3QC8A

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 48
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qc8A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qc8A02
1SFOA 2YU9A 1Y5IA 1CZ4A 1Q16A 2PJHB 1PQEA 3QWZA 3HU3A 1SIWA 3HU2A 3QQ7A 2JIPA 1PQHA 3GTKA 4AZDA 1TWGA 1I50A 5FTMA 2VPYA 1KQFA 5T5MD 2E2HA 2YUJA 1R7RA 2JIQA 3FKIA 1UHEA 2R92A 1CZ5A 1E60A 1TWAA 1Y4ZA 2R7ZA 4AONB 1K83A 1Y1VA 5EPPA 1E32A 2JA5A 4AOKB 4DMRA 3GTPA 2B63A 5B6CA 1QCSA 2KI8A 2JIRA 2VPZA 1AW8B 5C18A 3TIWA 3O5AA 1TMOA 3QQ8A 1FDOA 3HU1A 1G8KA 2V45A 2E2IA 1PYUB 1UHDA 4KLNA 5FTLA 2VPXA 3IR6A 1PPYA 1I3QA 2JV2A 1FDIA 1CR5A 2R93A 3PLXB 3OUGA 4AAYA 4CS0A 1IW7D 1KQGA 1AA6A 1DMRA 2NYAA 5DYGA 1Y1WA 2WAQA 2JIMA 3CQZA 3H0GA 1E61A 1PYQA 2WB1A 1OGYA 2PMZA 3IR7A 4GA6A 1R9TA 5T5ID 4D7ZB 2NVYA 2JA6A 2JIOA 2JA7A 3GTQA 4KDLA 1DMSA 1S3SA 2C45A 5C1BA 2NVXA 2VPWA 1E18A 5FTNA 4C2MA 5DYIA 4RV0A 3ML1A 1E5VA 3IR5A 1WCMA 4KO8A 1QDNA 1PT1A 3DMRA 1EU1A 4KODA 4CRZA 5FTJA 5FTKA 4GA5A 3GTMA 1TWFA 2VUMA 1H0HA 1G8JA 2IV2X 1YLEA 1ZC1A 2V3VA 1TWHA 3GTOA 2Y0SA 1R27A 5GLFA 1H5NA 3CF2A 1PQFA 1VC3B 2DMRA 3TM7B 3GTJA 2E7ZA 1PT0A 3GTGA 2NAPA 4CRYG 4QIWA 4KDIA 3GTLA 3QC8A 3HKZA 2EEOB 4AYBA 1TWCA 1WLFA
chains in the Genus database with same CATH superfamily
1SFOA 2YU9A 1Y5IA 1CZ4A 1Q16A 2PJHB 1PQEA 3QWZA 3HU3A 4ARIA 2PI8A 3X2GA 5D6YA 2Q1DX 5D6WA 5EQJB 5ERGB 2QQSA 1SIWA 2GAEA 4FIBA 3HU2A 3QQ7A 4AS1A 1BW4A 2JIPA 3MB5A 3X2OA 1PQHA 3GTKA 4AZDA 1TWGA 4JCWA 1I50A 4L48A 4FERA 2VPYA 5FTMA 5T5MD 3X2HA 1KQFA 2E2HA 2MM0A 5GLXA 1HD5A 1R7RA 2A68D 2CW0D 2JIQA 2YUJA 1UHEA 3FKIA 2R92A 3LGAA 1CZ5A 2Q1CX 3D30A 4ARCA 1E60A 1TWAA 1Y4ZA 3X2PA 2R7ZA 4AONB 1L8FA 1K83A 1Y1VA 1BW3A 5EPPA 1E32A 2JA5A 4AOKB 2PWYA 2QQRA 4DMRA 3GTPA 2B63A 2A69D 5B6CA 