A;  2QQ9 A;  2QDL A;  3ZBD A;  2LCL A;  3O5Z A;  2X4X A;  5ECA A;  2RHZ A;  3H9N A;  2Q1D X;  2GFA A;  4M78 G;  1SG5 A;  1LNX A;  4C0F A;  1K73 R;  1GFC A;  1LVK A;  4M7D C;  2QQB A;  2YUQ A;  3RMS A;  4JJD A;  4M77 A;  4WCI A;  3SWN B;  2VWF A;  2YXY A;  1Q7Y C;  1AOJ A;  1WXU A;  4BE0 A;  2BIV A;  2GBQ A;  2LQ8 A;  3D7S B;  1VQ9 T;  3PVQ A;  2ABL A;  1VQN T;  2L3Q A;  1VQM Q;  2DA9 A;  3CCU Q;  1D0Y A;  4F7U F;  3HRS A;  3ZJV A;  3EG1 A;  3QJ6 A;  1KJW A;  4OB1 B;  2HEQ A;  3I56 A;  4A4E A;  3CCL A;  4TVR A;  4A63 B;  5GAM g;  1BCM A;  2DXT A;  1NE8 A;  4DEX A;  3UWN A;  2FPD A;  1QQJ A;  3VS1 A;  3G6E A;  2CYZ B;  1Y96 B;  4QVD A;  1HJD A;  2WSE E;  4DBF A;  3HL8 A;  3QJY A;  1YJN T;  3M0P A;  1QWE A;  2RN8 A;  1FX7 A;  1N8R U;  1TUC A;  4IUR A;  1JJ2 S;  2LJ0 A;  4IIM A;  2SRC A;  2DTH A;  1YJW Q;  1R0B G;  2MOX A;  4VUB A;  3OSS C;  5CKF A;  2QTV A;  4M7A A;  1H64 1;  7AT1 B;  1R7R A;  4C8Q D;  2FVU A;  3CCM Q;  1HD3 A;  4RCC A;  1R8O B;  1OU9 A;  2YRV A;  4HVU A;  4LNP A;  2L3R A;  2LQK A;  3M4Y A;  3EHR A;  1AD5 A;  3C4S A;  1CR5 A;  4M78 B;  3HRU A;  3CCV Q;  1ZA2 B;  2KK4 A;  1O75 A;  2JTE A;  4M75 C;  2LTO A;  4HXJ A;  3CCE T;  5I22 A;  1YHQ Q;  4KBM B;  1QKW A;  1OZ3 A;  3C94 A;  3HTR A;  4C92 G;  2X4J A;  4PJO G;  4FYY B;  3V7C A;  1D3B B;  2GF7 A;  5GAN h;  4QKU A;  3HU1 A;  3M57 A;  1ACM B;  5CCA A;  1U1S A;  2OTL A;  3HU2 A;  2NUT A;  1LJO A;  1NJI R;  1AWJ A;  2Q1A X;  2QI2 A;  4MZT A;  4IUT A;  3VKI A;  4AG2 C;  2RJD A;  3EH2 A;  1UHF A;  3H0I A;  1R77 A;  2DXU A;  3CPW A;  4PLI A;  2DER A;  1WLF A;  3IQL A;  2DD5 A;  4KRT A;  2LC4 A;  4XTY A;  3LYI A;  2HZY A;  2JS2 A;  4EMH A;  2HAX A;  4RTY A;  1VQO A;  3EG9 A;  1Q82 R;  3HP9 A;  4O5V A;  2ESW A;  3EH1 A;  4JUV A;  1YWO A;  3UA7 A;  1RAE B;  1RAG B;  3PVL A;  3H0F A;  3BY7 A;  4CQN A;  2A36 A;  4A53 A;  1MMG A;  2JTF A;  2EW3 A;  4FYW B;  1PHT A;  2X3W D;  5A0L A;  2RF0 A;  1NLP C;  1HSQ A;  3KFV A;  4RTW A;  2QXF A;  1K76 A;  3VU3 C;  4J9E A;  2YDL A;  1JBM A;  2P4R A;  2V8J A;  3QYH B;  1VQ5 A;  1J3T A;  4MDX A;  2DD4 A;  2ZZD A;  3VS4 A;  1YFN A;  4AQ7 A;  2COW A;  2YVL A;  4JDS A;  1AZE A;  2AKL A;  3SWN C;  2ZPE B;  3I35 A;  1UFF A;  5FRN A;  3CC7 T;  3V7S A;  1EIF A;  4JLG A;  3SEM A;  2RHU A;  1PSF A;  4ZN3 A;  4C92 B;  1TTH B;  2J6O A;  1VQK A;  5GAM f;  3Q1J A;  2E5Q A;  2F69 A;  4JS5 A;  2A08 A;  5CIU A;  1LPL A;  1UTI A;  2WSF E;  3RNJ A;  3RUX A;  5KE3 A;  4FSS A;  2C0T A;  2NLU A;  3DB3 A;  1F1B B;  2O88 A;  2KMT A;  4ESR A;  4DOW A;  1VQ7 A;  1VQ6 T;  1X6O A;  2K4Y A;  4C0G A;  2VUB A;  1YJ9 A;  9ATC B;  5D6W A;  1GFD A;  4RKU E;  3LLR A;  1OOT A;  2QA4 Q;  3CC2 A;  1G3T A;  2XHC A;  4EDU A;  3EFO A;  3OS2 A;  3EG0 A;  1KFZ A;  5AT1 B;  5LJ3 j;  2DTI A;  4OMM A;  5GMK j;  2D6F A;  4C0D C;  4EMK A;  1SRL A;  1EZZ B;  2HBW A;  3RKX A;  1SEM A;  3KUF A;  1KK7 A;  1N8R C;  5GAN f;  1UGS B;  2JVV A;  1YNZ A;  3PMT A;  1MMA A;  4M78 C;  4PJO F;  2X35 A;  3VS7 A;  1AT1 B;  2EQK A;  3E19 A;  4HVW