2GF7A

Double tudor domain structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
QSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of histone H3 lysine-4 methylation by the double tudor domain of JMJD2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
total genus 21
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2gf7A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2gf7A02
2QQSA 5FRNA 1OI1A 1OYXA 5KE3A 3ZEHA 3OYGA 1OZ3A 3OYLA 4PLIA 2PQWA 3QBYA 3L2WA 5D6WA 2EQMA 3FDRA 2NLUA 3O8VA 3OMCA 4NS5A 4C5HA 2EKOA 3GOXA 3S3MA 4BE1A 3H8ZA 4QW2A 4QQ6A 3MEVA 2L3RA 4IURA 2R5AA 4X34A 3FC3A 4BDYA 3CEYA 2L8DA 2RHYA 3LGLA 4FL6A 2VYTA 2X35A 4IUVA 2G3RA 3MEWA 2X4XA 2DAQA 2WACA 4LD6A 3P8DA 4QVZA 3UT1A 2EFIA 4Z02A 4ZTJA 5C6SA 1MHNA 3MEAA 3OY9A 3OYBA 2BIVA 3OQ5A 3OYNA 4E7IA 2RJCA 2E5QA 2XK0A 2EQKA 2EQJA 3OA6A 4C5EA 1OZ2A 2MWPA 3Q1JA 3QIIA 2HQXA 3OYMA 4ZTFA 4CRIA 4N4IA 3MP6A 2LTOA 2K3YA 3META 4BE0A 2RHZA 2LDMA 3DB4A 2CKKA 3ASKA 3NTHA 3OYKA 4EDUA 2P0KA 2FHDA 3PMIA 3BDLA 3MP8A 3SD4A 2R58A 3OYHA 3OYIA 3LLRA 5IN1A 1N27A 2MWOA 4IUTA 3DLMA 4IKFA 3LX7A 2M0OA 3LH0A 5J26A 4N4GA 2RHXA 3PNWC 3OYCA 4E7LA 3MO8A 3OYFA 4BACA 3OS1A 3OS0A 5FROA 3OYJA 2GF7A 5M9OA 3L2QA 3FLGA 2RI3A 4Q5WA 2LRQA 2RJFA 1XNIA 4QQDA 3PMTA 2LVMA 3FEOA 3EAEA 4B9XA 5CIUA 2RO0A 3L2RA 4RG2A 5KCHA 2BKDN 3P8HA 1H3ZA 4E7JA 2HQEA 3QKJA 4PLLA 4L59A 3E9GA 3NTKA 4BE2A 2O4XA 4E7HA 4BD3A 3L42A 2D9TA 2RJEA 2RI5A 4IUQA 1WJRA 4UC4A 2L89A 4GY5A 2K3XA 2B8AA 2JZ2A 4N4HA 4OVAA 4QQGA 4A4GA 3OS2A 1G5VA 3UWNA 4C5GA 2RHIA 4A4FA 2F5KA 2M1HA 1KHCA 2QQRA 3ME9A 2R57A 3OB9A 4IUPA 5D6XA 2X4WA 2DIQA 4II1A 3PFSA 3L2UA 5KCOA 3C4SA 3E9FA 4A4EA 2IG0A 2GFUA 3DB3A 3H6ZA 4IUUA 3OMGA 3OYEA 3LYIA 1RI0A 2R5MA 4B9WA 3S3OA 2DIGA 4PL6A 2GFAA 5IAYA 3MP1A 2EQUA 2E6NA 2O4XB 2RI2A 3M9QA 3KUFA 4HCZA 2RJDA 3MEUA 5KE2A 3S3NA 4C5IA 3F70A 2RHUA 2YRVA 1WJSA 4FU6A 3OYAA 5J39A 1WJQA 5D6YA 2JTFA 5KH6A 1WGSA 3QJ6A 4BDZA 1SSFA 2XDPA 3LGFA 2X4YA 2BUDA 5FRMA 5C0MA 4A4HA 2M16A 3L2VA 4E7KA 3OYDA 3NTIA 3S6WA 2LCCA
chains in the Genus database with same CATH superfamily
5KYYA 1PSFA 3ER0A 1K8AU 3S3MA 3ZJTA 1HJDA 2KGTA 1ZSZC 1SF9A 2QA4T 1M4ZA 2YUQA 3QXEB 2VYTA 2DF6A 2WSEE 2X4XA 2DAQA 3C95A 3MEAA 1T0JA 3QWYA 1A0NB 1WFWA 2JTMA 2DA9A 2DD4A 1VQ7T 3CCJQ 1E7OA 3V7CA 3JB9I 3TQ7P 1I1JA 1ZUUA 1YCSB 1TG0A 4E6RA 2L2PA 1YCYA 2PUOB 1BB9A 1ZQ1A 2RM4A 3CXCS 3OYIA 2FB7A 2R58A 2DTIA 2FZKB 1D1CA 3UA7A 3CCMA 4JUVA 4KUIA 1VQ9A 4KLNA 2QTXA 2V26A 3QHSA 4B9XA 1PD0A 3G6EQ 8ATCB 1MV3A 4AT1B 1K4US 3FJ5A 3M4GA 1AOJA 3CMEA 2QYZA 2VUBA 2VB6A 2E41A 1YITQ 2QG9B 1KHCA 2C06A 4HA8A 3V7RA 4JLIA 4JJNK 2X4WA 3LHDA 1M2OA 2DIQA 2DILA 3E9FA 3FRNA 3M0PA 2VXEA 3INZA 1NBEB 3V8KA 1QVGA 2DX1A 3CQTA 1NPPA 5GAN4 4ELYC 3CMET 4CC3A 1JBMA 3VUZA 3S3OA 1IHVA 2FVUA 2IVWA 3M9QA 3KUFA 4ZGJB 1U06A 4BI8B 1XJWB 1WJSA 1AWXA 1K8AC 4MZTA 3VYHB 1KQ2A 3VS1A 2MOXA 1N6AA 4JPBW 2DPPB 1MGQA 1I9GA 5I22A 1YHQQ 3PTAA 5FU7B 3OYLA 1TSFA 3HKSA 1TUGB 2EQMA 2VASA 3GOXA 4AFSC 2KROA 1TOVA 2ED1A 4HT9A 1TUDA 9ATCB 4GLMA 4IUVA 1UUEA 1JXMA 4C8QD 4JJCA 1C6VX 4M78G 1G3TA 4QVZA 4Z02A 3OQ5A 1UJYA 3JCMP 1M90R 2XK0A 5FLXE 2RQWA 3QIIA 2HQXA 4CRIA 1WIEA 1QCFA 2LTOA 3EFOA 3H41A 3JRZA 1AT1B 1YJWA 2COZA 2HSPA 2K7AA 1OQKA 4A54A 2J05A 2JTEA 3PNWC 1U1TA 3GP8A 4JDSA 1CR5A 2KY9A 2GNCA 3VKIA 3FEOA 2HKNA 4KGXB 4RTVA 4E7JA 3QKJA 4PJOF 2QA4Q 2CP2A 1WQ7A 1FYNA 3VS5A 3FPUA 2QQAA 1HD3A 1VQ4A 3JB9H 2E12A 2O01E 2K79A 5CCXA 3A98A 2Q1DX 1VQOA 4M78C 3EFOB 1RLPC 2K5FA 3QZ5B 1T3LA 2LCLA 3VS7A 1OEBA 2CP3A 2JT4A 2DYBA 2CGHA 2WSFE 5LJ5e 1B34B 4QVDA 4LN2A 1NJIR 2F2VA 2YRVA 4RTTA 2VGNA 2DL8A 2JOYA 5IXBA 4XU1A 2ROTA 4BDZA 1VYTA 1RAHB 1X6OA 1VQ8A 2C0OA 2KK4A 5C0MA 2MMPA 2EJGA 3NTIA 2KQWA 2E10A 2PQWA 2LT1A 3URGA 3OSVA 5IHNA 3FDRA 2QGGA 1XOVA 5FTLA 4HCKA 2ROLA 3HTRA 4PJJA 1D09B 4PFZA 4AFUC 1SRLA 4JS5A 2BE9B 1YJWQ 4E2FB 3CCVT 3GIBA 2B25A 1YJNA 5C6SA 4NL2A 3UATA 2EQJA 4LXCA 1H92A 2ZCFB 2D8JA 3PVLA 4LNPA 1YJ9Q 1PCXA 2DL5A 4C0GA 2MM2A 4X1VA 1TXQA 3CC4T 3NTHA 4EDUA 1CKAA 1XQHA 4MZMA 1BI2A 3CD6T 2PJHB 1BKBA 4Y91A 1JJ2A 2QQBA 2KSSA 2X3WD 2DXUA 3CC2Q 5CVIA 4PJNA 1JEGA 4Q5WA 3JCMg 1YI2T 3R6NA 3V8LA 3UF4A 3M57A 2EGAA 1YFNA 1ZC1A 1V29B 1BI0A 3L42A 2RI5A 1PD1A 4OVAA 3G4SA 3SWNC 3RUXA 1E6GA 2JW4A 2QTVA 4BI4A 1BCMA 4RTXA 4J9IA 5D6XA 1Q86U 3PFSA 3AT1B 5CO7A 2OTLA 1U1SA 3QYGB 2J7IA 1AZEA 4F7UG 1H8KA 5IAYA 1JU5C 1SRMA 2CYZB 5GANe 4PJOD 4HCZA 3NMZC 1R8OB 1YJNQ 2A36A 1H3HA 5KH6A 1YWPA 4YTLA 2KRMA 4XQ3A 2O31A 2GQVA 2DM1A 2KDSA 3QQ7A 4J9FA 1VQNT 1BBZA 4MMKA 2DZCA 1NLPC 2K4YA 2QQSA 5FRNA 5GJVB 2OX7A 2LJ0A 4C92B 2L3SA 1ZBJA 4J9CA 1G8XA 4XTXA 3JAME 1AVZC 2EPDA 2E3IA 1CZ5A 4EMGA 5GMKh 1SPKA 4CC4B 2YRDA 1VQPQ 5CD1A 1HYOA 2VV5A 1HK9A 1QCSA 4C0ZA 3RESA 1PM3A 1N9RA 1IRXA 4PK4A 4J6WA 1GFCA 2DE0X 2MF2A 3OBYA 1K73U 2EBPA 3BW1A 3I55Q 2DFUA 2QDLA 4JRQA 5GANd 1WPYA 3EHQA 4AS1A 3J81E 3LH0A 2YVLA 4E7LA 3H0FA 3OYFA 2MIOA 5DLQE 1CSKA 1WQWA 3QWXX 3JB9F 1OU8A 2LQKA 1OULA 2FL7A 3GF5A 2VKNA 4M75B 3D7SB 1X01A 3CMAT 4R55A 2E6ZA 4E7SA 2V8IA 1D0YA 1C1AA 2E5KA 1S72Q 5GMKj 5GAN7 2M0YA 1IREB 2FG0A 1M2VA 5CQXA 2JN0A 4QQGA 4LDWA 1M1GA 2DD5A 3J80E 2RHIA 1X6GA 2GTJA 3ME9A 4KO8A 1K9MU 3BE3A 2L3PA 3CPWS 2ZPFB 3NHNA 1QVGP 3DB3A 3H6ZA 3HFNA 1KK7A 1LOJA 2MCNA 4FM4B 3CC4Q 2RB6A 4FW1A 4OMLA 3VYGA 2GQIA 5J3BA 1O54A 2ZZDA 5FU6C 3S3NA 1VQ4T 2QA4A 4M7AC 3QC8A 3ZGZA 1FMWA 3EGDA 1GBQA 2A3LA 2A37A 3CBMA 4EMHA 1Q95G 5GAOp 2YLBA 3OYDA 5C1BA 4OGCA 1QCOA 2JS0A 3OYGA 1YNZA 3CCQA 1VQLA 5CCAA 5I2MA 2VWFA 3M4YA 2LP5A 3CCEA 1G3YA 3JB9J 3CCST 5FWBA 2JS2A 4AQ7A 2HD0A 1V76A 4ARIA 1I5LA 1GCQC 1QKWA 2NUZA 4LD6A 1Q82R 1QKXA 3HU1A 2RD1A 3ZL7C 3PE0A 2MWPA 4RUGA 4QKUA 3LH5A 1W2BA 3META 3G7ZA 2DVJA 4KGVB 1YWOA 4OF1A 2GBQA 3BDLA 1OPLA 2LZ6B 1AWOA 2DO3A 2LNVA 2P4TA 3BY7A 4PJOA 2CP7A 2MPXC 5GAMh 1O75A 2NUTA 1K73C 1BI1A 1WHGA 4M78E 4M77A 4J6XA 1LJOA 5IXFA 3CCET 4GBQA 1WHJA 2H3JA 4EMKB 2GTOA 1Y71A 1ZLMA 2SRCA 5GMKl 2X3XD 3E9GA 3NTKA 2NYSA 3JCMJ 1VIFA 1FX7A 4BD3A 1WLFA 4DBQA 4EMKC 1VQ9Q 1Y0MA 2DKGA 2K3XA 3A8GB 3A8LB 4C5GA 4HVWA 2LX7A 2EAYA 2JJ9A 3CBOA 4E7ZA 4Y28E 3M55A 3JCMW 1ZA1B 4AFZC 4PFPA 3LGAA 4JZ3A 2CT3A 5GLFA 2HDAA 2L0AA 3M0SA 1UGPB 2O9SA 3CCQQ 1VQLQ 2XKOC 1B34A 2O2OA 2K5LA 3JCMc 2VC8A 2P4RA 1VQ5T 4WTOB 1P92A 2EYQA 1Q81C 4V2SA 3HHTB 3RBBB 5ECAA 2AIRB 4OMPA 4F17A 4E7KA 2PWYA 1W6XA 1C0MA 4IIMA 1X6BA 6AT1B 5LJ3e 2X4JA 1EFNA 1I0CA 2PNIA 2QEXQ 4M78B 1K76A 4QQ6A 2L3RA 2NUPA 3PIPA 1U3OA 2RHYA 3MPUB 3X28B 2KXDA 2KRNA 5LJ3f 1TTHB 2M51A 2CUBA 2RJCA 1S72T 1KFZA 3OYMA 1I4K1 3QO3A 2K3YA 3OYKA 2GGRA 1EIFA 4LDVA 3ZFJA 3OYHA 2SEMA 2DVEA 4R0KA 2RK2A 2M0OA 3NGPA 1KC8C 4HVUA 1ZA2B 1M1FA 5A0DA 1QLYA 4MMLA 2CZ7B 5GAN2 2XIDA 3KFVA 4ORZA 4XU0A 1UJ0A 1VYVA 2LVMA 1KD1R 5LJ3d 2FPEA 1H3ZA 4J9GA 5ERGB 2QXFA 3VS4A 4B6MA 1CKBA 4F7UB 1VQNA 2ED0A 1NPRA 3M59A 2EJFA 5FW9A 2XHCA 2AKKA 1KIKA 4M7DB 1ABQA 1JJ2P 1VQMA 3QSUA 2EYWA 1X43A 2CZ6B 2QEXA 3HPWA 2J6KA 2R5MA 3G1JA 4PJOG 2EIFA 3TREA 