3QC8A

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qc8A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qc8A02
3CF2A 1CR5A 1S3SA 1TWFA 2NYAA 1E18A 4KODA 2JIPA 2R92A 1UHDA 5FTKA 1Q16A 2VPYA 4AONB 2JIRA 2JIQA 1FDIA 1CZ5A 4DMRA 1PYUB 3TIWA 1E32A 1PYQA 2E2IA 3GTPA 1H0HA 1PQEA 4GA6A 1E60A 3HU3A 1H5NA 1EU1A 2JIOA 1SIWA 4AAYA 3GTKA 1KQFA 2VPXA 3IR7A 1Y4ZA 5DYGA 3OUGA 1E61A 4AZDA 2VPZA 4RV0A 2VUMA 1PPYA 1PQHA 4KDLA 4CRYG 3DMRA 3QC8A 1PQFA 1AW8B 5C1BA 1CZ4A 1WCMA 3ML1A 1QDNA 2IV2X 4D7ZB 2NVXA 2JA7A 1R7RA 1UHEA 3IR6A 2WB1A 1I50A 1QCSA 2E7ZA 3GTOA 1TWAA 1TMOA 3TM7B 2PJHB 2Y0SA 3H0GA 4KO8A 3CQZA 3GTQA 3QQ8A 2B63A 5FTNA 3HKZA 2NVYA 2R93A 2VPWA 4KDIA 2NAPA 4GA5A 2JIMA 5B6CA 4AYBA 3GTGA 4AOKB 2V45A 3FKIA 2JV2A 3PLXB 2DMRA 4CRZA 1SFOA 2YU9A 3QQ7A 5FTJA 5DYIA 3QWZA 1Y5IA 3HU2A 2R7ZA 1R9TA 2YUJA 1ZC1A 3GTMA 1K83A 5T5MD 1KQGA 5FTLA 4C2MA 1VC3B 5GLFA 1YLEA 1PT0A 3O5AA 5C18A 2KI8A 1OGYA 1G8KA 1FDOA 1DMRA 2C45A 1TWGA 2V3VA 1Y1WA 1R27A 1DMSA 1IW7D 4CS0A 3GTLA 4QIWA 1E5VA 1TWCA 2EEOB 5EPPA 3GTJA 5FTMA 4KLNA 5T5ID 3IR5A 1PT1A 1WLFA 1Y1VA 1AA6A 2JA5A 2WAQA 2JA6A 2PMZA 3HU1A 1G8JA 1I3QA 1TWHA 2E2HA
chains in the Genus database with same CATH superfamily
3CF2A 1CR5A 1S3SA 1TWFA 3X2PA 3ZJUA 2NYAA 1E18A 4KODA 4ZM7A 1I9GA 1YNJD 2JIPA 2R92A 3FPUA 2AE0X 1UHDA 5FTKA 2O5JD 4FG2A 2ENGA 1Q16A 2VPYA 4AVRA 4FG4A 2Q1AX 4AONB 2JIRA 3SUMA 2JIQA 4JP7A 2G5DA 1FDIA 5H4UA 1CZ5A 4DMRA 1PYUB 3TIWA 1E32A 1PYQA 2E2IA 3GTPA 1H0HA 1PQEA 4GA6A 1O54A 1E60A 1ZYRD 3HU3A 1H5NA 1EU1A 3MB5A 2JIOA 1SIWA 4AAYA 2PWYA 3GTKA 1KQFA 2VPXA 3IR7A 1Y4ZA 3X2OA 2QQRA 5DYGA 3OUGA 1L8FA 5D6XA 2CW0D 1E61A 4AZDA 2VPZA 4NOHA 4RV0A 2B25A 2VUMA 1PPYA 4FERA 1PQHA 2A69D 4KDLA 4CRYG 2YVLA 3DMRA 3QC8A 2A6ED 1PQFA 3X2LA 1AW8B 3FPTA 2MM2A 1YNND 3X2KA 1CZ4A 1WCMA 3ML1A 5C1BA 1QDNA 2IV2X 4D7ZB 2A68D 3SUJA 2NVXA 2JA7A 1R7RA 1UHEA 3FPRA 3IR6A 2WB1A 1I50A 1QCSA 2E7ZA 3GTOA 1TWAA 1TMOA 3TM7B 4FIBA 2PJHB 4ENGA 2Y0SA 3H0GA 4KO8A 3CQZA 4JJOA 3GTQA 3QQ8A 2B63A 5FTNA 4AQ7A 2PI8A 3HKZA 2NVYA 2R93A 2VPWA 1OA9A 4KDIA 2NAPA 4GA5A 2JIMA 5B6CA 4AYBA 3GTGA 3SULA 3D30A 3X2MA 4AOKB 5D6YA 5CCBA 2V45A 3FKIA 2JV2A 1HD5A 3PLXB 3X2GA 5EQJB 2DMRA 