A;  1OPK A;  3TQ7 P;  1VQ9 Q;  1JB0 E;  5D6X A;  2CP6 A;  1VQN Q;  2DIL A;  4JJB A;  5KYX A;  4J9F A;  4J9B A;  4M4Z A;  4R56 A;  5C0M A;  2QDY B;  3QII A;  3LH0 A;  3CC4 A;  1WJQ A;  2QGG A;  2P0K A;  4C8Q G;  2COY A;  5FW9 A;  4C5G A;  1T3S A;  2V1Q A;  1WYX A;  1Q81 U;  2VYT A;  2D0Q B;  3QHS A;  4RTU A;  2DYB A;  2YHT A;  3M0U A;  3CME T;  3QDR B;  3C0C A;  3AT1 B;  1YJN Q;  1QVF A;  3ZJU A;  2OTJ T;  5GAN 6;  3FB9 A;  1S72 T;  1FMW A;  4A4G A;  2LVM A;  3HFO A;  3UAT A;  1RUW A;  4M7D E;  1UJY A;  2DRK A;  2CRE A;  1C0M A;  2EQI A;  4QW2 A;  4JRP A;  4PFP A;  2K3Y A;  3V7R A;  2F2X A;  2P0Q A;  1D1B A;  2M0Y A;  2NUP A;  4EMG A;  5LJ5 g;  1PWT A;  2PU9 B;  3L2V A;  3DB4 A;  1V1C A;  5CQX A;  3QG1 A;  5GAO q;  3CD6 A;  5GAN 5;  3OYK A;  1VQ8 A;  5FU7 B;  2K5F A;  2ROL A;  2XMF A;  4IIO A;  3ZEH A;  2QEX T;  4FL6 A;  5GAM d;  1W2B P;  1VA7 A;  4WF2 A;  3CCE Q;  4LE9 A;  5CVI A;  3RMQ A;  4BY6 B;  4V2S A;  1AHJ B;  3ZFJ A;  3FLG A;  1H8K A;  3C12 A;  3OYJ A;  2ATC B;  2J6K A;  2D9T A;  2JM8 A;  1PSE A;  2DO3 A;  2DLP A;  3GLX A;  4PJO C;  3CQT A;  3H41 A;  1CZ4 A;  4BE1 A;  3A8G B;  2L3S A;  3OYG A;  4C8Q B;  2DJZ A;  2RI3 A;  2RH2 A;  2A7Y A;  4LDW A;  5GAN 3;  2WSC E;  3QKJ A;  4FIB A;  4KDL A;  2RK2 A;  2K6D A;  2EAY A;  3JCM J;  1KQS P;  2E12 A;  1H92 A;  2PQW A;  2YLB A;  2VB6 A;  5GAN d;  2QK0 A;  5GJW B;  3CBM A;  3VUZ A;  1M2O A;  4M7A F;  2FRW A;  5GAO m;  3QWX X;  1Y0M A;  3J81 E;  4M75 E;  2LP5 A;  3GNG A;  3I56 T;  4E6R A;  2P0P A;  2O4X A;  4KUD K;  2PZ1 A;  3CCL T;  1KHI A;  2E3I A;  4N4G A;  2QAS A;  3VUB A;  3VYH B;  3JCM Q;  3G6E T;  4OMO A;  2RHY A;  4AT1 B;  3T9N A;  2KE9 A;  1OEB A;  4ZGJ B;  4QQ6 A;  1M2V A;  3S3M A;  5LJ3 e;  3VS3 A;  3CC7 Q;  2P84 A;  1MV0 B;  5I21 A;  4BDY A;  4BB7 A;  4UC4 A;  3HRT A;  4X34 A;  2E4H A;  4KDI A;  2AK5 A;  4Z89 A;  2NYS A;  3HSB A;  4C8Q F;  3G71 A;  2HKN A;  4F7U E;  3VJP A;  2LW6 A;  3WVD B;  4OGE A;  1T0J A;  2DF6 A;  3L2Q A;  2HSE B;  1I5O B;  2DYI A;  1WA7 A;  4RTV A;  3WVE B;  2PUK B;  4F17 A;  2GGR A;  2EYY A;  2YRC A;  2XDP A;  2K3B A;  5DLO A;  1E7O A;  1UEC A;  3QUI A;  4J9H A;  2GFU A;  1WIE A;  3LW5 E;  4C0Z A;  3OYF A;  3ME9 A;  2MM2 A;  2FHD A;  2OI3 A;  4R0K A;  4QQD A;  1VQ6 Q;  2EGE A;  3FEO A;  4ATO A;  5D7U A;  1RLQ C;  3JB9 I;  1GCQ A;  2COZ A;  3M58 A;  1IHW A;  3DLL A;  1ZSZ A;  1N9R A;  4FM4 B;  3EGD A;  4KH0 B;  2MWO A;  1QKX A;  1NEG A;  3CCS A;  1UUE A;  5CO7 A;  3U23 A;  1NPP A;  4J6W A;  5LJ5 f;  2OTL T;  2DZC A;  2DET A;  3CCR A;  1SF9 A;  2KEA A;  1Q81 C;  2PTK A;  1X43 A;  1TS9 A;  2RQU A;  4B6M A;  5KYY B;  4L6V 5;  1KQS S;  3NFC A;  2X51 A;  5FU7 C;  5A2Q E;  1JXM A;  1VQO T;  2CT3 A;  4WTO B;  2F2W A;  1JJ2 P;  5DY9 A;  4BY6 C;  5C1B A;  3CXC A;  1K9M R;  1O54 A;  2KXD A;  3L2Z A;  4PFZ A;  1UHC A;  4RUG A;  3LWI A;  1SSF A;  4CC4 B;  3THK A;  4DA4 A;  4F7U B;  4FYX B;  4KGZ B;  4JZ3 A;  2IVW A;  4XTV A;  3FPU A;  2HNI A;  2JUF A;  4D6W A;  1YI2 A;  2K5L A;  5CR2 A;  5CKE A;  1P92 