4BY6B 4M75G 5GANg 4M77G 1VQ7A 2LQWA 5J39A 1KC8R 5DM7R 1OOTA 2YUJA 1Z9ZA 2EVRA 1VQOQ 2A0FB 1IGUA 4BDYA 2KVQG 4OMMA 1NM7A 1XTDA 1B7TA 1BYMA 1OYXA 3WVDB 2PTKA 4XTZA 4DEYA 2RN8A 1M8MA 1YJ9A 1D0ZA 4JRPA 1ZUYA 1ZHIA 1RI9A 4FCYA 2W0ZA 2OI3A 4FW2A 4PJOE 1UHCA 2WACA 5DYIA 2JXBA 1ABOA 2YRCA 5CCBA 3AHUA 1LNXA 2BTTA 3VS0A 1H641 3QJYA 3Q1JA 4FSSA 1KC8U 3H0HA 1UGVA 1QVGS 4M7AB 1YIJT 2HAXA 4A63B 2P0KA 1WHHA 1MMGA 3CPWA 4C92C 3LX7A 2CH4A 1Y07A 5EC7A 5J26A 3UPUA 2K6DA 4BACA 3JB9G 2CT4A 3EGXA 4RG8A 5LJ3g 1KQSS 2LRQA 4C0FA 1XNIA 4J5YA 3RKXA 3V7SA 4OB2B 3CXCP 4LE9A 2RNAA 2HCKA 3SWNB 1UFFA 2CP0A 2H8HA 2KYMA 4KUDK 2MM0A 2F69A 3CCRA 1GRIA 2M1HA 1IO6A 5FTKA 1AHJB 3TU4K 1Y96B 5KYWA 5KCOA 4J6YA 2EWNA 5A2QE 3A1PA 4XTUA 3JCMh 1K9AA 1ZSGA 1UECA 2RQVA 4NL3A 2KXCA 3M58A 3JCMQ 1VQMT 3VRZA 3MEUA 4CI0C 1QP3A 3E1SA 3CPWP 5A0LA 1Q7YU 3GNGA 1MMDA 1WZOA 3L2VA 1HXDA 2ENMA 3VV0A 1QVPA 3JCMX 3QBYA 4C5HA 1Z9QA 4DEXA 4IURA 1BI3A 1AZGB 3L2ZA 2VXFA 1VQKQ 2DL3A 2AKLA 3M0QA 3FPTA 1ZSZA 1WHMA 2PVGB 2CDTA 4D8KA 1U5SA 1MHNA 1RAGB 1ZSZB 1G2BA 1JJ2S 4KH0B 2BZXA 2OTJA 3A8HB 2V1RA 5GAOr 3EG0A 5GANf 3JCMV 2IPOB 2PVOB 2QASA 3CCLT 1S72A 1N27A 1VQPA 1W2BS 3CCUA 3H9NA 3OS5A 4NOYA 1JRIA 1D3BB 1YJWT 2AK5A 3OYJA 3CCVQ 2C0TA 1KHIA 2ZPHB 2XDBA 2BKDN 2FZGB 1MNEA 1X2QA 2BE7D 4AG1C 1M1KC 4LUDA 2PZ1A 4L59A 2LCSA 2KR3A 2EQIA 2RJEA 1R77A 3PIOA 4UC4A 4OMOA 3RKYA 5GANh 3OS2A 3JSCA 4M7AG 1NEBA 1UGQB 3UWNA 2QQ9A 1PSEA 2F5KA 2ESWA 3BQBA 1RAFB 3CCMQ 1W1FA 2ABLA 3IQLA 4IUPA 3X26B 1M2VB 5KYWB 4A4KA 3HU3A 2V1QA 2LW6A 2ZPBB 4A4EA 3CD6A 2MI6A 3E19A 1YI2Q 4LDXA 5CR2A 4J9EA 1X2KA 2PUKB 1M1KR 5FTJA 1NYFA 2JMAA 1TH7A 1RACB 1VA7A 3SFMA 1KQSP 2Q18X 1VUBA 1R0CB 3QJ6A 2E1HA 2HL5C 3CCJT 2OAWA 2OTJT 1IB8A 3MKDA 2DL7A 2KT1A 2FYKA 3I5SA 2QK0A 1GL5A 2F1LA 4XTVA 2KEAA 2HBWA 2LCCA 1MMAA 5KE3A 3VS6A 3X25B 1AEYA 4KRTA 3OMCA 2ZGWA 3FPRA 2FPFA 4KDLA 4X34A 2NUPB 2L8DA 4XTYA 3MEWA 1QVFP 4PJOB 3I56T 1NJIC 2JM9A 2RH2A 3G6ET 1YHQA 1WHKA 2BIVA 1QVFS 3M0TA 5DY9A 2KMTA 1WI7A 4ZTFA 2RHZA 3DB4A 4M75C 3ASKA 2ATCB 4HT8A 3RMSA 3WVEB 4N4GA 2RHXA 3MO8A 2QDYB 2HSEB 2LNHB 4C8QG 3LW5E 2ECZA 1JB0E 3FIFA 1VQPT 2HMAA 3EHRA 4C8QE 5EQJB 3CCLA 3VU3C 4FIBA 3H0IA 2RO0A 4RG2A 1IZ6A 2KBTA 2DETA 2VVKA 1PKTA 3M54A 2CREA 4M7DE 4JRKA 4DQ2A 4N0AA 1MNDA 5KYNA 1WJRA 3M5AA 3HFOA 3PT9A 1IGQA 2E3HA 1KSWA 2BZYA 2YHTA 4OB0B 4OB3B 2KE9A 3DKMA 4A53A 1QCNA 3OYEA 3LYIA 2EJ9A 1E6HA 1ZBXA 5GMKe 5GAMe 3M56A 4C92F 2IIMA 2YLCA 3EFRA 1WA7A 2O4XB 2P84A 1K1ZA 1M3AA 1F1BB 1OV3A 2J06A 4BB7A 1BK2A 4Z88A 3JCMb 1QQJA 2K5IA 1W2BP 4M7DA 2COWA 4HXJA 5HY6A 1G3SA 1ZUKA 4EPCA 4PLIA 5LJ5h 3QDFA 3O8VA 4DBHA 4BE1A 4QW2A 3TVTA 1WHLA 1RAIB 4TVRA 1TU0B 1RL2A 2G3RA 1K8AR 4FT4A 4RTWA 1B3QA 2HL3A 2AT1B 2QI2A 1E32A 5DYGA 2CP6A 2F5TX 4J9BA 3I56A 5GAOq 3CMAA 1Q82U 1NE8A 2KYBA 2E65A 4RCCA 3G6EA 1YHQT 2C0IA 4OP0A 3SHWA 2G6FX 4ZGDB 2K3BA 3CCQT 1VQLT 4M78A 3MP8A 3SD4A 1Q86R 5IN1A 1UGSB 1QMCA 1DJ7B 2EW3A 3C0CA 3CCSQ 1FMVA 1MV0B 4ZNXA 3SEMA 3RDVA 1UEBA 1SG5A 4QQDA 2ZPIB 5LJ5j 2XI9A 3C94A 1Q7YR 3EGUA 3L1AA 4BE2A 1SSHA 2DTHA 2OTJQ 1VQ5Q 4GY5A 4M77F 5KYXA 1KJWA 3EG9B 2FO0A 4M75D 1U8RA 1IHWA 1VQ9T 3C4SA 4M75A 2GFUA 3V8JA 3QDRB 3OMGA 4C8QC 2HZYA 3CCEQ 4O6JA 3ZBDA 1KD1C 2EGCA 1FMKA 5GAN3 4C5IA 2RA2A 1X75C 4C92G 1NYGA 4AFQC 4ELZC 4PNOA 1GFDA 3G4ST 1NZ9A 1T3SA 2JM8A 3VRYA 1WXBA 4M7AF 2M16A 1QDNA 1M27C 1SEMA 3CCUT 3GNFB 3S6WA 2LJ1A 4K11A 4M7DF 4FYVB 2XMFA 5IT9E 1KQ1A 3MHXA 3RERA 2MAMA 2OTLT 1NG2A 3CD6Q 1N9SA 2K2VA 2DJQA 5IHIA 4F7UF 2D8HA 4OB1B 5HKCA 3CEYA 5CKFA 3RMQA 2F2WA 2O9VA 1RADB 5CKEA 4XAXB 2BZ8A 4RMOA 2FPDA 4M77D 5CKHA 3P8DA 4ZTJA 3HRSA 4F7UE 3LWHA 4N4IA 4WF2A 1UDLA 2I0NA 2P0QA 4J7IA 3EG2A 2CKKA 4C8QF 1VQ5A 3RNJA 1I81A 4LD9K 3CXCA 1AWJA 1R0BG 4M78D 3C12A 2HBPA 4D8DA 4QVCA 1VQ6T 3O5ZA 5M9OA 3L2QA 4MZPA 3PMTA 2DEUA 1W4SA 1VIEA 4F04B 5CIUA 2JVVA 5KCHA 5FWCA 3P8HA 4Z8AA 3I55A 4M7DC 4J7FA 4C0DC 4PLLA 5GMKm 4XTWA 3TSWA 2AHJB 1MUZA 2K9GA 5HK3A 2RQUA 3T9NA 3OW2S 4PFOA 2DYIA 2Z0WA 2IG0A 2DXBA 4FYYB 3CC7A 1RI0A 1S3SA 5D7UA 5GAN5 4M75E 2DIGA 3MP1A 3REBB 3MJXA 2RI2A 2RK1A 4ESRA 5IH2A 2YSQA 4D6WA 2E70A 5GAOm 2CP5A 3NPFA 1WGSA 2XDPA 1WLPB 3KXTA 1LPLA 1YITA 1PNJA 4OMQA 4KBMB 2EYXA 2RPNA 3I55T 4HKEA 4XU3A 1OPKA 1VQOT 1YP5A 7AT1B 3CC4A 5AYFA 2R5AA 2M9UA 1J3TA 1M90U 1UG1A 4ARCA 1Q82C 2DLPA 3G71A 5GANj 3UT1A 1G83A 1SHFA 3A8MB 1YJNT 1D0XA 2HKQB 1NJIU 2E5QA 3OA6A 3CCVA 3CC2A 1OZ2A 4C92E 1X69A 1M3BA 5DLOA 5IHKA 1UHFA 1VQKA 4C8QA 5GMKi 4C8QB 3JB9D 2EYZA 3CC7T 1YIJQ 3G4SQ 2COYA 3OYYA 2GF7A 1K9MC 4M77B 2FRWA 3I35A 4PJOC 2CH4W 4O5VA 5CAIA 4M7AA 4ANJA 2OTLQ 4M77C 3TCJA 2P0PA 3EG9A 1PKSA 3EG3A 1N8RU 2L3QA 5CKBA 1BIBA 3NFCA 4IUQA 3EGXB 3FJPA 3RKWA 1D1BA 2KRSA 2A08A 2J6FA 2E64A 3CCSA 2M02A 5CKDA 3FB9A 4FYXB 5LJ3j 3OBWA 5CQYA 3SWNA 1WDXA 2CS7A 3OW2P 3VS2A 3GPLA 1GBRA 5GAMg 1RLQC 1WXTA 4RTYA 4WCIA 3M0RA 4M7DG 2HEQA 4FU6A 2CZ1B 4RKUE 3QUIA 4M7DD 5GAN6 1SSFA 3UDCA 3EH2A 3G71Q 1B07A 1IXDA 4F14A 2YXYA 1OI1A 3TSZA 2JV2A 1JQQA 3I9QA 3THKA 1BCOA 5D6WA 2DZ9A 3CCJA 2RMOA 3MEVA 2K57A 4KDIA 3QQ8A 3KBGA 1EX4A 2X35A 4L5GA 4CC2A 2J6OA 3CCMT 1G3WA 4IIOA 1I07A 3MCAB 3X24B 4BI3A 2D0QB 2B86A 2A7YA 4JJBA 5KYUA 2CUDA 1UTIA 4ME7A 4BE0A 2LDMA 5EPPA 1PRLC 1ARKA 1WX6A 3LLRA 3ZJVA 2DRMA 2MWOA 2VGMA 2Y4YA 4IKFA 1K73R 2O88A 2DNUA 1OX9A 3OS1A 1SHGA 3R6OA 4ZN3A 2RI3A 1Q7YC 4M7AD 2WSCE 1VYUA 5FU6B 3BDUA 4RV0A 1LVKA 2O4XA 2XDDA 1NLOC 1KQSA 4OMFB 2JUFA 2JZ2A 1ACMB 1WXUA 4LDUA 4Z89A 1TS9A 2RF0A 1HSQA 5EG2A 4JZ4A 3L2UA 4PJMA 4KT0E 4CC7A 4JJDA 4B9WA 4PL6A 2GFAA 1M5Q1 3J7AF 1WNLA 2EQUA 3WXMB 2PVDB 1BIAA 5I2SA 2YWWA 1WJQA 2W10A 1N5ZA 3HRUA 4XU2A 1O9SA 2FEIA 1Q81U 5CK9A 2X9HA 4C0DB 1MMNA 2XD0A 1V1CA 1NEGA 4RTZA 2QAZA 2DERA 2E4HA 3A8OB 4X9DA 3CC7Q 2JMCA 4KGZB 1N8RC 3FC3A 4AMCA 4HCBA 3LGLA 4R56A 5GAMj 5GAN8 4RCBA 3JV3A 5I21A 3OYNA 3HRTA 4E7IA 1K0SA 1OU9A 3JCMd 2EGEA 4C5EA 1PHTA 4FT2A 2H3EB 5GJWB 3MP6A 2DK3A 5GAMd 3I5RA 3QPHA 5LJ5d 2FHDA 2F2XA 3CC2T 2DXTA 2KAFA 3PMIA 4BUGA 5LJ5f 2K2MA 1I8FA 5GAMf 4RTUA 1AD5A 2Q1AX 3CBPA 3OYCA 4F7UA 4LDYA 5FROA 3I56Q 5L8RE 1AWWA 3JCMf 3M0UA 1D1AA 1RAEB 3EG1A 1YN8A 2AZSA 3HSBA 3L2RA 3LWIA 4QT7A 3CPFA 2HQEA 1K0XA 4E7HA 2OJ2A 2D9TA 2FZCB 3G71T 1VOMA 2NUTB 2CSQA 1G5VA 2QGFB 4A4FA 1YBYA 4GLKA 4X9CA 1TUCA 1QWFA 3N5BB 3JCMe 4J9HA 4C92D 1LCKA 1VQ8Q 1YJ9T 4DBFA 4JRIA 2DTOA 4OGEA 4EIKA 1FWZA 2KNBB 2E6NA 1QVFA 1OX8A 2ZPGB 3OSSC 2RHUA 3OYAA 2DBKA 2HQHA 3GLXA 2JTFA 2V8KA 3RR6A 1UB4A 2XU8A 1JXOA 1TWBA 3GBQA 3LGFA 2D6FA 1QWEA 3CCRQ 2I2LA 1R7RA 1M9SA 2LQNA 4N0AC 1M3CA 3BFMA 2OAUA 5L23A 5AT1B 1OZ3A 1PWTA 2L5QA 2DL4A 4MDWA 4KODA 4M77E 1I5OB 5GAOl 1M90C 1FXXA 4CQNA 1SKUB 4J9DA 4FL6A 4ZN1A 1VQ6A 4PJLA 2EFIA 5GAOn 1RUWA 3TEEA 2DRKA 1N8RR 2LT4A 2EQKA 1S1NA 2NWMA 4J8OA 1M8VA 2A28A 1CZ4A 4JS4A 2XG8D 2MYSA 1WYXA 1QW1A 2PU9B 3X20B 2LMJA 3A5ZB 4M75F 4HVVA 3EH1A 2LJ3A 3HL8A 3UA6A 5LJ3h 3DLLA 1PG5B 3ULRB 2LX9A 3OS0A 1VQNQ 3FLGA 1GCPA 2DJZA 3RIRA 3EAEA 2RQTA 4FYWB 1VQMQ 5KYXB 4BY6C 2EKHA 1X27A 