4CRZA 1SFOA 2YU9A 3QQ7A 5FTJA 5CD1A 5DYIA 3QWZA 2LW6A 1Y5IA 3HU2A 4ARIA 2R7ZA 1R9TA 3X2JA 2YUJA 4CQNA 5D6WA 2A6HD 1ZC1A 3ZGZA 3GTMA 3X2NA 2GFAA 4JP6A 2Q19X 1K83A 5T5MD 3X2IA 1KQGA 3ZJVA 5FTLA 4C2MA 4JCWA 1VC3B 4JS7A 5GLFA 1YLEA 1PT0A 3O5AA 5C18A 2KI8A 5GLXA 1OGYA 1G8KA 1BW3A 5GM9A 1FDOA 1DMRA 2QQSA 3CZBA 2GF7A 2BH0A 2C45A 2XDPA 1TWGA 3ZJTA 4UC4A 2V3VA 2BE5D 3LGAA 2HCZX 1Y1WA 3LHDA 1R27A 1DMSA 1IW7D 4L48A 5GLYA 4CS0A 2MM0A 5CCXA 1OA7A 3SUKA 3GTLA 4ARCA 3ENGA 1BW4A 5ERGB 4QIWA 2PICA 1E5VA 2KQAA 1WC2A 1TWCA 2EEOB 5EPPA 3GTJA 2Q1DX 5FTMA 1N10A 1SMYD 4KLNA 2GAEA 2PNWA 5T5ID 3IR5A 1PT1A 1WLFA 1Y1VA 3X2HA 1AA6A 2JA5A 3BQBA 2WAQA 4AS1A 4FFTA 2PJJA 2JA6A 2G6GA 3M3GA 2PMZA 2Q1CX 3HU1A 2KY9A 2Q18X 1G8JA 1I3QA 1TWHA 2E2HA
chains in the Genus database with same CATH topology
3CF2A 1CR5A 1S3SA 1TWFA 3ZJUA 2NYAA 1E18A 4KODA 1I9GA 1YNJD 2JIPA 2R92A 3FPUA 2AE0X 1UHDA 5FTKA 2O5JD 1Q16A 2VPYA 2Q1AX 4AONB 2JIRA 2JIQA 2G5DA 1FDIA 1CZ5A 4DMRA 1PYUB 3TIWA 1E32A 1PYQA 2E2IA 3GTPA 1H0HA 1PQEA 4GA6A 1O54A 1E60A 1ZYRD 3HU3A 1H5NA 1EU1A 3MB5A 2JIOA 1SIWA 4AAYA 2PWYA 3GTKA 1KQFA 2VPXA 3IR7A 1Y4ZA 2QQRA 5DYGA 3OUGA 5D6XA 2CW0D 1E61A 4AZDA 2VPZA 4NOHA 4RV0A 2B25A 2VUMA 1PPYA 1PQHA 2A69D 4KDLA 4CRYG 2YVLA 3DMRA 3QC8A 2A6ED 1PQFA 1AW8B 3FPTA 2MM2A 1YNND 5C1BA 1CZ4A 1WCMA 3ML1A 1QDNA 2IV2X 4D7ZB 2A68D 2NVXA 2JA7A 1R7RA 1UHEA 3FPRA 3IR6A 2WB1A 1I50A 1QCSA 2E7ZA 3GTOA 1TWAA 1TMOA 3TM7B 4FIBA 2PJHB 2Y0SA 3H0GA 4KO8A 3CQZA 3GTQA 3QQ8A 2B63A 5FTNA 4AQ7A 2PI8A 3HKZA 2NVYA 2R93A 2VPWA 4KDIA 2NAPA 4GA5A 2JIMA 5B6CA 4AYBA 3GTGA 4AOKB 5CCBA 5D6YA 2V45A 3FKIA 2JV2A 3PLXB 5EQJB 2DMRA 4CRZA 1SFOA 2YU9A 3QQ7A 5FTJA 5CD1A 5DYIA 3QWZA 2LW6A 1Y5IA 3HU2A 4ARIA 2R7ZA 1R9TA 4CQNA 2YUJA 5D6WA 2A6HD 1ZC1A 3ZGZA 3GTMA 2GFAA 2Q19X 1K83A 5T5MD 1KQGA 3ZJVA 5FTLA 4C2MA 1VC3B 5GLFA 1YLEA 1PT0A 3O5AA 5C18A 2KI8A 1OGYA 1G8KA 1FDOA 1DMRA 2QQSA 3CZBA 2GF7A 2C45A 2XDPA 1TWGA 3ZJTA 4UC4A 2V3VA 2BE5D 3LGAA 1Y1WA 3LHDA 1R27A 1DMSA 1IW7D 4CS0A 2MM0A 5CCXA 4ARCA 3GTLA 5ERGB 4QIWA 2PICA 1E5VA 1TWCA 2EEOB 5EPPA 3GTJA 2Q1DX 5FTMA 1SMYD 4KLNA 2GAEA 2PNWA 5T5ID 3IR5A 1PT1A 1WLFA 1Y1VA 1AA6A 2JA5A 3BQBA 4AS1A 2WAQA 2JA6A 2PJJA 2G6GA 