A;  1I81 A;  4M77 D;  2KRN A;  3CME Q;  2YUP A;  4C8Q C;  3SDZ A;  1VQ5 T;  4ZNX A;  4JJN K;  2OTJ Q;  3M56 A;  2RQW A;  2CUB A;  1S72 Q;  3CCJ A;  3CEY A;  2FZC B;  1QVG S;  1GCP A;  4XTZ A;  3JCM b;  3CCU A;  1C1A A;  3OBW A;  1BK2 A;  2E64 A;  4J5Y A;  1MMN A;  3QDF A;  1RLP C;  2ZPI B;  3VRY A;  3JCM e;  1QDN A;  1UGV A;  3FIF A;  3RER A;  2K2M A;  3ZL7 C;  3G4S A;  1ARK A;  2CZ1 B;  4M78 E;  2A28 A;  1N27 A;  1B3Q A;  1VQK T;  1KSW A;  2KRO A;  1TUG B;  4R55 A;  4JJC A;  1PC0 A;  4ARI A;  3E1S A;  2MF2 A;  1Q86 R;  2DL5 A;  4BI8 B;  2X3X D;  2R5M A;  4KUI A;  1ZUY A;  4E7L A;  3VYG A;  4NS5 A;  5FLX E;  1BI1 A;  3TSZ A;  2QEX Q;  1NYF A;  1MND A;  1K9A A;  5HY6 A;  3EFR A;  3E9F A;  4HT9 A;  4GLM A;  1QMC A;  1VQ7 T;  1YN8 A;  1YJW A;  1FYN A;  1YIT T;  1YJ9 T;  3CC2 T;  3OS1 A;  1SHG A;  5GAN 4;  2KGT A;  2MMP A;  2RB6 A;  3HU3 A;  4M7A D;  3JV3 A;  2L5Q A;  3VV0 A;  3P8B B;  1NG2 A;  3MP8 A;  4RTX A;  5I2M A;  3TSW A;  4HVV A;  1M30 A;  3OYI A;  1K4U S;  2ZPG B;  4K11 A;  2AIR B;  3M0R A;  1M3A A;  2CSQ A;  3TRE A;  2VVK A;  1TSF A;  2OAW A;  8ATC B;  5GAM h;  4Y91 A;  2RM4 A;  2LCS A;  3MP6 A;  4OB0 B;  3MEV A;  4E7H A;  1WHK A;  4OP0 A;  5LJ5 d;  2PVO B;  2Y4X A;  1PD0 A;  2FB7 A;  3J7A F;  2CP3 A;  4FW1 A;  1X6B A;  4C0D B;  2O9S A;  2EFI A;  1H3Z A;  4JS4 A;  3N5B B;  1VQP A;  2SEM A;  5KYW B;  1SHF A;  1SRM A;  3FC3 A;  2KVQ G;  1VUB A;  2IG0 A;  4MZP A;  3OS5 A;  3I56 Q;  3CC4 T;  1NZ9 A;  2MWP A;  4DBR A;  3CCL Q;  1K9M U;  2FO0 A;  1M4Z A;  3RES A;  2D0N A;  1K0X A;  1ABO A;  3RR6 A;  3OYD A;  3LGL A;  3G6E Q;  5DLQ E;  2RMO A;  2K5I A;  3F70 A;  4C92 E;  3EGX A;  2MK5 A;  5FTM A;  2OAU A;  1Z9Q A;  4PJO E;  2RQR A;  1M8V A;  4QQG A;  2DXC A;  3LWH A;  5GAO r;  1WZO A;  3RIR A;  3P8D A;  2E5K A;  3M4G A;  4XU2 A;  4HCC A;  5CK9 A;  2F5T X;  5EG2 A;  2EQU A;  2JMC A;  5L23 A;  4PLL A;  1IZ6 A;  4LUD A;  4C5H A;  1WHM A;  3UPU A;  4IKF A;  2LNH B;  2LT1 A;  1QCF A;  4XTW A;  1ABQ A;  2EJ9 A;  2CDT A;  4J6Y A;  2DVE A;  2PVD B;  5GAO n;  1K73 U;  3CD6 T;  1OX9 A;  4N0A C;  3OW2 S;  1VQ8 T;  2G3R A;  2B86 A;  3ZGZ A;  3M55 A;  3SD4 A;  4J7F A;  5KYU A;  2QQS A;  1Q86 U;  4M7D A;  1JQQ A;  1X27 A;  1OX8 A;  2DFU A;  1MNE A;  2RJF A;  4NOY A;  2O9V A;  2Y4Y A;  3OA6 A;  3KXT A;  1U5S A;  1K8A R;  3PE0 A;  3UDC A;  1WHG A;  2OTL Q;  2BZX A;  2DMO A;  1V29 B;  2Q19 X;  1M1F A;  1D1A A;  4HKE A;  4M77 G;  1PKS A;  4QT7 A;  2RQV A;  4E7K A;  1BI3 A;  2M02 A;  3V8L A;  1WGS A;  1A0N B;  2Z0W A;  3MPU B;  3NPF A;  1KC8 R;  3HFN A;  4Z8A A;  4BD3 A;  5HKC A;  1VQO Q;  3QO3 A;  1W2B A;  2MIO A;  2E6Z A;  4PJO B;  1WFW A;  2L0A A;  5IT9 E;  2YUO A;  2O01 E;  5FU6 C;  1WXB A;  3PT9 A;  5IHK A;  5FTL A;  1X2K A;  3OYE A;  1E32 A;  3CCQ A;  4FSX A;  3EGU A;  1B34 B;  5GAM e;  2WAC A;  3URG A;  2JM9 A;  2DM1 A;  2HDA A;  3OB9 A;  4KUL A;  2EJG A;  3OYM A;  2RJC A;  5IN1 A;  1WHJ A;  3JB9 H;  1VQ5 Q;  3QBY A;  1UGQ B;  2HQH A;  1VYV A;  3X26 B;  2DVJ A;  2F1L A;  3CXC S;  