2D1XA 5FU7C 1VQ7Q 8AT1B 1K9MR 4DOVA 2Q1CX 3EFSA 1RAAB 2CSIA 2B8AA 2YT6A 4MDXA 3CF2A 3E2UA 3PVQA 1Y57A 5KYYB 4Y92A 1W70A 1M1KU 3CCUQ 1BU1A 2HNIA 2D0NA 2DXCA 2GCXA 1UGRB 4FSXA 1UE9A 1T0HA 1VQKT 3PGGA 5LJ5g 2KI7A 3CCRT 1GXIE 1ZX6A 5FTMA 2RQRA 3QG1A 2Y4XA 3MB5A 2KT8A 2YUPA 1VQ6Q 2X4YA 5FRMA 4E47A 2FRYA 3CMAQ 3P8BB 2XICA 3ZEHA 4ATOA 4OMNA 3L2WA 4L6V5 2NLUA 1YI2A 4NS5A 2Q19X 2EKOA 3M53A 3H8ZA 2CZ0B 4VUBA 4KH1B 3VUBA 4P5NA 5C18A 1KG1A 4F16A 3QWZA 1YITT 5HCKA 1Q86C 2EYYA 3OY9A 3OYBA 1YIJA 1M30A 1PC0A 3QZ9B 4M7AE 1D3BA 1JO8A 3QYHB 5KYUB 3ZJUA 2X51A 4C92A 1Y7XA 5HK0A 2DBMA 4PKCC 4DBRA 1VQ4Q 4DA4A 4KULA 4IUTA 3DLMA 3EGDB 3REAB 1KD1U 2JNGA 2DEQA 1VQ8T 5B6CA 2AZVA 3VS3A 3U23A 4M4ZA 1RABB 2RJFA 2YDLA 1QP2A 2YUNA 1GCQA 1EZZB 5FTNA 2L89A 4A4GA 4AG2C 4J83A 3SDZA 4N4HA 1Q81R 4JLGA 4DOWA 2QQRA 1PRMC 2YUOA 3CCLQ 2R57A 3OB9A 5LL6S 4II1A 2DMOA 2LQ8A 4IUUA 2QEXT 2Y90A 4ZGEB 2LC4A 3VJPA 4HCCA 3HP9A 4M78F 2V8JA 4XK8E 3SB2A 2RJDA 5KE2A 2MK5A 3F70A 4LUEA 3CMEQ 5D6YA 2ZAEA 2ZPEB 3TIWA 5I11A 1Y96A 2BUDA 4A4HA 3OW2A 5A0GA 4EMKA 3HU2A
chains in the Genus database with same CATH topology
1OI1A 1PSFA 4OGCA 5KE3A 3OYGA 2JV2A 3X25B 3ER0A 3CCQA 1VQLA 5CCAA 1K8AU 5D6WA 2DZ9A 2ZGWA 3OMCA 5I2MA 3CCJA 3FPRA 3S3MA 3ZJTA 3M4YA 3MEVA 4KDLA 3CCEA 2K57A 4KDIA 2QA4T 4X34A 1G3YA 1M4ZA 3QQ8A 2L8DA 3KBGA 4XTYA 3JB9J 3QXEB 3CCST 2VYTA 2X35A 4L5GA 3MEWA 4PJOB 2X4XA 2HD0A 2WSEE 3I56T 4AQ7A 4ARIA 1I5LA 2DAQA 3C95A 4LD6A 1NJIC 2RH2A 3G6ET 3MEAA 1YHQA 3CCMT 1G3WA 2BIVA 3MCAB 3X24B 1QVFS 3HU1A 4BI3A 2D0QB 2RD1A 5DY9A 2JTMA 2DD4A 2KMTA 2A7YA 2MWPA 1VQ7T 3V7CA 4ZTFA 3JB9I 4ME7A 1W2BA 4BE0A 3META 3G7ZA 2RHZA 2LDMA 3DB4A 4M75C 5EPPA 4OF1A 3ASKA 1YCYA 2PUOB 1ZQ1A 2RM4A 3CXCS 3BDLA 4HT8A 3RMSA 3OYIA 2FB7A 2R58A 3LLRA 2DTIA 2DO3A 3WVEB 2MWOA 2VGMA 3ZJVA 2LNVA 2Y4YA 2P4TA 3BY7A 3CCMA 4IKFA 4PJOA 4N4GA 2RHXA 4JUVA 3MO8A 4KUIA 5GAMh 1VQ9A 2QDYB 1O75A 4KLNA 3OS1A 1K73C 2QTXA 4C8QG 3LW5E 3R6OA 1JB0E 1BI1A 2RI3A 3FIFA 4M78E 4M77A 4J6XA 4ZN3A 1VQPT 4C8QE 5EQJB 1Q7YC 3VU3C 3CCLA 1LJOA 4FIBA 3CCET 3QHSA 4B9XA 2RO0A 4M7AD 2WSCE 4RG2A 1IZ6A 5FU6B 2H3JA 3BDUA 4EMKB 4RV0A 1Y71A 5GMKl 3M54A 3E9GA 3NTKA 3JCMJ 4M7DE 1VIFA 1FX7A 2O4XA 3M4GA 4JRKA 4BD3A 4DQ2A 4N0AA 2XDDA 3CMEA 1KQSA 4OMFB 1WLFA 1WJRA 2JUFA 3M5AA 2K3XA 2DKGA 2JZ2A 2VUBA 3A8GB 3A8LB 3HFOA 3PT9A 3CC2T 2E41A 4C5GA 2YHTA 1KHCA 4LDUA 4OB0B 2C06A 2EAYA 4OB3B 4HA8A 3CBOA 4JLIA 3V7RA 3DKMA 4JJNK 2X4WA 4A53A 2DIQA 4Y28E 3M55A 5EG2A 3LHDA 3L2UA 3JCMW 3E9FA 3FRNA 2VXEA 3INZA 4KT0E 3V8KA 3OYEA 1QVGA 3LYIA 3LGAA 1NPPA 5GAN4 4ELYC 2EJ9A 3CMET 4B9WA 1JBMA 3VUZA 3S3OA 1ZBXA 5GMKe 5GLFA 5GAMe 3M56A 4PL6A 4C92F 2GFAA 2FVUA 1M5Q1 1UGPB 2YLCA 3J7AF 2XKOC 1WNLA 2EQUA 2IVWA 3EFRA 2O4XB 3M9QA 1B34A 2PVDB 1BIAA 3KUFA 3WXMB 4ZGJB 5I2SA 4BI8B 2K5LA 1WJSA 3JCMc 4BB7A 2VC8A 1WJQA 1K8AC 4MZTA 3VYHB 1VQ5T 1KQ2A 3JCMb 1P92A 1N6AA 2EYQA 1Q81C 4V2SA 2K5IA 3HRUA 4XU2A 2DPPB 3HHTB 3RERA 4M7DA 1MGQA 1O9SA 1I9GA 1Q81U 5CK9A 4E7KA 4C0DB 2XD0A 2PWYA 3PTAA 5HY6A 5FU7B 3A8OB 5LJ3e 4X9DA 1G3SA 2X4JA 4EPCA 3OYLA 4PLIA 3HKSA 2EQMA 5LJ5h 3O8VA 4M78B 3GOXA 4BE1A 4QW2A 4QQ6A 2L3RA 4HT9A 1N8RC 3FC3A 3PIPA 4HCBA 2RHYA 3LGLA 4TVRA 4IUVA 1RL2A 2G3RA 3X28B 4FT4A 4C8QD 4R56A 5GAMj 5LJ3f 4M78G 1G3TA 4QVZA 5GAN8 4Z02A 2QI2A 4RCBA 3OQ5A 5I21A 3OYNA 3HRTA 4E7IA 1E32A 2RJCA 5DYGA 2F5TX 3JCMd 3JCMP 1S72T 2XK0A 3I56A 4C5EA 4FT2A 5FLXE 3QIIA 2HQXA 5GAOq 3OYMA 1I4K1 4CRIA 3QO3A 3CMAA 3MP6A 1Q82U 1NE8A 2K3YA 2LTOA 2DK3A 3JRZA 5GAMd 3OYKA 2E65A 4RCCA 1EIFA 4LDVA 3G6EA 1YHQT 3QPHA 5LJ5d 2FHDA 4OP0A 4ZGDB 1YJWA 2DXTA 2KAFA 3PMIA 3ZFJA 4BUGA 4M78A 3MP8A 3SD4A 5LJ5f 3OYHA 3CCQT 1I8FA 5IN1A 5GAMf 1UGSB 2DVEA 2RK2A 1DJ7B 2M0OA 4A54A 3CBPA 2Q1AX 3OYCA 3PNWC 1KC8C 4F7UA 1U1TA 1M1FA 4LDYA 5FROA 5A0DA 3GP8A 5L8RE 4JDSA 4MMLA 2CZ7B 1UEBA 3JCMf 2KY9A 5GAN2 1CR5A 2XIDA 4XU0A 4QQDA 3VKIA 2LVMA 3FEOA 3HSBA 2ZPIB 5LJ3d 3LWIA 3L2RA 5LJ5j 1H3ZA 3CPFA 4E7JA 2HQEA 5ERGB 3QKJA 2XI9A 2QXFA 4PJOF 3C94A 3L1AA 4BE2A 1WQ7A 2DTHA 4E7HA 2D9TA 4F7UB 4GY5A 3G71T 4M77F 3FPUA 2QQAA 1VQNA 1G5VA 3M59A 1NPRA 1VQ4A 3JB9H 4A4FA 1YBYA 4GLKA 2EJFA 2E12A 2O01E 4M75D 2XHCA 4X9CA 1U8RA 4M7DB 5CCXA 3N5BB 1VQ9T 2Q1DX 3C4SA 4M75A 3JCMe 1VQOA 1VQMA 4C92D 3QSUA 4M78C 2GFUA 2K5FA 3QZ5B 3V8JA 3QDRB 2CZ6B 3OMGA 2QEXA 1YJ9T 4C8QC 4JRIA 3HPWA 2LCLA 2DTOA 2R5MA 4O6JA 4OGEA 4PJOG 3ZBDA 2EIFA 1KD1C 1FWZA 2CGHA 2WSFE 5LJ5e 1B34B 2E6NA 3TREA 1QVFA 4QVDA 4BY6B 4M75G 5GAN3 2ZPGB 5GANg 4C5IA 4M77G 3OSSC 2RHUA 2YRVA 3GLXA 2RA2A 3OYAA 1X75C 2VGNA 1VQ7A 5J39A 2JOYA 2JTFA 5DM7R 2YUJA 4XU1A 4BDZA 2V8KA 1UB4A 2XU8A 4C92G 4ELZC 4PNOA 3LGFA 3G4ST 1X6OA 2D6FA 1VQ8A 2KK4A 1NZ9A 5C0MA 2I2LA 4M7AF 2M16A 2MMPA 2EJGA 1M9SA 4N0AC 3NTIA 4EMKA 2KVQG 3GNFB 3S6WA 3CCUT 4BDYA 3CD6A 4M7DF 3BFMA 1XTDA 2OAUA 1BYMA 1OYXA 5IT9E 2KQWA 1OZ3A 4XTZA 1KQ1A 2E10A 3MHXA 3WVDB 2L5QA 2LT1A 2MAMA 2PQWA 3OSVA 3URGA 2OTLT 3FDRA 1N9SA 2K2VA 1XOVA 4MDWA 4KODA 4M77E 5FTLA 4F7UF 5GAOl 1YJ9A 1M90C 1FXXA 4JRPA 4OB1B 5HKCA 4CQNA 3CEYA 1ZHIA 4FL6A 5CKFA 4JS5A 3RMQA 4PJOE 5CKEA 4XAXB 4ZN1A 4RMOA 3CCVT 1VQ6A 3GIBA 2WACA 4M77D 2B25A 5CKHA 5DYIA 3P8DA 1YJNA 1QDNA 2EFIA 4ZTJA 5CCBA 3AHUA 5C6SA 3HRSA 5GAOn 4NL2A 1LNXA 4F7UE 3TEEA 2LT4A 1H641 2EQKA 2EQJA 3QJYA 4J8OA 1M8VA 3Q1JA 2ZCFB 3LWHA 1KC8U 1CZ4A 4N4IA 2XG8D 4WF2A 4JS4A 2P0QA 4C0GA 1QVGS 2MM2A 4J7IA 3CC4T 4M7AB 1YIJT 1QW1A 2CKKA 3NTHA 4C8QF 2PU9B 4EDUA 1VQ5A 2HAXA 1R7RA 1XQHA 1I81A 2P0KA 4MZMA 3CXCA 3X20B 4LD9K 3CPWA 1BI2A 4C92C 4M78D 3C12A 3OS2A 3A5ZB 2HBPA 4M75F 3CD6T 2PJHB 1BKBA 3LX7A 4Y91A 1Y07A 3HL8A 5J26A 1JJ2A 3UPUA 5LJ3h 3DLLA 4BACA 2QQBA 3JB9G 4QVCA 2KSSA 2LX9A 3OS0A 1VQ6T 2DXUA 5M9OA 5CVIA 4RG8A 3L2QA 3FLGA 5LJ3g 1KQSS 4MZPA 4Q5WA 3JCMg 2LRQA 4C0FA 1XNIA 2DJZA 3RIRA 4J5YA 3PMTA 1YI2T 1W4SA 3V8LA 1VIEA 3RKXA 3EAEA 3V7SA 5CIUA 2JVVA 5KCHA 4OB2B 3P8HA 3I55A 3M57A 4BY6C 1VQLT 4M7DC 4J7FA 4C0DC 4PLLA 3SWNB 5GMKm 1ZC1A 4XTWA 5FU7C 1V29B 1BI0A 3L42A 4DOVA 2RI5A 2AHJB 2Q1CX 3EFSA 5C1BA 2B8AA 4OVAA 5HK3A 4MDXA 3G4SA 3SWNC 3CF2A 4KUDK 3RUXA 2MM0A 2F69A 4BI4A 2M1HA 3CCRA 5FTKA 1M1KU 1AHJB 5D6XA 3TU4K 3T9NA 1Y96B 3OW2S 1Q86U 3PFSA 5KCOA 5CO7A 2HNIA 2OTLA 1U1SA 2IG0A 2DXBA 3QYGB 3CC7A 4J6YA 2EWNA 2DXCA 5A2QE 1RI0A 1UGRB 2GCXA 4XTUA 4FSXA 3JCMh 4F7UG 1S3SA 5GAN5 1VQKT 3PGGA 4M75E 5LJ5g 2DIGA 5IAYA 3MP1A 4NL3A 4PJOD 3M58A 2CYZB 2RI2A 5GANe 4HCZA 3JCMQ 2RK1A 3CCRT 4CI0C 3MEUA 1VQMT 1GXIE 1R8OB 4D6WA 5FTMA 2E70A 1QP3A 3QG1A 3E1SA 5GAOm 5KH6A 2Y4XA 5A0LA 3MB5A 1WGSA 4YTLA 1Q7YU 4XQ3A 2XDPA 2GQVA 2KDSA 3KXTA 3QQ7A 3GNGA 1VQNT 1YITA 2X4YA 4MMKA 5FRMA 2DZCA 4E47A 3L2VA 2K4YA 3P8BB 4KBMB 3I55T 1HXDA 2XICA 4HKEA 2QQSA 5FRNA 3ZEHA 4XU3A 3VV0A 1QVPA 4C92B 3JCMX 3L2WA 3QBYA 1VQOT 4ATOA 4L6V5 2NLUA 4C5HA 1YI2A 4NS5A 2Q19X 2EKOA 3M53A 3H8ZA 4XTXA 2CZ0B 3CC4A 4VUBA 4IURA 3JAME 1BI3A 3VUBA 5AYFA 2R5AA 4P5NA 2M9UA 1CZ5A 3L2ZA 2VXFA 4EMGA 1M90U 5C18A 5GMKh 4ARCA 1Q82C 1KG1A 3G71A 5GANj 3FPTA 