2PMZA 2Q1CX 3HU1A 2KY9A 2Q18X 1G8JA 1I3QA 1TWHA 2E2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CF2 A;  1CR5 A;  1S3S A;  1TWF A;  2NYA A;  1E18 A;  4KOD A;  2JIP A;  2R92 A;  1UHD A;  5FTK A;  1Q16 A;  2VPY A;  4AON B;  2JIR A;  2JIQ A;  1FDI A;  1CZ5 A;  4DMR A;  1PYU B;  3TIW A;  1E32 A;  1PYQ A;  2E2I A;  3GTP A;  1H0H A;  1PQE A;  4GA6 A;  1E60 A;  3HU3 A;  1H5N A;  1EU1 A;  2JIO A;  1SIW A;  4AAY A;  3GTK A;  1KQF A;  2VPX A;  3IR7 A;  1Y4Z A;  5DYG A;  3OUG A;  1E61 A;  4AZD A;  2VPZ A;  4RV0 A;  2VUM A;  1PPY A;  1PQH A;  4KDL A;  4CRY G;  3DMR A;  3QC8 A;  1PQF A;  1AW8 B;  5C1B A;  1CZ4 A;  1WCM A;  3ML1 A;  1QDN A;  2IV2 X;  4D7Z B;  2NVX A;  2JA7 A;  1R7R A;  1UHE A;  3IR6 A;  2WB1 A;  1I50 A;  1QCS A;  2E7Z A;  3GTO A;  1TWA A;  1TMO A;  3TM7 B;  2PJH B;  2Y0S A;  3H0G A;  4KO8 A;  3CQZ A;  3GTQ A;  3QQ8 A;  2B63 A;  5FTN A;  3HKZ A;  2NVY A;  2R93 A;  2VPW A;  4KDI A;  2NAP A;  4GA5 A;  2JIM A;  5B6C A;  4AYB A;  3GTG A;  4AOK B;  2V45 A;  3FKI A;  2JV2 A;  3PLX B;  2DMR A;  4CRZ A;  1SFO A;  2YU9 A;  3QQ7 A;  5FTJ A;  5DYI A;  3QWZ A;  1Y5I A;  3HU2 A;  2R7Z A;  1R9T A;  2YUJ A;  1ZC1 A;  3GTM A;  1K83 A;  5T5M D;  1KQG A;  5FTL A;  4C2M A;  1VC3 B;  5GLF A;  1YLE A;  1PT0 A;  3O5A A;  5C18 A;  2KI8 A;  1OGY A;  1G8K A;  1FDO A;  1DMR A;  2C45 A;  1TWG A;  2V3V A;  1Y1W A;  1R27 A;  1DMS A;  1IW7 D;  4CS0 A;  3GTL A;  4QIW A;  1E5V A;  1TWC A;  2EEO B;  5EPP A;  3GTJ A;  5FTM A;  4KLN A;  5T5I D;  3IR5 A;  1PT1 A;  1WLF A;  1Y1V A;  1AA6 A;  2JA5 A;  2WAQ A;  2JA6 A;  2PMZ A;  3HU1 A;  1G8J A;  1I3Q A;  1TWH A;  2E2H A; 
#chains in the Genus database with same CATH topology
 3CF2 A;  1CR5 A;  1S3S A;  1TWF A;  3X2P A;  3ZJU A;  2NYA A;  1E18 A;  4KOD A;  4ZM7 A;  1I9G A;  1YNJ D;  2JIP A;  2R92 A;  3FPU A;  2AE0 X;  1UHD A;  5FTK A;  2O5J D;  4FG2 A;  2ENG A;  1Q16 A;  2VPY A;  4AVR A;  4FG4 A;  2Q1A X;  4AON B;  2JIR A;  3SUM A;  2JIQ A;  4JP7 A;  2G5D A;  1FDI A;  5H4U A;  1CZ5 A;  4DMR A;  1PYU B;  3TIW A;  1E32 A;  1PYQ A;  2E2I A;  3GTP A;  1H0H A;  1PQE A;  4GA6 A;  1O54 A;  1E60 A;  1ZYR D;  3HU3 A;  1H5N A;  1EU1 A;  3MB5 