1PCX A;  3A8H B;  2BKD N;  3I55 A;  3ULR B;  2RNA A;  4LN2 A;  2D8J A;  1OUL A;  4M7A G;  2DK3 A;  2FPE A;  2KNB B;  1I4K 1;  1M27 C;  5IH2 A;  3G71 T;  4M75 A;  2ZGW A;  2RI5 A;  1NJI U;  3GIB A;  1VQK Q;  4L5G A;  4D8K A;  2DL4 A;  2DXB A;  1HK9 A;  3CMA A;  2L2P A;  2XI9 A;  2E6N A;  3OYN A;  5HCK A;  3JRZ A;  3P8H A;  4ELZ C;  4Q5W A;  4EIK A;  2JV2 A;  2LX7 A;  2JZ2 A;  4JLI A;  1GL5 A;  3GF5 A;  4DBH A;  5GAN e;  2DNU A;  4M77 B;  2YLC A;  5LJ3 g;  3A8L B;  3GOX A;  1VOM A;  3LH5 A;  1Q82 U;  3RKY A;  1VQ7 Q;  2RJE A;  2ED0 A;  1T0H A;  3QZ5 B;  1YIT Q;  1YJ9 Q;  5CD1 A;  4ELY C;  1BYM A;  2X4Y A;  3NTK A;  4C8Q E;  1PKT A;  3CC2 Q;  1NLO C;  1AWX A;  2XDD A;  1G5V A;  3CCS T;  2K2V A;  1K9M C;  4FU6 A;  2LZ6 B;  3QPH A;  3CCR T;  1BU1 A;  1ZA1 B;  3E2U A;  2J06 A;  1N9S A;  4RG8 A;  2Y90 A;  3UF4 A;  2KQW A;  3GBQ A;  2DAQ A;  3L1A A;  3LHD A;  6AT1 B;  4LD6 A;  4ANJ A;  1QCO A;  1N6A A;  2XDB A;  3WXM B;  1NBE B;  1FXX A;  1VQ4 A;  4AS1 A;  5HK3 A;  2KYB A;  1OI1 A;  2VXE A;  2EYZ A;  3I5S A;  4ZTF A;  3V8J A;  3I5R A;  3JCM W;  1M3B A;  2QTX A;  4GLK A;  1VIF A;  3OY9 A;  3MEW A;  2E10 A;  2DX1 A;  4FT4 A;  3JB9 D;  2ZPH B;  4E7S A;  1YIJ A;  1KHC A;  1OYX A;  2V1R A;  4LDX A;  3SWN A;  2XID A;  4M77 F;  2DL8 A;  3BDL A;  4XQ3 A;  3CC4 Q;  2CT4 A;  5GMK l;  1ZBX A;  4M7A B;  5LJ5 h;  3H6Z A;  1PNJ A;  1KQ1 A;  3JCM c;  3BE3 A;  1K73 C;  2DBM A;  1YI2 T;  2F5K A;  2K79 A;  4QVZ A;  4MDW A;  4HCB A;  4LUE A;  3QWY A;  1QP3 A;  2YUJ A;  1IGU A;  1XOV A;  1D0Z A;  4PFO A;  1Q86 C;  4OMN A;  2QGF B;  3HPW A;  4ME7 A;  2JW4 A;  3CCJ T;  3S3O A;  3AHU A;  3OYH A;  1JJ2 A;  3CCU T;  1PD1 A;  3M0T A;  1G83 A;  1Y96 A;  3FPT A;  2NUT B;  3G4S T;  5CCX A;  3BDU A;  2FRY A;  4F14 A;  2BE9 B;  2IIM A;  2FG0 A;  1K1Z A;  4B9W A;  1FMK A;  3CD6 Q;  1I07 A;  1IO6 A;  4CC3 A;  1VQ8 Q;  3JB9 J;  3LGF A;  1MUZ A;  3M59 A;  3FJP A;  4PK4 A;  2HMA A;  3EG9 B;  5FRO A;  3TEE A;  1FWZ A;  2GQV A;  2CP7 A;  3CPW S;  1XJW B;  2EKO A;  3BQB A;  3PMI A;  4HT8 A;  2ROT A;  2LMJ A;  3JCM g;  3UA6 A;  2VGN A;  1VQL A;  2ZAE A;  2DIQ A;  3OYY A;  4M78 A;  2EYX A;  3INZ A;  1ZC1 A;  2HL3 A;  2JMA A;  4BI4 A;  4PJN A;  3EG3 A;  2RI2 A;  3NTH A;  2V26 A;  1KD1 R;  1D3B A;  1X6G A;  5LJ3 f;  1YP5 A;  2DEU A;  1UDL A;  5FTK A;  3TVT A;  4DBQ A;  1VIE A;  4M77 C;  4O6J A;  1WQ7 A;  1QVG P;  1K0S A;  2PWY A;  4CC7 A;  5AYF A;  2J6F A;  3ER0 A;  1FMV A;  5CKB A;  2E1H A;  2E65 A;  3MEU A;  1CKA A;  3E9G A;  3PIO A;  1VQP T;  1NJI C;  1JRI A;  1R0C B;  2BZY A;  2ED1 A;  2LNV A;  3A1P A;  2RQT A;  4OF1 A;  2XU8 A;  3EFS A;  3KBG A;  2D1X A;  2FYK A;  5GAO p;  2YSQ A;  4BE2 A;  1GRI A;  3QXE B;  3L2W A;  2CZ7 B;  5CKH A;  1Q82 C;  2DZ9 A;  4J8O A;  4FT2 A;  2H3E B;  3M5A A;  2AZS A;  4M7D F;  1IRX A;  2RPN A;  2JOY A;  1S3S A;  2O31 A;  5J39 A;  4HCZ A;  4KGX B;  3G71 Q;  4IUU A;  5HK0 A;  5LJ5 e;  3EFO B;  4EPC A;  4F16 A;  3EG2 A;  2CGH A;  1N8R R;  5IHN A;  1BI2 A;  4E7Z A;  1RAI B;  3L42 A;  1WX6 A;  