5CD1A 3UT1A 3QWZA 1YITT 2PVGB 2VV5A 1Q86C 1MHNA 1HK9A 3OY9A 1QCSA 3OYBA 3A8MB 1YJNT 1YIJA 4C0ZA 1NJIU 3QZ9B 4M7AE 3RESA 1N9RA 1D3BA 2E5QA 3OA6A 3CCVA 3CC2A 1OZ2A 4C92E 4J6WA 2MF2A 3OBYA 3QYHB 3ZJUA 1K73U 5DLOA 4C92A 1JJ2S 1Y7XA 2OTJA 3A8HB 3BW1A 5HK0A 4PKCC 5GAOr 5GANf 1VQKA 3JCMV 4C8QA 5GMKi 2PVOB 5GANd 4C8QB 3CCLT 4JRQA 3JB9D 4DA4A 1S72A 1N27A 4KULA 1VQPA 1WPYA 3DLMA 4IUTA 3CC7T 4AS1A 3J81E 1W2BS 1KD1U 3LH0A 3CCUA 2YVLA 4E7LA 2JNGA 2DEQA 3OS5A 3OYFA 4NOYA 1JRIA 5DLQE 1D3BB 1WQWA 1YJWT 1VQ8T 5B6CA 3OYJA 3JB9F 3OYYA 2GF7A 1K9MC 2LQKA 3GF5A 2FL7A 4M77B 1KHIA 4PJOC 2RJFA 4M75B 2ZPHB 4O5VA 1X01A 3CMAT 5CAIA 1QP2A 4R55A 2XDBA 4M7AA 2E6ZA 2BKDN 2V8IA 1M1KC 4M77C 3TCJA 2P0PA 4L59A 5GMKj 5GAN7 1N8RU 5CKBA 5FTNA 1IREB 1BIBA 3NFCA 2RJEA 3PIOA 4IUQA 4UC4A 2L89A 5CQXA 2JN0A 3FJPA 4A4GA 4J83A 4N4HA 4QQGA 3RKYA 4LDWA 3JSCA 1M1GA 3RKWA 1UGQB 3SDZA 3UWNA 5GANh 2QQ9A 1PSEA 2DD5A 4M7AG 4JLGA 3J80E 2RHIA 2F5KA 4DOWA 2QQRA 3BQBA 3ME9A 4KO8A 2R57A 3OB9A 1K9MU 4IUPA 3X26B 2E64A 5LL6S 4II1A 4EMKC 3CPWS 4A4KA 2ZPFB 3CCSA 5CKDA 3HU3A 2LW6A 2ZPBB 3FB9A 4A4EA 3DB3A 3H6ZA 2LQ8A 3HFNA 3OBWA 4IUUA 2MI6A 3E19A 5CQYA 3SWNA 5LJ3j 5CR2A 2QEXT 2Y90A 2CS7A 1LOJA 4LDXA 4ZGEB 2PUKB 4FM4B 2RB6A 5FTJA 2LC4A 3GPLA 3VYGA 3VJPA 4HCCA 3HP9A 4M78F 2V8JA 4XK8E 5J3BA 5GAMg 2ZZDA 1O54A 1TH7A 3SB2A 5FU6C 2RJDA 5KE2A 3S3NA 4M7DG 1VQ4T 3SFMA 3F70A 4FU6A 2CZ1B 2QA4A 4M7AC 4RKUE 2Q18X 3QUIA 5D6YA 3QC8A 1VUBA 4M7DD 3ZGZA 3QJ6A 2E1HA 1SSFA 5GAN6 3CCJT 2OTJT 2ZPEB 3TIWA 3UDCA 2A3LA 2FYKA 3CBMA 4EMHA 1Y96A 2BUDA 4A4HA 3OW2A 5A0GA 5GAOp 2YLBA 3OYDA 4XTVA 2LCCA 3HU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQS A;  5FRN A;  1OI1 A;  1OYX A;  5KE3 A;  3ZEH A;  3OYG A;  1OZ3 A;  3OYL A;  4PLI A;  2PQW A;  3QBY A;  3L2W A;  5D6W A;  2EQM A;  3FDR A;  2NLU A;  3O8V A;  3OMC A;  4NS5 A;  4C5H A;  2EKO A;  3GOX A;  3S3M A;  4BE1 A;  3H8Z A;  4QW2 A;  4QQ6 A;  3MEV A;  2L3R A;  4IUR A;  2R5A A;  4X34 A;  3FC3 A;  4BDY A;  3CEY A;  2L8D A;  2RHY A;  3LGL A;  4FL6 A;  2VYT A;  2X35 A;  4IUV A;  2G3R A;  3MEW A;  2X4X A;  2DAQ A;  2WAC A;  4LD6 A;  3P8D A;  4QVZ A;  3UT1 A;  2EFI A;  4Z02 A;  4ZTJ A;  5C6S A;  1MHN A;  3MEA A;  3OY9 A;  3OYB A;  2BIV A;  3OQ5 A;  3OYN A;  4E7I A;  2RJC A;  2E5Q A;  2XK0 A;  2EQK A;  2EQJ A;  3OA6 A;  4C5E A;  1OZ2 A;  2MWP A;  3Q1J A;  3QII A;  2HQX A;  3OYM A;  4ZTF A;  4CRI A;  4N4I A;  3MP6 A;  2LTO A;  2K3Y A;  3MET A;  4BE0 A;  2RHZ A;  2LDM A;  3DB4 A;  2CKK A;  3ASK A;  3NTH A;  3OYK A;  4EDU A;  2P0K A;  2FHD A;  3PMI A;  3BDL A;  3MP8 A;  3SD4 A;  2R58 A;  3OYH A;  3OYI A;  3LLR A;  5IN1 A;  1N27 A;  2MWO A;  4IUT A;  3DLM A;  4IKF A;  3LX7 A;  2M0O A;  3LH0 A;  5J26 A;  4N4G A;  2RHX A;  3PNW C;  3OYC A;  4E7L A;  3MO8 A;  3OYF A;  4BAC A;  3OS1 A;  3OS0 A;  5FRO A;  3OYJ A;  2GF7 A;  5M9O A;  3L2Q A;  3FLG A;  2RI3 A;  4Q5W A;  2LRQ A;  2RJF A;  1XNI A;  4QQD A;  3PMT A;  2LVM A;  3FEO A;  3EAE A;  4B9X A;  5CIU A;  2RO0 A;  3L2R A;  4RG2 A;  5KCH A;  2BKD N;  3P8H A;  1H3Z A;  4E7J A;  2HQE A;  3QKJ A;  4PLL A;  4L59 A;  3E9G A;  3NTK A;  4BE2 A;  2O4X A;  4E7H A;  4BD3 A;  3L42 A;  2D9T A;  2RJE A;  2RI5 A;  4IUQ A;  1WJR A;  4UC4 A;  2L89 A;  4GY5 A;  2K3X A;  2B8A A;  2JZ2 A;  4N4H A;  4OVA A;  4QQG A;  4A4G A;  3OS2 A;  1G5V A;  3UWN A;  4C5G A;  2RHI A;  4A4F A;  2F5K A;  2M1H A;  1KHC A;  2QQR A;  3ME9 A;  2R57 A;  3OB9 A;  4IUP A;  5D6X A;  2X4W A;  2DIQ A;  4II1 A;  3PFS A;  3L2U A;  5KCO A;  3C4S A;  3E9F A;  4A4E A;  2IG0 A;  2GFU A;  3DB3 A;  3H6Z A;  4IUU A;  3OMG A;  3OYE A;  3LYI A;  1RI0 A;  2R5M A;  4B9W A;  3S3O A;  2DIG A;  4PL6 A;  2GFA A;  5IAY A;  3MP1 A;  2EQU A;  2E6N A;  2O4X B;  2RI2 A;  3M9Q A;  3KUF A;  4HCZ A;  2RJD A;  3MEU A;  5KE2 A;  3S3N A;  4C5I A;  3F70 A;  2RHU A;  2YRV A;  1WJS A;  4FU6 A;  3OYA A;  5J39 A;  1WJQ A;  5D6Y A;  2JTF A;  5KH6 A;  1WGS A;  3QJ6 A;  4BDZ A;  1SSF A;  2XDP A;  3LGF A;  2X4Y A;  2BUD A;  5FRM A;  5C0M A;  4A4H A;  2M16 A;  3L2V A;  4E7K A;  3OYD A;  3NTI A;  3S6W A;  2LCC A; 
#chains in the Genus database with same CATH topology
 5KYY A;  1PSF A;  3ER0 A;  1K8A U;  3S3M A;  3ZJT A;  1HJD A;  2KGT A;  1ZSZ C;  1SF9 A;  2QA4 T;  1M4Z A;  2YUQ A;  3QXE B;  2VYT A;  2DF6 A;  2WSE E;  2X4X A;  2DAQ A;  3C95 A;  3MEA A;  1T0J A;  3QWY A;  1A0N B;  1WFW A;  2JTM A;  2DA9 A;  2DD4 A;  1VQ7 T;  3CCJ Q;  1E7O A;  3V7C A;  3JB9 I;  3TQ7 P;  1I1J A;  1ZUU A;  1YCS B;  1TG0 A;  4E6R A;  2L2P A;  1YCY A;  2PUO B;  1BB9 A;  1ZQ1 A;  2RM4 A;  3CXC S;  3OYI A;  2FB7 A;  2R58 A;  2DTI A;  2FZK B;  1D1C A;  3UA7 A;  3CCM A;  4JUV A;  4KUI A;  1VQ9 A;  4KLN A;  2QTX A;  2V26 A;  3QHS A;  4B9X A;  1PD0 A;  3G6E Q;  8ATC B;  1MV3 A;  4AT1 B;  1K4U S;  3FJ5 A;  3M4G A;  1AOJ A;  3CME A;  2QYZ A;  2VUB A;  2VB6 A;  2E41 A;  1YIT Q;  2QG9 B;  1KHC A;  2C06 A;  4HA8 A;  3V7R A;  4JLI A;  4JJN K;  2X4W A;  3LHD A;  1M2O A;  2DIQ A;  2DIL A;  3E9F A;  3FRN A;  3M0P A;  2VXE A;  3INZ A;  1NBE B;  3V8K A;  1QVG A;  2DX1 A;  3CQT A;  1NPP A;  5GAN 4;  4ELY C;  3CME T;  4CC3 A;  1JBM A;  3VUZ A;  3S3O A;  1IHV A;  2FVU A;  2IVW A;  3M9Q A;  3KUF A;  4ZGJ B;  1U06 A;  4BI8 B;  1XJW B;  1WJS A;  1AWX A;  1K8A C;  4MZT A;  3VYH B;  1KQ2 A;  3VS1 A;  2MOX A;  1N6A A;  4JPB W;  2DPP B;  1MGQ A;  1I9G A;  5I22 A;  1YHQ Q;  3PTA A;  5FU7 B;  3OYL A;  1TSF A;  3HKS A;  1TUG B;  2EQM A;  2VAS A;  3GOX A;  4AFS C;  2KRO A;  1TOV A;  2ED1 A;  4HT9 A;  1TUD A;  9ATC B;  4GLM A;  4IUV A;  1UUE A;  1JXM A;  4C8Q D;  4JJC A;  1C6V X;  4M78 G;  1G3T A;  4QVZ A;  4Z02 A;  3OQ5 A;  1UJY A;  3JCM P;  1M90 R;  2XK0 A;  5FLX E;  2RQW A;  3QII A;  2HQX A;  4CRI A;  1WIE A;  1QCF A;  2LTO A;  3EFO A;  3H41 A;  3JRZ A;  1AT1 B;  1YJW A;  2COZ A;  2HSP A;  2K7A A;  1OQK A;  4A54 A;  2J05 A;  2JTE A;  3PNW C;  1U1T A;  3GP8 A;  4JDS A;  1CR5 A;  2KY9 A;  2GNC A;  3VKI A;  3FEO A;  2HKN A;  4KGX B;  4RTV A;  4E7J A;  3QKJ A;  4PJO F;  2QA4 Q;  2CP2 A;  1WQ7 A;  1FYN A;  3VS5 A;  3FPU A;  2QQA A;  1HD3 A;  1VQ4 A;  3JB9 H;  2E12 A;  2O01 E;  2K79 A;  5CCX A;  3A98 A;  2Q1D X;  1VQO A;  4M78 C;  3EFO B;  1RLP C;  2K5F A;  3QZ5 B;  1T3L A;  2LCL A;  3VS7 A;  1OEB A;  2CP3 A;  2JT4 A;  2DYB A;  2CGH A;  2WSF E;  5LJ5 e;  1B34 B;  4QVD A;  4LN2 A;  1NJI R;  2F2V A;  2YRV A;  4RTT A;  2VGN A;  2DL8 A;  2JOY A;  5IXB A;  4XU1 A;  2ROT A;  4BDZ A;  1VYT A;  1RAH B;  1X6O A;  1VQ8 A;  2C0O A;  2KK4 A;  5C0M A;  2MMP A;  2EJG A;  3NTI A;  2KQW A;  2E10 A;  2PQW A;  2LT1 A;  3URG A;  3OSV A;  5IHN A;  3FDR A;  2QGG A;  1XOV A;  5FTL A;  4HCK A;  2ROL A;  3HTR A;  4PJJ A;  1D09 B;  4PFZ A;  4AFU C;  1SRL A;  4JS5 A;  2BE9 B;  1YJW Q;  4E2F B;  3CCV T;  3GIB A;  2B25 A;  1YJN A;  5C6S A;  4NL2 A;  3UAT A;  2EQJ A;  4LXC A;  1H92 A;  2ZCF B;  2D8J A;  3PVL A;  4LNP