1QCSA 2KI8A 2JIRA 2VPZA 1AW8B 3X2KA 5C18A 2PJJA 2BE5D 3TIWA 5GLYA 3O5AA 1TMOA 3QQ8A 1FDOA 3HU1A 3X2MA 4ZM7A 2AE0X 1G8KA 2V45A 2E2IA 3ZJVA 1PYUB 3SULA 3FPTA 1UHDA 2A6ED 4KLNA 2GF7A 2A6HD 2ENGA 5FTLA 2VPXA 2KY9A 3IR6A 1PPYA 1I3QA 5GM9A 2JV2A 1FDIA 1WC2A 1ZYRD 1CR5A 2R93A 3PLXB 3ZGZA 3OUGA 3X2LA 5CD1A 4AAYA 4CS0A 1IW7D 1N10A 4FFTA 1AA6A 1KQGA 1DMRA 2NYAA 1O54A 5DYGA 4NOHA 1Y1WA 2WAQA 2XDPA 5CCBA 2JIMA 3ENGA 3M3GA 3SUMA 2G6GA 3CQZA 3ZJTA 3H0GA 1SMYD 5H4UA 1E61A 1PYQA 2WB1A 4CQNA 1OGYA 2PMZA 3IR7A 3ZJUA 2B25A 4GA6A 1R9TA 5T5ID 4D7ZB 2NVYA 2JA6A 2JIOA 4JP7A 2JA7A 3GTQA 4KDLA 1DMSA 1S3SA 2C45A 5C1BA 2NVXA 3FPUA 2VPWA 3SUJA 1E18A 3LHDA 5FTNA 4C2MA 2HCZX 5DYIA 4RV0A 3ML1A 2Q18X 1E5VA 2Q1AX 3IR5A 2PNWA 3CZBA 4AVRA 1WCMA 2KQAA 4KO8A 1QDNA 2PICA 3X2IA 3BQBA 1PT1A 4ENGA 3DMRA 1EU1A 1YNND 4KODA 2GFAA 1OA9A 4CRZA 5FTJA 5FTKA 4GA5A 3GTMA 1TWFA 2O5JD 2MM2A 2VUMA 1H0HA 2Q19X 1G8JA 3FPRA 4JS7A 2IV2X 3X2JA 2LW6A 1YLEA 1ZC1A 2V3VA 2BH0A 1TWHA 5D6XA 3GTOA 2Y0SA 1R27A 4JJOA 5GLFA 5CCXA 4UC4A 3SUKA 1H5NA 1I9GA 3CF2A 1PQFA 2G5DA 2YVLA 1VC3B 2DMRA 3TM7B 3GTJA 2E7ZA 4AQ7A 4FG4A 1PT0A 4FG2A 1YNJD 2NAPA 4JP6A 4QIWA 4CRYG 4KDIA 3GTGA 3GTLA 3X2NA 3QC8A 3HKZA 2EEOB 1OA7A 4AYBA 1TWCA 1WLFA
chains in the Genus database with same CATH topology
1SFOA 2YU9A 1Y5IA 1CZ4A 1Q16A 2PJHB 1PQEA 3QWZA 3HU3A 4ARIA 2PI8A 5D6YA 5EQJB 2Q1DX 5D6WA 5ERGB 2QQSA 1SIWA 2GAEA 4FIBA 3HU2A 3QQ7A 4AS1A 2JIPA 3MB5A 1PQHA 3GTKA 4AZDA 1TWGA 1I50A 5FTMA 2VPYA 1KQFA 5T5MD 2E2HA 2MM0A 2XDPA 2YUJA 1R7RA 2A68D 2CW0D 2JIQA 3FKIA 1UHEA 2R92A 3LGAA 1CZ5A 2Q1CX 4ARCA 1E60A 1TWAA 1Y4ZA 2R7ZA 4AONB 1K83A 1Y1VA 5EPPA 1E32A 2JA5A 4AOKB 2PWYA 2QQRA 4DMRA 3GTPA 2B63A 2A69D 5B6CA 1QCSA 2KI8A 2JIRA 2VPZA 1AW8B 5C18A 2PJJA 2BE5D 3TIWA 3O5AA 1TMOA 