2B8A A;  4M7A C;  2G6F X;  4EMK B;  2CP2 A;  4OML A;  1UGP B;  2ZCF B;  1N5Z A;  2DRM A;  1BKB A;  3HKS A;  3OBY A;  3QC8 A;  2XD0 A;  2CH4 A;  4C92 A;  1XTD A;  2VAS A;  4XTU A;  2HL5 C;  2LRQ A;  3JB9 G;  2YRD A;  3JCM P;  4E2F B;  1U1T A;  2H8H A;  3BW1 A;  1SSH A;  2MYS A;  1V76 A;  5CKD A;  1OPL A;  5EC7 A;  2EYQ A;  3OQ5 A;  4AFQ C;  3CCS Q;  1G3Y A;  2GTJ A;  3H0H A;  2VV5 A;  4QVC A;  4RV0 A;  5KCO A;  1I0C A;  3CCR Q;  3OYA A;  2W0Z A;  2DE0 X;  5DYG A;  1VQM A;  1BIA A;  1BIB A;  2O2O A;  2JT4 A;  1ZLM A;  5ERG B;  2QAZ A;  5J26 A;  2AHJ B;  1WQW A;  2J7I A;  1KD1 U;  1RL2 A;  3A98 A;  3JCM f;  1WNL A;  4LD9 K;  5LJ3 d;  4NL2 A;  2E41 A;  1W70 A;  4M75 F;  2PUO B;  1OZ2 A;  2IPO B;  4LDU A;  1QVF S;  4PJJ A;  1IXD A;  2C0O A;  3RKW A;  3CCQ T;  4OMF B;  5GAN 2;  4RG2 A;  4FW2 A;  2NUP B;  4CC2 A;  1LCK A;  1O9S A;  1YI2 Q;  2A0F B;  2QYZ A;  2HBP A;  3R6O A;  5GAM j;  1M3C A;  1Y07 A;  5FU6 B;  3OW2 P;  3MP1 A;  3VS2 A;  3NHN A;  4CRI A;  3CCJ Q;  3CPF A;  3OSV A;  3I55 T;  4KOD A;  1XQH A;  3CCM A;  1RAB B;  1Y7X A;  2LX9 A; 
#chains in the Genus database with same CATH homology
 5LJ5 g;  4EMG A;  1CZ5 A;  3UT1 A;  3HFN A;  4BD3 A;  4OB3 B;  2PU9 B;  3L2V A;  5HKC A;  2CS7 A;  2FL7 A;  3DB4 A;  5CQX A;  4C92 D;  3QG1 A;  5GAO q;  2PVG B;  3CCV A;  2PJH B;  5FTJ A;  3QO3 A;  1W2B A;  3CD6 A;  4PJO D;  3A5Z B;  5GAN 5;  3OYK A;  1X75 C;  2E6Z A;  4DQ2 A;  1VQ8 A;  4PJO B;  1YHQ A;  5J3B A;  5IT9 E;  1ZHI A;  5FU7 B;  2K5F A;  2O01 E;  5I2S A;  2EQJ A;  5FU6 C;  3ZEH A;  3GNF B;  5A0G A;  4J6X A;  3PT9 A;  2EIF A;  2QEX T;  4FL6 A;  4PL6 A;  3X24 B;  3CMA T;  1UEB A;  5GAM d;  3OYE A;  1E32 A;  5FTL A;  3CCQ A;  2M16 A;  4WF2 A;  4FSX A;  5CVI A;  3RMQ A;  4BY6 B;  1B34 B;  5A0D A;  4V2S A;  1AHJ B;  5GAM e;  5M9O A;  3ZFJ A;  2WAC A;  3PIP A;  1K8A C;  3CME A;  3M54 A;  3SFM A;  3URG A;  1M1G A;  2CZ0 B;  2ZPB B;  3FLG A;  2OTJ A;  3OB9 A;  2K57 A;  2Q18 X;  4KUL A;  2RHI A;  4Y28 E;  5GAN j;  1S72 A;  4KO8 A;  2EJG A;  2XKO C;  4M75 B;  3C12 A;  5KCH A;  3DKM A;  4L59 A;  2RJC A;  4RMO A;  5IN1 A;  3OYM A;  4E47 A;  3OYJ A;  2D9T A;  3JB9 H;  1QCS A;  3QBY A;  2R57 A;  4PJO A;  1PSE A;  1UGQ B;  2RA2 A;  2DO3 A;  3GLX A;  3X26 B;  4A4K A;  1M90 C;  2VXF A;  4PJO C;  3CXC S;  3OS0 A;  1CZ4 A;  3A8H B;  5CCB A;  2MI6 A;  4BE1 A;  2BKD N;  3A8G B;  4NL3 A;  2CKK A;  2HD0 A;  3I55 A;  1KC8 C;  1NPR A;  3OYG A;  3LX7 A;  4C8Q B;  2DJZ A;  2RI3 A;  2EJF A;  4XU0 A;  1B34 A;  2O4X B;  2DIG A;  3TCJ A;  2RH2 A;  2DK3 A;  4M7A G;  3FDR A;  1WJS A;  1X01 A;  4BUG A;  4B9X A;  2A7Y A;  2X4W A;  2V8K A;  4EMK C;  1I4K 1;  4LDW A;  4J83 A;  2WSC E;  4DOV A;  5GAN 3;  3QKJ A;  4FIB A;  4X9C A;  3DLM A;  1DJ7 B;  3G71 T;  4OGC A;  5GAN g;  4E7I A;  4KDL A;  2RK2 A;  4IUQ A;  4M75 A;  2RK1 A;  2ZGW A;  2I2L A;  2RI5 A;  3MHX A;  1U8R A;  1GXI E;  4BI3 A;  2EAY A;  3PNW C;  1NJI U;  2LCC A;  1WJR A;  3GIB A;  3JCM J;  2EQM A;  1VQ4 T;  2E12 A;  2CZ6 B;  2RO0 A;  4L5G A;  1I5L A;  