A;  1YJ9 Q;  1PCX A;  2DL5 A;  4C0G A;  2MM2 A;  4X1V A;  1TXQ A;  3CC4 T;  3NTH A;  4EDU A;  1CKA A;  1XQH A;  4MZM A;  1BI2 A;  3CD6 T;  2PJH B;  1BKB A;  4Y91 A;  1JJ2 A;  2QQB A;  2KSS A;  2X3W D;  2DXU A;  3CC2 Q;  5CVI A;  4PJN A;  1JEG A;  4Q5W A;  3JCM g;  1YI2 T;  3R6N A;  3V8L A;  3UF4 A;  3M57 A;  2EGA A;  1YFN A;  1ZC1 A;  1V29 B;  1BI0 A;  3L42 A;  2RI5 A;  1PD1 A;  4OVA A;  3G4S A;  3SWN C;  3RUX A;  1E6G A;  2JW4 A;  2QTV A;  4BI4 A;  1BCM A;  4RTX A;  4J9I A;  5D6X A;  1Q86 U;  3PFS A;  3AT1 B;  5CO7 A;  2OTL A;  1U1S A;  3QYG B;  2J7I A;  1AZE A;  4F7U G;  1H8K A;  5IAY A;  1JU5 C;  1SRM A;  2CYZ B;  5GAN e;  4PJO D;  4HCZ A;  3NMZ C;  1R8O B;  1YJN Q;  2A36 A;  1H3H A;  5KH6 A;  1YWP A;  4YTL A;  2KRM A;  4XQ3 A;  2O31 A;  2GQV A;  2DM1 A;  2KDS A;  3QQ7 A;  4J9F A;  1VQN T;  1BBZ A;  4MMK A;  2DZC A;  1NLP C;  2K4Y A;  2QQS A;  5FRN A;  5GJV B;  2OX7 A;  2LJ0 A;  4C92 B;  2L3S A;  1ZBJ A;  4J9C A;  1G8X A;  4XTX A;  3JAM E;  1AVZ C;  2EPD A;  2E3I A;  1CZ5 A;  4EMG A;  5GMK h;  1SPK A;  4CC4 B;  2YRD A;  1VQP Q;  5CD1 A;  1HYO A;  2VV5 A;  1HK9 A;  1QCS A;  4C0Z A;  3RES A;  1PM3 A;  1N9R A;  1IRX A;  4PK4 A;  4J6W A;  1GFC A;  2DE0 X;  2MF2 A;  3OBY A;  1K73 U;  2EBP A;  3BW1 A;  3I55 Q;  2DFU A;  2QDL A;  4JRQ A;  5GAN d;  1WPY A;  3EHQ A;  4AS1 A;  3J81 E;  3LH0 A;  2YVL A;  4E7L A;  3H0F A;  3OYF A;  2MIO A;  5DLQ E;  1CSK A;  1WQW A;  3QWX X;  3JB9 F;  1OU8 A;  2LQK A;  1OUL A;  2FL7 A;  3GF5 A;  2VKN A;  4M75 B;  3D7S B;  1X01 A;  3CMA T;  4R55 A;  2E6Z A;  4E7S A;  2V8I A;  1D0Y A;  1C1A A;  2E5K A;  1S72 Q;  5GMK j;  5GAN 7;  2M0Y A;  1IRE B;  2FG0 A;  1M2V A;  5CQX A;  2JN0 A;  4QQG A;  4LDW A;  1M1G A;  2DD5 A;  3J80 E;  2RHI A;  1X6G A;  2GTJ A;  3ME9 A;  4KO8 A;  1K9M U;  3BE3 A;  2L3P A;  3CPW S;  2ZPF B;  3NHN A;  1QVG P;  3DB3 A;  3H6Z A;  3HFN A;  1KK7 A;  1LOJ A;  2MCN A;  4FM4 B;  3CC4 Q;  2RB6 A;  4FW1 A;  4OML A;  3VYG A;  2GQI A;  5J3B A;  1O54 A;  2ZZD A;  5FU6 C;  3S3N A;  1VQ4 T;  2QA4 A;  4M7A C;  3QC8 A;  3ZGZ A;  1FMW A;  3EGD A;  1GBQ A;  2A3L A;  2A37 A;  3CBM A;  4EMH A;  1Q95 G;  5GAO p;  2YLB A;  3OYD A;  5C1B A;  4OGC A;  1QCO A;  2JS0 A;  3OYG A;  1YNZ A;  3CCQ A;  1VQL A;  5CCA A;  5I2M A;  2VWF A;  3M4Y A;  2LP5 A;  3CCE A;  1G3Y A;  3JB9 J;  3CCS T;  5FWB A;  2JS2 A;  4AQ7 A;  2HD0 A;  1V76 A;  4ARI A;  1I5L A;  1GCQ C;  1QKW A;  2NUZ A;  4LD6 A;  1Q82 R;  1QKX A;  3HU1 A;  2RD1 A;  3ZL7 C;  3PE0 A;  2MWP A;  4RUG A;  4QKU A;  3LH5 A;  1W2B A;  3MET A;  3G7Z A;  2DVJ A;  4KGV B;  1YWO A;  4OF1 A;  2GBQ A;  3BDL A;  1OPL A;  2LZ6 B;  1AWO A;  2DO3 A;  2LNV A;  2P4T A;  3BY7 A;  4PJO A;  2CP7 A;  2MPX C;  5GAM h;  1O75 A;  2NUT A;  1K73 C;  1BI1 A;  1WHG A;  4M78 E;  4M77 A;  4J6X A;  1LJO A;  5IXF A;  3CCE T;  4GBQ A;  1WHJ A;  2H3J A;  4EMK B;  2GTO A;  1Y71 A;  1ZLM A;  2SRC A;  5GMK l;  2X3X D;  3E9G A;  3NTK A;  2NYS A;  3JCM J;  1VIF A;  1FX7 A;  4BD3 A;  1WLF A;  4DBQ A;  4EMK C;  1VQ9 Q;  1Y0M A;  2DKG A;  2K3X A;  3A8G B;  3A8L B;  4C5G A;  4HVW A;  2LX7 A;  2EAY A;  2JJ9 A;  3CBO A;  4E7Z A;  4Y28 E;  3M55 A;  3JCM W;  1ZA1 B;  4AFZ C;  4PFP A;  3LGA A;  4JZ3 A;  2CT3 A;  5GLF A;  2HDA A;  2L0A A;  3M0S A;  1UGP B;  2O9S A;  3CCQ Q;  1VQL Q;  2XKO C;  1B34 A;  2O2O A;  2K5L A;  3JCM c;  2VC8 A;  2P4R A;  1VQ5 T;  4WTO B;  1P92 A;  2EYQ A;  1Q81 C;  4V2S A;  3HHT B;  3RBB B;  5ECA A;  2AIR B;  4OMP A;  4F17 A;  4E7K A;  2PWY A;  1W6X A;  1C0M A;  4IIM A;  1X6B A;  6AT1 B;  5LJ3 e;  2X4J A;  1EFN A;  1I0C A;  2PNI A;  2QEX Q;  4M78 B;  1K76 A;  4QQ6 A;  2L3R A;  2NUP A;  3PIP A;  1U3O A;  2RHY A;  3MPU B;  3X28 B;  2KXD A;  2KRN A;  5LJ3 f;  1TTH B;  2M51 A;  2CUB A;  2RJC A;  1S72 T;  1KFZ A;  3OYM A;  1I4K 1;  3QO3 A;  2K3Y A;  3OYK A;  2GGR A;  1EIF A;  4LDV A;  3ZFJ A;  3OYH A;  2SEM A;  2DVE A;  4R0K A;  2RK2 A;  2M0O A;  3NGP A;  1KC8 C;  4HVU A;  1ZA2 B;  1M1F A;  5A0D A;  1QLY A;  4MML A;  2CZ7 B;  5GAN 2;  2XID A;  3KFV A;  4ORZ A;  4XU0 A;  1UJ0 A;  1VYV A;  2LVM A;  1KD1 R;  5LJ3 d;  2FPE A;  1H3Z A;  4J9G A;  5ERG B;  2QXF A;  3VS4 A;  4B6M A;  1CKB A;  4F7U B;  1VQN A;  2ED0 A;  1NPR A;  3M59 A;  2EJF A;  5FW9 A;  2XHC A;  2AKK A;  1KIK A;  4M7D B;  1ABQ A;  1JJ2 P;  1VQM A;  3QSU A;  2EYW A;  1X43 A;  2CZ6 B;  2QEX A;  3HPW A;  2J6K A;  2R5M A;  3G1J A;  4PJO G;  2EIF A;  3TRE A;  4BY6 B;  4M75 G;  5GAN g;  4M77 G;  1VQ7 A;  2LQW A;  5J39 A;  1KC8 R;  5DM7 R;  1OOT A;  2YUJ A;  1Z9Z A;  2EVR A;  1VQO Q;  2A0F B;  1IGU A;  4BDY A;  2KVQ G;  4OMM A;  1NM7 A;  1XTD A;  1B7T A;  1BYM A;  1OYX A;  3WVD B;  2PTK A;  4XTZ A;  4DEY A;  2RN8 A;  1M8M A;  1YJ9 A;  1D0Z A;  4JRP A;  1ZUY A;  1ZHI A;  1RI9 A;  4FCY A;  2W0Z A;  2OI3 A;  4FW2 A;  4PJO E;  1UHC A;  2WAC A;  5DYI A;  2JXB A;  1ABO A;  2YRC A;  5CCB A;  3AHU A;  1LNX A;  2BTT A;  3VS0 A;  1H64 1;  3QJY A;  3Q1J A;  4FSS A;  1KC8 U;  3H0H A;  1UGV A;  1QVG S;  4M7A B;  1YIJ T;  2HAX A;  4A63 B;  2P0K A;  1WHH A;  1MMG A;  3CPW A;  4C92 C;  3LX7 A;  2CH4 A;  1Y07 A;  5EC7 A;  5J26 A;  3UPU A;  2K6D A;  4BAC A;  3JB9 G;  2CT4 A;  3EGX A;  4RG8 A;  5LJ3 g;  1KQS S;  2LRQ A;  4C0F A;  1XNI A;  4J5Y A;  3RKX A;  3V7S A;  4OB2 B;  3CXC P;  4LE9 A;  2RNA A;  2HCK A;  3SWN B;  1UFF A;  2CP0 A;  2H8H A;  2KYM A;  4KUD K;  2MM0 A;  2F69 A;  3CCR A;  1GRI A;  2M1H A;  1IO6 A;  5FTK A;  1AHJ B;  3TU4 K;  1Y96 B;  5KYW A;  5KCO A;  4J6Y A;  2EWN A;  5A2Q E;  3A1P A;  4XTU A;  3JCM h;  1K9A A;  1ZSG A;  1UEC A;  2RQV A;  4NL3 A;  2KXC A;  3M58 A;  3JCM Q;  1VQM T;  3VRZ A;  3MEU A;  4CI0 C;  1QP3 A;  3E1S A;  3CPW P;  5A0L A;  1Q7Y U;  3GNG A;  1MMD A;  1WZO A;  3L2V A;  1HXD A;  2ENM A;  3VV0 A;  1QVP A;  3JCM X;  3QBY A;  4C5H A;  1Z9Q A;  4DEX A;  4IUR A;  1BI3 A;  1AZG B;  3L2Z A;  2VXF A;  1VQK Q;  2DL3 A;  2AKL A;  3M0Q A;  3FPT A;  1ZSZ A;  1WHM A;  2PVG B;  2CDT A;  4D8K A;  1U5S A;  1MHN A;  1RAG B;  1ZSZ B;  1G2B A;  1JJ2 S;  4KH0 B;  2BZX A;  2OTJ A;  3A8H B;  2V1R A;  5GAO r;  3EG0 A;  5GAN f;  3JCM V;  2IPO B;  2PVO B;  2QAS A;  3CCL T;  1S72 A;  1N27 A;  1VQP A;  1W2B S;  3CCU A;  3H9N A;  3OS5 A;  4NOY A;  1JRI A;  1D3B B;  1YJW T;  2AK5 A;  3OYJ A;  3CCV Q;  2C0T A;  1KHI A;  2ZPH B;  2XDB A;  2BKD N;  2FZG B;  1MNE A;  1X2Q A;  2BE7 D;  4AG1 C;  1M1K C;  4LUD A;  2PZ1 A;  4L59 A;  2LCS A;  2KR3 A;  2EQI A;  2RJE A;  1R77 A;  3PIO A;  4UC4 A;  4OMO A;  3RKY A;  5GAN h;  3OS2 A;  3JSC A;  4M7A G;  1NEB A;  1UGQ B;  3UWN A;  2QQ9 A;  1PSE A;  2F5K A;  2ESW A;  3BQB A;  1RAF B;  3CCM Q;  1W1F A;  2ABL A;  3IQL A;  4IUP A;  3X26 B;  1M2V B;  5KYW B;  4A4K A;  3HU3 A;  2V1Q A;  2LW6 A;  2ZPB B;  4A4E A;  3CD6 A;  2MI6 A;  3E19 A;  1YI2 Q;  4LDX A;  5CR2 A;  4J9E A;  1X2K A;  2PUK B;  1M1K R;  5FTJ A;  1NYF A;  2JMA A;  