A;  2JIO A;  1SIW A;  4AAY A;  2PWY A;  3GTK A;  1KQF A;  2VPX A;  3IR7 A;  1Y4Z A;  3X2O A;  2QQR A;  5DYG A;  3OUG A;  1L8F A;  5D6X A;  2CW0 D;  1E61 A;  4AZD A;  2VPZ A;  4NOH A;  4RV0 A;  2B25 A;  2VUM A;  1PPY A;  4FER A;  1PQH A;  2A69 D;  4KDL A;  4CRY G;  2YVL A;  3DMR A;  3QC8 A;  2A6E D;  1PQF A;  3X2L A;  1AW8 B;  3FPT A;  2MM2 A;  1YNN D;  3X2K A;  1CZ4 A;  1WCM A;  3ML1 A;  5C1B A;  1QDN A;  2IV2 X;  4D7Z B;  2A68 D;  3SUJ A;  2NVX A;  2JA7 A;  1R7R A;  1UHE A;  3FPR A;  3IR6 A;  2WB1 A;  1I50 A;  1QCS A;  2E7Z A;  3GTO A;  1TWA A;  1TMO A;  3TM7 B;  4FIB A;  2PJH B;  4ENG A;  2Y0S A;  3H0G A;  4KO8 A;  3CQZ A;  4JJO A;  3GTQ A;  3QQ8 A;  2B63 A;  5FTN A;  4AQ7 A;  2PI8 A;  3HKZ A;  2NVY A;  2R93 A;  2VPW A;  1OA9 A;  4KDI A;  2NAP A;  4GA5 A;  2JIM A;  5B6C A;  4AYB A;  3GTG A;  3SUL A;  3D30 A;  3X2M A;  4AOK B;  5D6Y A;  5CCB A;  2V45 A;  3FKI A;  2JV2 A;  1HD5 A;  3PLX B;  3X2G A;  5EQJ B;  2DMR A;  4CRZ A;  1SFO A;  2YU9 A;  3QQ7 A;  5FTJ A;  5CD1 A;  5DYI A;  3QWZ A;  2LW6 A;  1Y5I A;  3HU2 A;  4ARI A;  2R7Z A;  1R9T A;  3X2J A;  2YUJ A;  4CQN A;  5D6W A;  2A6H D;  1ZC1 A;  3ZGZ A;  3GTM A;  3X2N A;  2GFA A;  4JP6 A;  2Q19 X;  1K83 A;  5T5M D;  3X2I A;  1KQG A;  3ZJV A;  5FTL A;  4C2M A;  4JCW A;  1VC3 B;  4JS7 A;  5GLF A;  1YLE A;  1PT0 A;  3O5A A;  5C18 A;  2KI8 A;  5GLX A;  1OGY A;  1G8K A;  1BW3 A;  5GM9 A;  1FDO A;  1DMR A;  2QQS A;  3CZB A;  2GF7 A;  2BH0 A;  2C45 A;  2XDP A;  1TWG A;  3ZJT A;  4UC4 A;  2V3V A;  2BE5 D;  3LGA A;  2HCZ X;  1Y1W A;  3LHD A;  1R27 A;  1DMS A;  1IW7 D;  4L48 A;  5GLY A;  4CS0 A;  2MM0 A;  5CCX A;  1OA7 A;  3SUK A;  3GTL A;  4ARC A;  3ENG A;  1BW4 A;  5ERG B;  4QIW A;  2PIC A;  1E5V A;  2KQA A;  1WC2 A;  1TWC A;  2EEO B;  5EPP A;  3GTJ A;  2Q1D X;  5FTM A;  1N10 A;  1SMY D;  4KLN A;  2GAE A;  2PNW A;  5T5I D;  3IR5 A;  1PT1 A;  1WLF A;  1Y1V A;  3X2H A;  1AA6 A;  2JA5 A;  3BQB A;  2WAQ A;  4AS1 A;  4FFT A;  2PJJ A;  2JA6 A;  2G6G A;  3M3G A;  2PMZ A;  2Q1C X;  3HU1 A;  2KY9 A;  2Q18 X;  1G8J A;  1I3Q A;  1TWH A;  2E2H A; 
#chains in the Genus database with same CATH homology