2MM0 A;  1KQ2 A;  3JB9 F;  2QEX A;  2PQW A;  2DXB A;  2YLB A;  1HK9 A;  3CMA A;  2C06 A;  5B6C A;  4M7D D;  2XI9 A;  2E6N A;  5GAN d;  3OYN A;  5FTN A;  3CBM A;  3JRZ A;  3P8H A;  3VUZ A;  4Q5W A;  4ELZ C;  5KH6 A;  2JV2 A;  1ZQ1 A;  4M7A F;  3CD6 T;  2JZ2 A;  4JLI A;  3J80 E;  5GAO m;  3CBP A;  3GF5 A;  5GAN e;  3QWZ A;  3J81 E;  4M75 E;  1I8F A;  4A4H A;  4C8Q A;  4M77 B;  3GNG A;  3I56 T;  2YLC A;  2P0P A;  3A8L B;  2O4X A;  5LJ3 g;  3GOX A;  4KUD K;  2QA4 T;  4KT0 E;  3CCL T;  2B25 A;  1Q82 U;  4PKC C;  3RKY A;  1KHI A;  3M53 A;  2RJE A;  4N4G A;  2KSS A;  5CAI A;  3JCM X;  4ZGD B;  3TIW A;  5EPP A;  2VGM A;  1M1K C;  3QZ5 B;  4LDV A;  2QQ9 A;  3VUB A;  3A8O B;  2M1H A;  4CI0 C;  3MO8 A;  3VYH B;  3ZBD A;  4ELY C;  3JCM Q;  2LCL A;  3G6E T;  5CD1 A;  2RHY A;  3JCM d;  3T9N A;  1BYM A;  2X4Y A;  3NTK A;  2X4X A;  1QVP A;  4C8Q E;  3QC8 A;  4ZGJ B;  2RHZ A;  4QQ6 A;  2XDD A;  5LJ3 e;  3S3M A;  1G5V A;  2Q1D X;  4XTX A;  1IRE B;  4II1 A;  4A4F A;  2GFA A;  4M78 G;  3CCS T;  1LNX A;  4C0F A;  5I21 A;  2K2V A;  2E70 A;  1K9M C;  4FU6 A;  4BDY A;  4BB7 A;  4M7D C;  1M5Q 1;  3JAM E;  3QPH A;  2QQB A;  4UC4 A;  3HRT A;  1G3S A;  3CCR T;  3MB5 A;  4X34 A;  4RG8 A;  1N9S A;  4KDI A;  2Y90 A;  3RMS A;  4C5I A;  4M77 A;  2XG8 D;  2KQW A;  3SWN B;  3MET A;  3HSB A;  4C8Q F;  3G71 A;  2DAQ A;  3L1A A;  4F7U E;  3LHD A;  2JTM A;  1BI0 A;  4LD6 A;  3VJP A;  1Q7Y C;  2LW6 A;  4BE0 A;  3WVD B;  1N6A A;  2BIV A;  5D6Y A;  2XDB A;  3WXM B;  4OGE A;  1FXX A;  2P4T A;  2LQ8 A;  3L2Q A;  1VQ4 A;  4AS1 A;  5HK3 A;  1VQ9 T;  3WVE B;  2PUK B;  1OI1 A;  2VXE A;  4M78 F;  1MGQ A;  2XDP A;  1VQN T;  5DLO A;  5GLF A;  4M77 E;  4E7J A;  2M9U A;  3QUI A;  2GFU A;  3LW5 E;  4ZTF A;  3V8J A;  4C0Z A;  4F7U F;  3HRS A;  3ZJV A;  3JCM W;  3QJ6 A;  3OYF A;  3ME9 A;  2QTX A;  2MM2 A;  2FHD A;  4GLK A;  4OB1 B;  2HQE A;  3I56 A;  1VIF A;  3MEA A;  4A4E A;  3OY9 A;  3MEW A;  2E10 A;  4A54 A;  4XK8 E;  4QQD A;  4FT4 A;  2QA4 A;  2DPP B;  3JB9 D;  2ZPH B;  4TVR A;  5KE2 A;  1YIJ A;  3CCL A;  1KHC A;  2GCX A;  1OYX A;  5GAM g;  4LDX A;  2VC8 A;  3SWN A;  2XID A;  2DXT A;  3FEO A;  3O8V A;  4M77 F;  4XAX B;  1NE8 A;  4ATO A;  3BDL A;  2RHX A;  3UWN A;  4XQ3 A;  3JB9 I;  5GMK l;  1ZBX A;  3M58 A;  4M7A B;  3G6E A;  3DLL A;  2CYZ B;  3H6Z A;  5LJ5 h;  1N9R A;  1KQ1 A;  1Y96 B;  4QVD A;  3JCM c;  4FM4 B;  1K73 C;  1KD1 C;  2WSE E;  2MWO A;  3HL8 A;  2F5K A;  3QJY A;  1YI2 T;  4QVZ A;  1YJN T;  4ZGE B;  3CCS A;  4MDW A;  5CO7 A;  1FX7 A;  3GP8 A;  1N8R U;  1NPP A;  4HCB A;  3CBO A;  1QP3 A;  4J6W A;  5LJ5 f;  2OTL T;  4IUR A;  2DZC A;  1JJ2 S;  2YUJ A;  3CCR A;  3L2R A;  2R5A A;  4M75 D;  1XOV A;  1Q81 C;  1VQL T;  1Q86 C;  1QW1 A;  3CF2 A;  3HPW A;  2KY9 A;  4JRQ A;  4ME7 A;  3CCJ T;  2DTH A;  3QSU A;  2LT4 A;  3S3O A;  3AHU A;  4L6V 5;  3OYH A;  1JJ2 A;  4JRK A;  4VUB A;  3CCU T;  1KQS S;  1VQ9 A;  5DYI A;  4ARC A;  3OSS C;  5CKF A;  3NFC A;  4M7A A;  3BFM A;  1H64 1;  5FU7 C;  1VQN A;  1Y96 A;  5A2Q E;  3H8Z