1TH7 A;  1RAC B;  1VA7 A;  3SFM A;  1KQS P;  2Q18 X;  1VUB A;  1R0C B;  3QJ6 A;  2E1H A;  2HL5 C;  3CCJ T;  2OAW A;  2OTJ T;  1IB8 A;  3MKD A;  2DL7 A;  2KT1 A;  2FYK A;  3I5S A;  2QK0 A;  1GL5 A;  2F1L A;  4XTV A;  2KEA A;  2HBW A;  2LCC A;  1MMA A;  5KE3 A;  3VS6 A;  3X25 B;  1AEY A;  4KRT A;  3OMC A;  2ZGW A;  3FPR A;  2FPF A;  4KDL A;  4X34 A;  2NUP B;  2L8D A;  4XTY A;  3MEW A;  1QVF P;  4PJO B;  3I56 T;  1NJI C;  2JM9 A;  2RH2 A;  3G6E T;  1YHQ A;  1WHK A;  2BIV A;  1QVF S;  3M0T A;  5DY9 A;  2KMT A;  1WI7 A;  4ZTF A;  2RHZ A;  3DB4 A;  4M75 C;  3ASK A;  2ATC B;  4HT8 A;  3RMS A;  3WVE B;  4N4G A;  2RHX A;  3MO8 A;  2QDY B;  2HSE B;  2LNH B;  4C8Q G;  3LW5 E;  2ECZ A;  1JB0 E;  3FIF A;  1VQP T;  2HMA A;  3EHR A;  4C8Q E;  5EQJ B;  3CCL A;  3VU3 C;  4FIB A;  3H0I A;  2RO0 A;  4RG2 A;  1IZ6 A;  2KBT A;  2DET A;  2VVK A;  1PKT A;  3M54 A;  2CRE A;  4M7D E;  4JRK A;  4DQ2 A;  4N0A A;  1MND A;  5KYN A;  1WJR A;  3M5A A;  3HFO A;  3PT9 A;  1IGQ A;  2E3H A;  1KSW A;  2BZY A;  2YHT A;  4OB0 B;  4OB3 B;  2KE9 A;  3DKM A;  4A53 A;  1QCN A;  3OYE A;  3LYI A;  2EJ9 A;  1E6H A;  1ZBX A;  5GMK e;  5GAM e;  3M56 A;  4C92 F;  2IIM A;  2YLC A;  3EFR A;  1WA7 A;  2O4X B;  2P84 A;  1K1Z A;  1M3A A;  1F1B B;  1OV3 A;  2J06 A;  4BB7 A;  1BK2 A;  4Z88 A;  3JCM b;  1QQJ A;  2K5I A;  1W2B P;  4M7D A;  2COW A;  4HXJ A;  5HY6 A;  1G3S A;  1ZUK A;  4EPC A;  4PLI A;  5LJ5 h;  3QDF A;  3O8V A;  4DBH A;  4BE1 A;  4QW2 A;  3TVT A;  1WHL A;  1RAI B;  4TVR A;  1TU0 B;  1RL2 A;  2G3R A;  1K8A R;  4FT4 A;  4RTW A;  1B3Q A;  2HL3 A;  2AT1 B;  2QI2 A;  1E32 A;  5DYG A;  2CP6 A;  2F5T X;  4J9B A;  3I56 A;  5GAO q;  3CMA A;  1Q82 U;  1NE8 A;  2KYB A;  2E65 A;  4RCC A;  3G6E A;  1YHQ T;  2C0I A;  4OP0 A;  3SHW A;  2G6F X;  4ZGD B;  2K3B A;  3CCQ T;  1VQL T;  4M78 A;  3MP8 A;  3SD4 A;  1Q86 R;  5IN1 A;  1UGS B;  1QMC A;  1DJ7 B;  2EW3 A;  3C0C A;  3CCS Q;  1FMV A;  1MV0 B;  4ZNX A;  3SEM A;  3RDV A;  1UEB A;  1SG5 A;  4QQD A;  2ZPI B;  5LJ5 j;  2XI9 A;  3C94 A;  1Q7Y R;  3EGU A;  3L1A A;  4BE2 A;  1SSH A;  2DTH A;  2OTJ Q;  1VQ5 Q;  4GY5 A;  4M77 F;  5KYX A;  1KJW A;  3EG9 B;  2FO0 A;  4M75 D;  1U8R A;  1IHW A;  1VQ9 T;  3C4S A;  4M75 A;  2GFU A;  3V8J A;  3QDR B;  3OMG A;  4C8Q C;  2HZY A;  3CCE Q;  4O6J A;  3ZBD A;  1KD1 C;  2EGC A;  1FMK A;  5GAN 3;  4C5I A;  2RA2 A;  1X75 C;  4C92 G;  1NYG A;  4AFQ C;  4ELZ C;  4PNO A;  1GFD A;  3G4S T;  1NZ9 A;  1T3S A;  2JM8 A;  3VRY A;  1WXB A;  4M7A F;  2M16 A;  1QDN A;  1M27 C;  1SEM A;  3CCU T;  3GNF B;  3S6W A;  2LJ1 A;  4K11 A;  4M7D F;  4FYV B;  2XMF A;  5IT9 E;  1KQ1 A;  3MHX A;  3RER A;  2MAM A;  2OTL T;  1NG2 A;  3CD6 Q;  1N9S A;  2K2V A;  2DJQ A;  5IHI A;  4F7U F;  2D8H A;  4OB1 B;  5HKC A;  3CEY A;  5CKF A;  3RMQ A;  2F2W A;  2O9V A;  1RAD B;  5CKE A;  4XAX B;  2BZ8 A;  4RMO A;  2FPD A;  4M77 D;  5CKH A;  3P8D A;  4ZTJ A;  3HRS A;  4F7U E;  3LWH A;  4N4I A;  4WF2 A;  1UDL A;  2I0N A;  2P0Q A;  4J7I A;  3EG2 A;  2CKK A;  4C8Q F;  1VQ5 A;  3RNJ A;  1I81 A;  4LD9 K;  3CXC A;  1AWJ A;  1R0B G;  4M78 D;  3C12 A;  2HBP A;  4D8D A;  4QVC A;  1VQ6 T;  3O5Z A;  5M9O A;  3L2Q A;  4MZP A;  3PMT A;  2DEU A;  1W4S A;  1VIE A;  4F04 B;  5CIU A;  2JVV A;  5KCH A;  5FWC A;  3P8H A;  4Z8A A;  3I55 A;  4M7D C;  4J7F A;  4C0D C;  4PLL A;  5GMK m;  4XTW A;  3TSW A;  2AHJ B;  1MUZ A;  2K9G A;  5HK3 A;  2RQU A;  3T9N A;  3OW2 S;  4PFO A;  2DYI A;  2Z0W A;  2IG0 A;  2DXB A;  4FYY B;  3CC7 A;  1RI0 A;  1S3S A;  5D7U A;  5GAN 5;  4M75 E;  2DIG A;  3MP1 A;  3REB B;  3MJX A;  2RI2 A;  2RK1 A;  4ESR A;  5IH2 A;  2YSQ A;  4D6W A;  2E70 A;  5GAO m;  2CP5 A;  3NPF A;  1WGS A;  2XDP A;  1WLP B;  3KXT A;  1LPL A;  1YIT A;  1PNJ A;  4OMQ A;  4KBM B;  2EYX A;  2RPN A;  3I55 T;  4HKE A;  4XU3 A;  1OPK A;  1VQO T;  1YP5 A;  7AT1 B;  3CC4 A;  5AYF A;  2R5A A;  2M9U A;  1J3T A;  1M90 U;  1UG1 A;  4ARC A;  1Q82 C;  2DLP A;  3G71 A;  5GAN j;  3UT1 A;  1G83 A;  1SHF A;  3A8M B;  1YJN T;  1D0X A;  2HKQ B;  1NJI U;  2E5Q A;  3OA6 A;  3CCV A;  3CC2 A;  1OZ2 A;  4C92 E;  1X69 A;  1M3B A;  5DLO A;  5IHK A;  1UHF A;  1VQK A;  4C8Q A;  5GMK i;  4C8Q B;  3JB9 D;  2EYZ A;  3CC7 T;  1YIJ Q;  3G4S Q;  2COY A;  3OYY A;  2GF7 A;  1K9M C;  4M77 B;  2FRW A;  3I35 A;  4PJO C;  2CH4 W;  4O5V A;  5CAI A;  4M7A A;  4ANJ A;  2OTL Q;  4M77 C;  3TCJ A;  2P0P A;  3EG9 A;  1PKS A;  3EG3 A;  1N8R U;  2L3Q A;  5CKB A;  1BIB A;  3NFC A;  4IUQ A;  3EGX B;  3FJP A;  3RKW A;  1D1B A;  2KRS A;  2A08 A;  2J6F A;  2E64 A;  3CCS A;  2M02 A;  5CKD A;  3FB9 A;  4FYX B;  5LJ3 j;  3OBW A;  5CQY A;  3SWN A;  1WDX A;  2CS7 A;  3OW2 P;  3VS2 A;  3GPL A;  1GBR A;  5GAM g;  1RLQ C;  1WXT A;  4RTY A;  4WCI A;  3M0R A;  4M7D G;  2HEQ A;  4FU6 A;  2CZ1 B;  4RKU E;  3QUI A;  4M7D D;  5GAN 6;  1SSF A;  3UDC A;  3EH2 A;  3G71 Q;  1B07 A;  1IXD A;  4F14 A;  2YXY A;  1OI1 A;  3TSZ A;  2JV2 A;  1JQQ A;  3I9Q A;  3THK A;  1BCO A;  5D6W A;  2DZ9 A;  3CCJ A;  2RMO A;  3MEV A;  2K57 A;  4KDI A;  3QQ8 A;  3KBG A;  1EX4 A;  2X35 A;  4L5G A;  4CC2 A;  2J6O A;  3CCM T;  1G3W A;  4IIO A;  1I07 A;  3MCA B;  3X24 B;  4BI3 A;  2D0Q B;  2B86 A;  2A7Y A;  4JJB A;  5KYU A;  2CUD A;  1UTI A;  4ME7 A;  4BE0 A;  2LDM A;  5EPP A;  1PRL C;  1ARK A;  1WX6 A;  3LLR A;  3ZJV A;  2DRM A;  2MWO A;  2VGM A;  2Y4Y A;  4IKF A;  1K73 R;  2O88 A;  2DNU A;  1OX9 A;  3OS1 A;  1SHG A;  3R6O A;  4ZN3 A;  2RI3 A;  1Q7Y C;  4M7A D;  2WSC E;  1VYU A;  5FU6 B;  3BDU A;  4RV0 A;  1LVK A;  2O4X A;  2XDD A;  1NLO C;  1KQS A;  4OMF B;  2JUF A;  2JZ2 A;  1ACM B;  1WXU A;  4LDU A;  4Z89 A;  1TS9 A;  2RF0 A;  1HSQ A;  5EG2 A;  4JZ4 A;  3L2U A;  4PJM A;  4KT0 E;  4CC7 A;  4JJD A;  4B9W A;  4PL6 A;  2GFA A;  1M5Q 1;  3J7A F;  1WNL A;  2EQU A;  3WXM B;  2PVD B;  1BIA A;  5I2S A;  2YWW A;  1WJQ A;  2W10 A;  1N5Z A;  3HRU A;  4XU2 A;  1O9S A;  2FEI A;  1Q81 U;  5CK9 A;  2X9H A;  4C0D B;  1MMN A;  2XD0 A;  1V1C A;  1NEG A;  4RTZ A;  2QAZ A;  2DER A;  2E4H A;  3A8O B;  4X9D A;  3CC7 Q;  2JMC A;  4KGZ B;  1N8R C;  3FC3 A;  4AMC A;  4HCB A;  3LGL A;  4R56 A;  5GAM j;  5GAN 8;  4RCB A;  3JV3 A;  5I21 A;  3OYN A;  3HRT A;  4E7I A;  1K0S A;  1OU9 A;  3JCM d;  2EGE A;  4C5E A;  1PHT A;  4FT2 A;  2H3E B;  5GJW B;  3MP6 A;  2DK3 A;  5GAM d;  3I5R A;  3QPH A;  5LJ5 d;  2FHD A;  2F2X A;  3CC2 T;  2DXT A;  2KAF A;  3PMI A;  4BUG A;  5LJ5 f;  2K2M A;  1I8F A;  5GAM f;  4RTU A;  1AD5 A;  2Q1A X;  3CBP A;  3OYC A;  4F7U A;  4LDY A;  5FRO A;  3I56 Q;  5L8R E;  1AWW A;  3JCM f;  3M0U A;  1D1A A;  1RAE B;  3EG1 A;  1YN8 A;  2AZS A;  3HSB A;  3L2R A;  3LWI A;  4QT7 A;  3CPF A;  2HQE A;  1K0X A;  4E7H A;  2OJ2 A;  2D9T A;  2FZC B;  3G71 T;  1VOM A;  2NUT B;  2CSQ A;  1G5V A;  2QGF B;  4A4F A;  1YBY A;  4GLK A;  4X9C A;  1TUC A;  1QWF A;  3N5B B;  3JCM e;  4J9H A;  4C92 D;  1LCK A;  1VQ8 