 3CF2 A;  1CR5 A;  1S3S A;  1TWF A;  3ZJU A;  2NYA A;  1E18 A;  4KOD A;  1I9G A;  1YNJ D;  2JIP A;  2R92 A;  3FPU A;  2AE0 X;  1UHD A;  5FTK A;  2O5J D;  1Q16 A;  2VPY A;  2Q1A X;  4AON B;  2JIR A;  2JIQ A;  2G5D A;  1FDI A;  1CZ5 A;  4DMR A;  1PYU B;  3TIW A;  1E32 A;  1PYQ A;  2E2I A;  3GTP A;  1H0H A;  1PQE A;  4GA6 A;  1O54 A;  1E60 A;  1ZYR D;  3HU3 A;  1H5N A;  1EU1 A;  3MB5 A;  2JIO A;  1SIW A;  4AAY A;  2PWY A;  3GTK A;  1KQF A;  2VPX A;  3IR7 A;  1Y4Z A;  2QQR A;  5DYG A;  3OUG A;  5D6X A;  2CW0 D;  1E61 A;  4AZD A;  2VPZ A;  4NOH A;  4RV0 A;  2B25 A;  2VUM A;  1PPY A;  1PQH A;  2A69 D;  4KDL A;  4CRY G;  2YVL A;  3DMR A;  3QC8 A;  2A6E D;  1PQF A;  1AW8 B;  3FPT A;  2MM2 A;  1YNN D;  5C1B A;  1CZ4 A;  1WCM A;  3ML1 A;  1QDN A;  2IV2 X;  4D7Z B;  2A68 D;  2NVX A;  2JA7 A;  1R7R A;  1UHE A;  3FPR A;  3IR6 A;  2WB1 A;  1I50 A;  1QCS A;  2E7Z A;  3GTO A;  1TWA A;  1TMO A;  3TM7 B;  4FIB A;  2PJH B;  2Y0S A;  3H0G A;  4KO8 A;  3CQZ A;  3GTQ A;  3QQ8 A;  2B63 A;  5FTN A;  4AQ7 A;  2PI8 A;  3HKZ A;  2NVY A;  2R93 A;  2VPW A;  4KDI A;  2NAP A;  4GA5 A;  2JIM A;  5B6C A;  4AYB A;  3GTG A;  4AOK B;  5CCB A;  5D6Y A;  2V45 A;  3FKI A;  2JV2 A;  3PLX B;  5EQJ B;  2DMR A;  4CRZ A;  1SFO A;  2YU9 A;  3QQ7 A;  5FTJ A;  5CD1 A;  5DYI A;  3QWZ A;  2LW6 A;  1Y5I A;  3HU2 A;  4ARI A;  2R7Z A;  1R9T A;  4CQN A;  2YUJ A;  5D6W A;  2A6H D;  1ZC1 A;  3ZGZ A;  3GTM A;  2GFA A;  2Q19 X;  1K83 A;  5T5M D;  1KQG A;  3ZJV A;  5FTL A;  4C2M A;  1VC3 B;  5GLF A;  1YLE A;  1PT0 A;  3O5A A;  5C18 A;  2KI8 A;  1OGY A;  1G8K A;  1FDO A;  1DMR A;  2QQS A;  3CZB A;  2GF7 A;  2C45 A;  2XDP A;  1TWG A;  3ZJT A;  4UC4 A;  2V3V A;  2BE5 D;  3LGA A;  1Y1W A;  3LHD A;  1R27 A;  1DMS A;  1IW7 D;  4CS0 A;  2MM0 A;  5CCX A;  4ARC A;  3GTL A;  5ERG B;  4QIW A;  2PIC A;  1E5V A;  1TWC A;  2EEO B;  5EPP A;  3GTJ A;  2Q1D X;  5FTM A;  1SMY D;  4KLN A;  2GAE A;  2PNW A;  5T5I D;  3IR5 A;  1PT1 A;  1WLF A;  1Y1V A;  1AA6 A;  2JA5 A;  3BQB A;  4AS1 A;  2WAQ A;  2JA6 A;  2PJJ A;  2G6G A;  2PMZ A;  2Q1C X;  3HU1 A;  2KY9 A;  2Q18 X;  1G8J A;  1I3Q A;  1TWH A;  2E2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...