A;  1R7R A;  4C8Q D;  1VQO T;  1UGR B;  3FPT A;  2FVU A;  3G4S T;  2JNG A;  4RCC A;  5CCX A;  3BDU A;  5DY9 A;  1KQS A;  1R8O B;  4BY6 C;  3FRN A;  2YRV A;  2M0O A;  5C1B A;  3CXC A;  1YIT A;  2L3R A;  2LQK A;  3L2Z A;  1O54 A;  4MML A;  2DTO A;  2R58 A;  3M4Y A;  4B9W A;  4M7A E;  3C4S A;  1CR5 A;  4M78 B;  3HRU A;  3LWI A;  1SSF A;  2ZPF B;  2KK4 A;  4GY5 A;  3ZJT A;  1YBY A;  1O75 A;  4M75 C;  2LTO A;  3JB9 J;  3LGF A;  4DA4 A;  3CCE T;  4F7U B;  4KBM B;  1OZ3 A;  3C94 A;  3M59 A;  3QYG B;  3FJP A;  4C92 G;  2IVW A;  4XTV A;  2XD0 A;  3FPU A;  2HNI A;  2JUF A;  4D6W A;  2X4J A;  4PJO G;  1YI2 A;  3X20 B;  3V7C A;  5L8R E;  3TEE A;  5FRO A;  1YJN A;  1WPY A;  3QQ8 A;  1D3B B;  1FWZ A;  2GQV A;  2K5L A;  5CR2 A;  5CKE A;  2GF7 A;  5GAN h;  1P92 A;  1I81 A;  2EWN A;  4P5N A;  3CPW S;  3HU1 A;  2EKO A;  3BQB A;  4M77 D;  2A3L A;  3M57 A;  5CCA A;  1U1S A;  2OTL A;  3HU2 A;  1LJO A;  3PMI A;  4C8Q C;  2Q1A X;  4BDZ A;  4HT8 A;  3SDZ A;  2QI2 A;  5GAN 7;  1VQ5 T;  3JCM g;  1VQL A;  2VGN A;  4JJN K;  4MZT A;  4IUT A;  3M56 A;  3VKI A;  2RJD A;  2DIQ A;  3OYY A;  2DXU A;  3CCJ A;  3CEY A;  3CPW A;  4PLI A;  4M78 A;  4C92 F;  1QVG S;  4XTZ A;  3INZ A;  1WLF A;  1ZC1 A;  3JCM b;  3CCU A;  2DD5 A;  4BI4 A;  3OBW A;  2E64 A;  4F7U A;  4J5Y A;  5LJ3 h;  2LC4 A;  5GMK h;  2ZPI B;  4XTY A;  3LYI A;  3JCM V;  3OMC A;  4EMH A;  3JCM e;  2RI2 A;  2HAX A;  1VQO A;  1QDN A;  3NTH A;  3FIF A;  3HP9 A;  4O5V A;  1QVG A;  3RER A;  1KG1 A;  1D3B A;  3G4S A;  4JUV A;  2CZ1 B;  2V8I A;  4M78 E;  4N0A A;  5LJ3 f;  1N27 A;  4C5E A;  3PTA A;  1VQK T;  3BY7 A;  5FTK A;  1VIE A;  4M77 C;  4O6J A;  5LL6 S;  4CQN A;  3QZ9 B;  4R55 A;  1WQ7 A;  4A53 A;  1K8A U;  2JTF A;  4IUV A;  4ARI A;  3CCE A;  2PWY A;  3E1S A;  2BUD A;  2MF2 A;  3G7Z A;  5AYF A;  5A0L A;  4BI8 B;  2R5M A;  4KUI A;  4E7L A;  3ER0 A;  3VYG A;  5LJ5 j;  4NS5 A;  5CKB A;  5FLX E;  1BI1 A;  2E1H A;  2E65 A;  3MEU A;  3E9G A;  3PIO A;  1VQP T;  2L8D A;  1UB4 A;  5HY6 A;  1NJI C;  3EFR A;  5EQJ B;  3E9F A;  3L2U A;  1JRI A;  4HT9 A;  2K3X A;  1VQ7 T;  3S6W A;  2QXF A;  1M90 U;  2LNV A;  4KLN A;  3HHT B;  3VU3 C;  4HA8 A;  4M7D G;  1JBM A;  4OF1 A;  1YIT T;  2V8J A;  2XU8 A;  3EFS A;  3QYH B;  1YJ9 T;  1YJW A;  1XNI A;  1KC8 U;  1VQ5 A;  3KBG A;  2DD4 A;  4MDX A;  3X28 B;  2FYK A;  2ZZD A;  3CC2 T;  3OS1 A;  4AQ7 A;  5GAN 4;  3C95 A;  2YVL A;  2MMP A;  2RB6 A;  4JDS A;  5GAO p;  3SWN C;  3HU3 A;  2ZPE B;  4M7A D;  4BE2 A;  2L5Q A;  3VV0 A;  2MAM A;  5FRN A;  3CC7 T;  3QXE B;  3V7S A;  3P8B B;  3L2W A;  2CZ7 B;  5CKH A;  3MP8 A;  5I2M A;  1Q82 C;  2DZ9 A;  1EIF A;  3OYI A;  4J8O A;  2ZPG B;  4FT2 A;  4JLG A;  3QQ7 A;  3M5A A;  3TRE A;  5GAM h;  2RHU A;  4M7D F;  4Y91 A;  2RM4 A;  1PSF A;  3OYB A;  3MCA B;  5CQY A;  3MP6 A;  4ZN3 A;  5GMK m;  4OB0 B;  4C92 B;  3MEV A;  2KDS A;  2JOY A;  4E7H A;  1S3S A;  4OP0 A;  5J39 A;  5LJ5 d;  3PFS A;  4HCZ A;  1VQK A;  2PVO B;  2Y4X A;  1G3W A;  5GAM f;  3Q1J A;  4IUU A;  2E5Q A;  3PGG A;  2F69 A;  4JS5 