Q;  1YJ9 T;  4DBF A;  4JRI A;  2DTO A;  4OGE A;  4EIK A;  1FWZ A;  2KNB B;  2E6N A;  1QVF A;  1OX8 A;  2ZPG B;  3OSS C;  2RHU A;  3OYA A;  2DBK A;  2HQH A;  3GLX A;  2JTF A;  2V8K A;  3RR6 A;  1UB4 A;  2XU8 A;  1JXO A;  1TWB A;  3GBQ A;  3LGF A;  2D6F A;  1QWE A;  3CCR Q;  2I2L A;  1R7R A;  1M9S A;  2LQN A;  4N0A C;  1M3C A;  3BFM A;  2OAU A;  5L23 A;  5AT1 B;  1OZ3 A;  1PWT A;  2L5Q A;  2DL4 A;  4MDW A;  4KOD A;  4M77 E;  1I5O B;  5GAO l;  1M90 C;  1FXX A;  4CQN A;  1SKU B;  4J9D A;  4FL6 A;  4ZN1 A;  1VQ6 A;  4PJL A;  2EFI A;  5GAO n;  1RUW A;  3TEE A;  2DRK A;  1N8R R;  2LT4 A;  2EQK A;  1S1N A;  2NWM A;  4J8O A;  1M8V A;  2A28 A;  1CZ4 A;  4JS4 A;  2XG8 D;  2MYS A;  1WYX A;  1QW1 A;  2PU9 B;  3X20 B;  2LMJ A;  3A5Z B;  4M75 F;  4HVV A;  3EH1 A;  2LJ3 A;  3HL8 A;  3UA6 A;  5LJ3 h;  3DLL A;  1PG5 B;  3ULR B;  2LX9 A;  3OS0 A;  1VQN Q;  3FLG A;  1GCP A;  2DJZ A;  3RIR A;  3EAE A;  2RQT A;  4FYW B;  1VQM Q;  5KYX B;  4BY6 C;  2EKH A;  1X27 A;  2D1X A;  5FU7 C;  1VQ7 Q;  8AT1 B;  1K9M R;  4DOV A;  2Q1C X;  3EFS A;  1RAA B;  2CSI A;  2B8A A;  2YT6 A;  4MDX A;  3CF2 A;  3E2U A;  3PVQ A;  1Y57 A;  5KYY B;  4Y92 A;  1W70 A;  1M1K U;  3CCU Q;  1BU1 A;  2HNI A;  2D0N A;  2DXC A;  2GCX A;  1UGR B;  4FSX A;  1UE9 A;  1T0H A;  1VQK T;  3PGG A;  5LJ5 g;  2KI7 A;  3CCR T;  1GXI E;  1ZX6 A;  5FTM A;  2RQR A;  3QG1 A;  2Y4X A;  3MB5 A;  2KT8 A;  2YUP A;  1VQ6 Q;  2X4Y A;  5FRM A;  4E47 A;  2FRY A;  3CMA Q;  3P8B B;  2XIC A;  3ZEH A;  4ATO A;  4OMN A;  3L2W A;  4L6V 5;  2NLU A;  1YI2 A;  4NS5 A;  2Q19 X;  2EKO A;  3M53 A;  3H8Z A;  2CZ0 B;  4VUB A;  4KH1 B;  3VUB A;  4P5N A;  5C18 A;  1KG1 A;  4F16 A;  3QWZ A;  1YIT T;  5HCK A;  1Q86 C;  2EYY A;  3OY9 A;  3OYB A;  1YIJ A;  1M30 A;  1PC0 A;  3QZ9 B;  4M7A E;  1D3B A;  1JO8 A;  3QYH B;  5KYU B;  3ZJU A;  2X51 A;  4C92 A;  1Y7X A;  5HK0 A;  2DBM A;  4PKC C;  4DBR A;  1VQ4 Q;  4DA4 A;  4KUL A;  4IUT A;  3DLM A;  3EGD B;  3REA B;  1KD1 U;  2JNG A;  2DEQ A;  1VQ8 T;  5B6C A;  2AZV A;  3VS3 A;  3U23 A;  4M4Z A;  1RAB B;  2RJF A;  2YDL A;  1QP2 A;  2YUN A;  1GCQ A;  1EZZ B;  5FTN A;  2L89 A;  4A4G A;  4AG2 C;  4J83 A;  3SDZ A;  4N4H A;  1Q81 R;  4JLG A;  4DOW A;  2QQR A;  1PRM C;  2YUO A;  3CCL Q;  2R57 A;  3OB9 A;  5LL6 S;  4II1 A;  2DMO A;  2LQ8 A;  4IUU A;  2QEX T;  2Y90 A;  4ZGE B;  2LC4 A;  3VJP A;  4HCC A;  3HP9 A;  4M78 F;  2V8J A;  4XK8 E;  3SB2 A;  2RJD A;  5KE2 A;  2MK5 A;  3F70 A;  4LUE A;  3CME Q;  5D6Y A;  2ZAE A;  2ZPE B;  3TIW A;  5I11 A;  1Y96 A;  2BUD A;  4A4H A;  3OW2 A;  5A0G A;  4EMK A;  3HU2 A; 
#chains in the Genus database with same CATH homology
 1OI1 A;  1PSF A;  4OGC A;  5KE3 A;  3OYG A;  2JV2 A;  3X25 B;  3ER0 A;  3CCQ A;  1VQL A;  5CCA A;  1K8A U;  5D6W A;  2DZ9 A;  2ZGW A;  3OMC A;  5I2M A;  3CCJ A;  3FPR A;  3S3M A;  3ZJT A;  3M4Y A;  3MEV A;  4KDL A;  3CCE A;  2K57 A;  4KDI A;  2QA4 T;  4X34 A;  1G3Y A;  1M4Z A;  3QQ8 A;  2L8D A;  3KBG A;  4XTY A;  3JB9 J;  3QXE B;  3CCS T;  2VYT A;  2X35 A;  4L5G A;  3MEW A;  4PJO B;  2X4X A;  2HD0 A;  2WSE E;  3I56 T;  4AQ7 A;  4ARI A;  1I5L A;  2DAQ A;  3C95 A;  4LD6 A;  1NJI C;  2RH2 A;  3G6E T;  3MEA A;  1YHQ A;  3CCM T;  1G3W A;  2BIV A;  3MCA B;  3X24 B;  1QVF S;  3HU1 A;  4BI3 A;  2D0Q B;  2RD1 A;  5DY9 A;  2JTM A;  2DD4 A;  2KMT A;  2A7Y A;  2MWP A;  1VQ7 T;  3V7C A;  4ZTF A;  3JB9 I;  4ME7 A;  1W2B A;  4BE0 A;  3MET A;  3G7Z A;  2RHZ A;  2LDM A;  3DB4 A;  4M75 C;  5EPP A;  4OF1 A;  3ASK A;  1YCY A;  2PUO B;  1ZQ1 A;  2RM4 A;  3CXC S;  3BDL A;  4HT8 A;  3RMS A;  3OYI A;  2FB7 A;  2R58 A;  3LLR A;  2DTI A;  2DO3 A;  3WVE B;  2MWO A;  2VGM A;  3ZJV A;  2LNV A;  2Y4Y A;  2P4T A;  3BY7 A;  3CCM A;  4IKF A;  4PJO A;  4N4G A;  2RHX A;  4JUV A;  3MO8 A;  4KUI A;  5GAM h;  1VQ9 A;  2QDY B;  1O75 A;  4KLN A;  3OS1 A;  1K73 C;  2QTX A;  4C8Q G;  3LW5 E;  3R6O A;  1JB0 E;  1BI1 A;  2RI3 A;  3FIF A;  4M78 E;  4M77 A;  4J6X A;  4ZN3 A;  1VQP T;  4C8Q E;  5EQJ B;  1Q7Y C;  3VU3 C;  3CCL A;  1LJO A;  4FIB A;  3CCE T;  3QHS A;  4B9X A;  2RO0 A;  4M7A D;  2WSC E;  4RG2 A;  1IZ6 A;  5FU6 B;  2H3J A;  3BDU A;  4EMK B;  4RV0 A;  1Y71 A;  5GMK l;  3M54 A;  3E9G A;  3NTK A;  3JCM J;  4M7D E;  1VIF A;  1FX7 A;  2O4X A;  3M4G A;  4JRK A;  4BD3 A;  4DQ2 A;  4N0A A;  2XDD A;  3CME A;  1KQS A;  4OMF B;  1WLF A;  1WJR A;  2JUF A;  3M5A A;  2K3X A;  2DKG A;  2JZ2 A;  2VUB A;  3A8G B;  3A8L B;  3HFO A;  3PT9 A;  3CC2 T;  2E41 A;  4C5G A;  2YHT A;  1KHC A;  4LDU A;  4OB0 B;  2C06 A;  2EAY A;  4OB3 B;  4HA8 A;  3CBO A;  4JLI A;  3V7R A;  3DKM A;  4JJN K;  2X4W A;  4A53 A;  2DIQ A;  4Y28 E;  3M55 A;  5EG2 A;  3LHD A;  3L2U A;  3JCM W;  3E9F A;  3FRN A;  2VXE A;  3INZ A;  4KT0 E;  3V8K A;  3OYE A;  1QVG A;  3LYI A;  3LGA A;  1NPP A;  5GAN 4;  4ELY C;  2EJ9 A;  3CME T;  4B9W A;  1JBM A;  3VUZ A;  3S3O A;  1ZBX A;  5GMK e;  5GLF A;  5GAM e;  3M56 A;  4PL6 A;  4C92 F;  2GFA A;  2FVU A;  1M5Q 1;  1UGP B;  2YLC A;  3J7A F;  2XKO C;  1WNL A;  2EQU A;  2IVW A;  3EFR A;  2O4X B;  3M9Q A;  1B34 A;  2PVD B;  1BIA A;  3KUF A;  3WXM B;  4ZGJ B;  5I2S A;  4BI8 B;  2K5L A;  1WJS A;  3JCM c;  4BB7 A;  2VC8 A;  1WJQ A;  1K8A C;  4MZT A;  3VYH B;  1VQ5 T;  1KQ2 A;  3JCM b;  1P92 A;  1N6A A;  2EYQ A;  1Q81 C;  4V2S A;  2K5I A;  3HRU A;  4XU2 A;  2DPP B;  3HHT B;  3RER A;  4M7D A;  1MGQ A;  1O9S A;  1I9G A;  1Q81 U;  5CK9 A;  4E7K A;  4C0D B;  2XD0 A;  2PWY A;  3PTA A;  5HY6 A;  5FU7 B;  3A8O B;  5LJ3 e;  4X9D A;  1G3S A;  2X4J A;  4EPC A;  3OYL A;  4PLI A;  3HKS A;  2EQM A;  5LJ5 h;  3O8V A;  4M78 B;  3GOX A;  4BE1 A;  4QW2 A;  4QQ6 A;  2L3R A;  4HT9 A;  1N8R C;  3FC3 A;  3PIP A;  4HCB A;  2RHY A;  3LGL A;  4TVR A;  4IUV A;  1RL2 A;  2G3R A;  3X28 B;  4FT4 A;  4C8Q D;  4R56 A;  5GAM j;  5LJ3 f;  4M78 G;  1G3T A;  4QVZ A;  5GAN 8;  4Z02 A;  2QI2 A;  4RCB A;  3OQ5 A;  5I21 A;  3OYN A;  3HRT A;  4E7I A;  1E32 A;  2RJC A;  5DYG A;  2F5T X;  3JCM d;  3JCM P;  1S72 T;  2XK0 A;  3I56 A;  4C5E A;  4FT2 A;  5FLX E;  3QII A;  2HQX A;  5GAO q;  3OYM A;  1I4K 1;  4CRI A;  3QO3 A;  3CMA A;  3MP6 A;  1Q82 U;  1NE8 A;  2K3Y A;  2LTO A;  2DK3 A;  3JRZ A;  5GAM d;  3OYK A;  2E65 A;  4RCC A;  1EIF A;  4LDV A;  3G6E A;  1YHQ T;  3QPH A;  5LJ5 d;  2FHD A;  4OP0 A;  4ZGD B;  1YJW A;  2DXT A;  2KAF A;  3PMI A;  3ZFJ A;  4BUG A;  4M78 A;  3MP8 A;  3SD4 A;  5LJ5 f;  3OYH A;  3CCQ T;  1I8F A;  5IN1 A;  5GAM f;  1UGS B;  2DVE A;  2RK2 A;  1DJ7 B;  2M0O A;  4A54 A;  3CBP A;  2Q1A X;  3OYC A;  3PNW C;  1KC8 C;  4F7U A;  1U1T A;  1M1F A;  4LDY A;  5FRO A;  5A0D A;  3GP8 A;  5L8R E;  4JDS A;  4MML A;  2CZ7 B;  1UEB A;  3JCM f;  2KY9 A;  5GAN 2;  1CR5 A;  2XID A;  4XU0 A;  4QQD A;  3VKI A;  2LVM A;  3FEO A;  3HSB A;  2ZPI B;  5LJ3 d;  3LWI A;  3L2R A;  5LJ5 j;  1H3Z A;  3CPF A;  4E7J A;  2HQE A;  5ERG B;  3QKJ A;  2XI9 A;  2QXF A;  4PJO F;  3C94 A;  3L1A A;  4BE2 A;  1WQ7 A;  2DTH A;  4E7H A;  2D9T A;  4F7U B;  4GY5 A;  3G71 T;  4M77 F;  3FPU A;  2QQA A;  1VQN A;  1G5V A;  3M59 A;  1NPR A;  1VQ4 A;  3JB9 H;  4A4F A;  1YBY A;  4GLK A;  2EJF A;  2E12 A;  2O01 E;  4M75 D;  2XHC A;  4X9C A;  1U8R A;  4M7D B;  5CCX A;  3N5B B;  1VQ9 T;  2Q1D X;  3C4S A;  4M75 A;  3JCM e;  1VQO A;  1VQM A;  4C92 D;  3QSU A;  4M78 C;  2GFU A;  2K5F A;  3QZ5 B;  3V8J A;  3QDR B;  2CZ6 B;  3OMG A;  2QEX A;  1YJ9 T;  4C8Q C;  4JRI A;  3HPW A;  2LCL A;  2DTO A;  2R5M A;  4O6J A;  4OGE A;  4PJO G;  3ZBD A;  2EIF A;  1KD1 C;  1FWZ A;  2CGH A;  2WSF E;  5LJ5 e;  1B34 B;  2E6N A;  3TRE A;  1QVF A;  4QVD A;  4BY6 B;  4M75 G;  5GAN 3;  2ZPG B;  5GAN g;  4C5I A;  4M77 G;  3OSS C;  2RHU A;  2YRV A;  3GLX A;  2RA2 A;  3OYA A;  1X75 C;  2VGN A;  1VQ7 A;  5J39 A;  2JOY A;  2JTF A;  5DM7 R;  2YUJ A;  4XU1 A;  4BDZ A;  2V8K A;  1UB4 A;  2XU8 A;  4C92 G;  4ELZ C;  4PNO A;  3LGF A;  3G4S T;  1X6O A;  2D6F A;  1VQ8 A;  2KK4 A;  1NZ9 A;  5C0M A;  2I2L A;  4M7A F;  2M16 A;  2MMP A;  2EJG A;  1M9S A;  4N0A C;  3NTI A;  4EMK A;  2KVQ G;  3GNF B;  3S6W A;  3CCU T;  4BDY A;  3CD6 A;  4M7D F;  3BFM A;  1XTD A;  2OAU A;  1BYM A;  1OYX A;  5IT9 E;  2KQW A;  1OZ3 A;  4XTZ A;  1KQ1 A;  2E10 A;  3MHX A;  3WVD B;  2L5Q A;  2LT1 A;  2MAM A;  2PQW A;  3OSV A;  3URG A;  2OTL T;  3FDR A;  1N9S A;  2K2V A;  1XOV A;  4MDW A;  4KOD A;  4M77 E;  5FTL A;  4F7U F;  5GAO l;  1YJ9 A;  1M90 C;  1FXX A;  4JRP A;  4OB1 B;  5HKC A;  4CQN A;  3CEY A;  1ZHI A;  4FL6 A;  5CKF A;  4JS5 A;  3RMQ A;  4PJO E;  5CKE A;  4XAX B;  4ZN1 A;  4RMO A;  3CCV T;  1VQ6 A;  3GIB A;  2WAC A;  4M77 D;  2B25 A;  5CKH A;  5DYI A;  3P8D A;  1YJN A;  1QDN A;  2EFI A;  4ZTJ A;  5CCB A;  3AHU A;  5C6S A;  3HRS A;  5GAO n;  4NL2 A;  1LNX A;  4F7U E;  3TEE A;  2LT4 A;  1H64 1;  2EQK A;  2EQJ A;  3QJY A;  4J8O A;  1M8V A;  3Q1J A;  2ZCF B;  3LWH A;  1KC8 U;  1CZ4 A;  4N4I A;  2XG8 D;  4WF2 A;  4JS4 A;  2P0Q A;  4C0G A;  1QVG S;  2MM2 A;  4J7I A;  3CC4 T;  4M7A B;  1YIJ T;  1QW1 A;  2CKK A;  3NTH A;  4C8Q F;  2PU9 B;  4EDU A;  1VQ5 A;  2HAX A;  1R7R A;  1XQH A;  1I81 A;  2P0K A;  4MZM A;  3CXC A;  3X20 B;  4LD9 K;  3CPW A;  1BI2 A;  4C92 C;  4M78 D;  3C12 A;  3OS2 A;  3A5Z B;  2HBP A;  4M75 F;  3CD6 T;  2PJH B;  1BKB A;  3LX7 A;  4Y91 A;  1Y07 A;  3HL8 A;  5J26 A;  1JJ2 A;  3UPU A;  5LJ3 h;  3DLL A;  4BAC A;  2QQB A;  3JB9 G;  4QVC A;  2KSS A;  2LX9 A;  3OS0 A;  1VQ6 T;  2DXU A;  5M9O A;  5CVI A;  4RG8 A;  3L2Q A;  3FLG A;  5LJ3 g;  1KQS S;  4MZP A;  4Q5W A;  3JCM g;  2LRQ A;  4C0F A;  1XNI A;  2DJZ A;  3RIR A;  4J5Y A;  3PMT A;  1YI2 T;  1W4S A;  3V8L A;  1VIE A;  3RKX A;  3EAE A;  3V7S A;  5CIU A;  2JVV A;  5KCH A;  4OB2 B;  3P8H A;  3I55 A;  3M57 A;  4BY6 C;  1VQL T;  4M7D C;  4J7F A;  4C0D C;  4PLL A;  3SWN B;  5GMK m;  1ZC1 A;  4XTW A;  5FU7 C;  1V29 B;  1BI0 A;  3L42 A;  4DOV A;  2RI5 A;  2AHJ B;  2Q1C X;  3EFS A;  5C1B A;  2B8A A;  4OVA A;  5HK3 A;  4MDX A;  3G4S A;  3SWN C;  3CF2 A;  4KUD K;  3RUX A;  2MM0 A;  2F69 A;  4BI4 A;  2M1H A;  3CCR A;  5FTK A;  1M1K U;  1AHJ B;  5D6X A;  3TU4 K;  3T9N A;  1Y96 B;  3OW2 S;  1Q86 U;  3PFS A;  5KCO A;  5CO7 A;  2HNI A;  2OTL A;  1U1S A;  2IG0 A;  2DXB A;  3QYG B;  3CC7 A;  4J6Y A;  2EWN A;  2DXC A;  5A2Q E;  1RI0 A;  1UGR B;  2GCX A;  4XTU A;  4FSX A;  3JCM h;  4F7U G;  1S3S A;  5GAN 5;  1VQK T;  3PGG A;  4M75 E;  5LJ5 g;  2DIG A;  5IAY A;  3MP1 A;  4NL3 A;  4PJO D;  3M58 A;  2CYZ B;  2RI2 A;  5GAN e;  4HCZ A;  3JCM Q;  2RK1 A;  3CCR T;  4CI0 C;  3MEU A;  1VQM T;  1GXI E;  1R8O B;  4D6W A;  5FTM A;  2E70 A;  1QP3 A;  3QG1 A;  3E1S A;  5GAO m;  5KH6 A;  2Y4X A;  5A0L A;  3MB5 A;  1WGS A;  4YTL A;  1Q7Y U;  4XQ3 A;  2XDP A;  2GQV A;  2KDS A;  3KXT A;  3QQ7 A;  3GNG A;  1VQN T;  1YIT A;  2X4Y A;  4MMK A;  5FRM A;  2DZC A;  4E47 A;  3L2V A;  2K4Y A;  3P8B B;  4KBM B;  3I55 T;  1HXD A;  2XIC A;  4HKE A;  2QQS A;  5FRN A;  3ZEH A;  4XU3 A;  3VV0 A;  1QVP A;  4C92 B;  3JCM X;  3L2W A;  3QBY A;  1VQO T;  4ATO A;  4L6V 5;  2NLU A;  4C5H A;  1YI2 A;  4NS5 A;  2Q19 X;  2EKO A;  3M53 A;  3H8Z A;  4XTX A;  2CZ0 B;  3CC4 A;  4VUB A;  4IUR A;  3JAM E;  1BI3 A;  3VUB A;  5AYF A;  2R5A A;  4P5N A;  2M9U A;  1CZ5 A;  3L2Z A;  2VXF A;  4EMG A;  1M90 U;  5C18 A;  5GMK h;  4ARC A;  1Q82 C;  1KG1 A;  3G71 A;  5GAN j;  3FPT A;  5CD1 A;  3UT1 A;  3QWZ A;  1YIT T;  2PVG B;  2VV5 A;  1Q86 C;  1MHN A;  1HK9 A;  3OY9 A;  1QCS A;  3OYB A;  3A8M B;  1YJN T;  1YIJ A;  4C0Z A;  1NJI U;  3QZ9 B;  4M7A E;  3RES A;  1N9R A;  1D3B A;  2E5Q A;  3OA6 A;  3CCV A;  3CC2 A;  1OZ2 A;  4C92 E;  4J6W A;  2MF2 A;  3OBY A;  3QYH B;  3ZJU A;  1K73 U;  5DLO A;  4C92 A;  1JJ2 S;  1Y7X A;  2OTJ A;  3A8H B;  3BW1 A;  5HK0 A;  4PKC C;  5GAO r;  5GAN f;  1VQK A;  3JCM V;  4C8Q A;  5GMK i;  2PVO B;  5GAN d;  4C8Q B;  3CCL T;  4JRQ A;  3JB9 D;  4DA4 A;  1S72 A;  1N27 A;  4KUL A;  1VQP A;  1WPY A;  3DLM A;  4IUT A;  3CC7 T;  4AS1 A;  3J81 E;  1W2B S;  1KD1 U;  3LH0 A;  3CCU A;  2YVL A;  4E7L A;  2JNG A;  2DEQ A;  3OS5 A;  3OYF A;  4NOY A;  1JRI A;  5DLQ E;  1D3B B;  1WQW A;  1YJW T;  1VQ8 T;  5B6C A;  3OYJ A;  3JB9 F;  3OYY A;  2GF7 A;  1K9M C;  2LQK A;  3GF5 A;  2FL7 A;  4M77 B;  1KHI A;  4PJO C;  2RJF A;  4M75 B;  2ZPH B;  4O5V A;  1X01 A;  3CMA T;  5CAI A;  1QP2 A;  4R55 A;  2XDB A;  4M7A A;  2E6Z A;  2BKD N;  2V8I A;  1M1K C;  4M77 C;  3TCJ A;  2P0P A;  4L59 A;  5GMK j;  5GAN 7;  1N8R U;  5CKB A;  5FTN A;  1IRE B;  1BIB A;  3NFC A;  2RJE A;  3PIO A;  4IUQ A;  4UC4 A;  2L89 A;  5CQX A;  2JN0 A;  3FJP A;  4A4G A;  4J83 A;  4N4H A;  4QQG A;  3RKY A;  4LDW A;  3JSC A;  1M1G A;  3RKW A;  1UGQ B;  3SDZ A;  3UWN A;  5GAN h;  2QQ9 A;  1PSE A;  2DD5 A;  4M7A G;  4JLG A;  3J80 E;  2RHI A;  2F5K A;  4DOW A;  2QQR A;  3BQB A;  3ME9 A;  4KO8 A;  2R57 A;  3OB9 A;  1K9M U;  4IUP A;  3X26 B;  2E64 A;  5LL6 S;  4II1 A;  4EMK C;  3CPW S;  4A4K A;  2ZPF B;  3CCS A;  5CKD A;  3HU3 A;  2LW6 A;  2ZPB B;  3FB9 A;  4A4E A;  3DB3 A;  3H6Z A;  2LQ8 A;  3HFN A;  3OBW A;  4IUU A;  2MI6 A;  3E19 A;  5CQY A;  3SWN A;  5LJ3 j;  5CR2 A;  2QEX T;  2Y90 A;  2CS7 A;  1LOJ A;  4LDX A;  4ZGE B;  2PUK B;  4FM4 B;  2RB6 A;  5FTJ A;  2LC4 A;  3GPL A;  3VYG A;  3VJP A;  4HCC A;  3HP9 A;  4M78 F;  2V8J A;  4XK8 E;  5J3B A;  5GAM g;  2ZZD A;  1O54 A;  1TH7 A;  3SB2 A;  5FU6 C;  2RJD A;  5KE2 A;  3S3N A;  4M7D G;  1VQ4 T;  3SFM A;  3F70 A;  4FU6 A;  2CZ1 B;  2QA4 A;  4M7A C;  4RKU E;  2Q18 X;  3QUI A;  5D6Y A;  3QC8 A;  1VUB A;  4M7D D;  3ZGZ A;  3QJ6 A;  2E1H A;  1SSF A;  5GAN 6;  3CCJ T;  2OTJ T;  2ZPE B;  3TIW A;  3UDC A;  2A3L A;  2FYK A;  3CBM A;  4EMH A;  1Y96 A;  2BUD A;  4A4H A;  3OW2 A;  5A0G A;  5GAO p;  2YLB A;  3OYD A;  4XTV A;  2LCC A;  3HU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...