A;  5HK0 A;  2FB7 A;  5CIU A;  1QP2 A;  4XU1 A;  5LJ5 e;  2H3J A;  1VQM T;  2WSF E;  4EPC A;  3J7A F;  2CGH A;  4OB2 B;  2RD1 A;  5GMK i;  3RUX A;  5KE3 A;  1M9S A;  1BI2 A;  4C0D B;  3DB3 A;  2NLU A;  3L42 A;  3ASK A;  1TH7 A;  2B8A A;  2EFI A;  3M9Q A;  4M7A C;  1H3Z A;  4JS4 A;  1M1K U;  3N5B B;  4EMK B;  1VQP A;  2KMT A;  1UGP B;  2DKG A;  2ZCF B;  4DOW A;  1YCY A;  1VQ7 A;  1VQ6 T;  1X6O A;  3OMG A;  1BKB A;  4J7I A;  2K4Y A;  3HKS A;  3FC3 A;  2KVQ G;  4N4H A;  4Z02 A;  2VUB A;  4C0G A;  3OBY A;  1YJ9 A;  1VUB A;  5D6W A;  2IG0 A;  4MZP A;  3OS5 A;  4C92 A;  3CC4 T;  1NZ9 A;  2MWP A;  4M78 D;  1XTD A;  4RKU E;  1W4S A;  5C6S A;  3LLR A;  4ZTJ A;  3EAE A;  4C92 C;  3CC2 A;  1K9M U;  1M4Z A;  4PNO A;  1G3T A;  3RES A;  2XHC A;  4MZM A;  4XTU A;  1YIJ T;  4EDU A;  3CC7 A;  4MMK A;  2LRQ A;  3OYD A;  3LGA A;  3LGL A;  3JB9 G;  3JSC A;  3OS2 A;  3JCM P;  4ZN1 A;  1U1T A;  5DLQ E;  3BW1 A;  5LJ3 j;  1Q7Y U;  2K5I A;  2DTI A;  3F70 A;  5CKD A;  4C92 E;  5GMK j;  5FTM A;  2D6F A;  2EYQ A;  3OQ5 A;  2OAU A;  4C0D C;  4EMK A;  4PJO E;  1G3Y A;  2VV5 A;  3RKX A;  1M8V A;  4QQG A;  2DXC A;  3X25 B;  3LWH A;  4QVC A;  1YJW T;  5KCO A;  4RV0 A;  5C18 A;  3FPR A;  3KUF A;  3OYA A;  5GAO r;  5GAO l;  3RIR A;  1N8R C;  5GAN f;  1UGS B;  2JVV A;  3P8D A;  4XU2 A;  3M4G A;  4HCC A;  5DYG A;  5CK9 A;  3PMT A;  1MHN A;  2F5T X;  1VQM A;  5EG2 A;  2LDM A;  4IUP A;  3SB2 A;  4JRI A;  1BIA A;  4M78 C;  2EQU A;  4PJO F;  2X35 A;  4M7D B;  4M75 G;  3A8M B;  1BIB A;  4PLL A;  2EQK A;  1IZ6 A;  3E19 A;  3CCM T;  1JB0 E;  3UPU A;  4C5H A;  4IKF A;  2HQX A;  5D6X A;  3JCM h;  5ERG B;  2DEQ A;  2LT1 A;  4X9D A;  4XTW A;  4R56 A;  1VQ6 A;  2EJ9 A;  5C0M A;  5IAY A;  5FRM A;  2QDY B;  2QQA A;  4J6Y A;  5J26 A;  2DVE A;  2JN0 A;  2AHJ B;  2PVD B;  5GAO n;  3CCV T;  1WQW A;  5DM7 R;  1K73 U;  1KD1 U;  3QII A;  1RL2 A;  3LH0 A;  4N0A C;  3OW2 S;  1VQ8 T;  3JCM f;  2G3R A;  3S3N A;  3CC4 A;  1WJQ A;  2P0K A;  1WNL A;  4C8Q G;  1Y71 A;  1YHQ T;  3GPL A;  3M55 A;  4LD9 K;  5LJ3 d;  4NL2 A;  3ZGZ A;  2L89 A;  3SD4 A;  2E41 A;  4J7F A;  4M75 F;  2PUO B;  1OZ2 A;  3NTI A;  4LDU A;  4C5G A;  1QVF S;  2QQS A;  3OYL A;  5GMK e;  3RKW A;  3CCQ T;  1Q81 U;  4OMF B;  5GAN 2;  4RCB A;  3OYC A;  4RG2 A;  2VYT A;  3OW2 A;  2D0Q B;  1Q86 U;  4M7D A;  1HXD A;  2QQR A;  3QHS A;  2YHT A;  1O9S A;  3CME T;  4YTL A;  3QDR B;  1I9G A;  4F7U G;  1QVF A;  3ZJU A;  2RJF A;  4NOY A;  4BAC A;  5GAN 6;  2HBP A;  3R6O A;  5GAM j;  2OTJ T;  2Y4Y A;  3KXT A;  1Y07 A;  3FB9 A;  3OA6 A;  1S72 T;  4A4G A;  2LVM A;  5FU6 B;  3UDC A;  3MP1 A;  4OVA A;  3HFO A;  1V29 B;  2Q19 X;  2KAF A;  1M1F A;  4M7D E;  2XIC A;  5GAN 8;  4HKE A;  4M77 G;  4CRI A;  1RI0 A;  4N4I A;  3V8K A;  4LDY A;  1LOJ A;  4QW2 A;  4JRP A;  3CPF A;  3OSV A;  3I55 T;  4E7K A;  4KOD A;  2K3Y A;  1BI3 A;  1W2B S;  2Q1C X;  1XQH A;  4XU3 A;  3V7R A;  3TU4 K;  3V8L A;  3CCM A;  2XK0 A;  1WGS A;  2P0Q A;  1Y7X A;  2LX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...