3QQ8A 1FDOA 3HU1A 2AE0X 1G8KA 2V45A 2E2IA 3ZJVA 1PYUB 3FPTA 1UHDA 2A6ED 4KLNA 2GF7A 2A6HD 5FTLA 2VPXA 2KY9A 3IR6A 1PPYA 1I3QA 2JV2A 1FDIA 1ZYRD 1CR5A 2R93A 3PLXB 3ZGZA 3OUGA 5CD1A 4AAYA 4CS0A 1IW7D 1KQGA 1AA6A 1DMRA 2NYAA 1O54A 5DYGA 4NOHA 1Y1WA 2WAQA 5CCBA 2JIMA 2G6GA 3CQZA 3ZJTA 3H0GA 1SMYD 1E61A 1PYQA 2WB1A 4CQNA 1OGYA 2PMZA 3IR7A 3ZJUA 2B25A 4GA6A 1R9TA 5T5ID 4D7ZB 2NVYA 2JA6A 2JIOA 2JA7A 3GTQA 4KDLA 1DMSA 1S3SA 2C45A 5C1BA 2NVXA 3FPUA 2VPWA 1E18A 3LHDA 5FTNA 4C2MA 5DYIA 4RV0A 3ML1A 2Q18X 1E5VA 2Q1AX 3IR5A 2PNWA 3CZBA 1WCMA 4KO8A 3BQBA 1QDNA 2PICA 1PT1A 3DMRA 1EU1A 1YNND 4KODA 2GFAA 4CRZA 5FTJA 5FTKA 4GA5A 3GTMA 1TWFA 2O5JD 2MM2A 2VUMA 1H0HA 2Q19X 1G8JA 3FPRA 2IV2X 2LW6A 1YLEA 1ZC1A 2V3VA 1TWHA 5D6XA 3GTOA 2Y0SA 1R27A 5GLFA 5CCXA 4UC4A 1H5NA 1I9GA 3CF2A 1PQFA 2G5DA 2YVLA 1VC3B 2DMRA 3TM7B 3GTJA 2E7ZA 4AQ7A 1PT0A 3GTGA 2NAPA 4CRYG 4QIWA 4KDIA 3GTLA 3QC8A 3HKZA 2EEOB 1YNJD 4AYBA 1TWCA 1WLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO A;  2YU9 A;  1Y5I A;  1CZ4 A;  1Q16 A;  2PJH B;  1PQE A;  3QWZ A;  3HU3 A;  1SIW A;  3HU2 A;  3QQ7 A;  2JIP A;  1PQH A;  3GTK A;  4AZD A;  1TWG A;  1I50 A;  5FTM A;  2VPY A;  1KQF A;  5T5M D;  2E2H A;  2YUJ A;  1R7R A;  2JIQ A;  3FKI A;  1UHE A;  2R92 A;  1CZ5 A;  1E60 A;  1TWA A;  1Y4Z A;  2R7Z A;  4AON B;  1K83 A;  1Y1V A;  5EPP A;  1E32 A;  2JA5 A;  4AOK B;  4DMR A;  3GTP A;  2B63 A;  5B6C A;  1QCS A;  2KI8 A;  2JIR A;  2VPZ A;  1AW8 B;  5C18 A;  3TIW A;  3O5A A;  1TMO A;  3QQ8 A;  1FDO A;  3HU1 A;  1G8K A;  2V45 A;  2E2I A;  1PYU B;  1UHD A;  4KLN A;  5FTL A;  2VPX A;  3IR6 A;  1PPY A;  1I3Q A;  2JV2 A;  1FDI A;  1CR5 A;  2R93 A;  3PLX B;  3OUG A;  4AAY A;  4CS0 A;  1IW7 D;  1KQG A;  1AA6 A;  1DMR A;  2NYA A;  5DYG A;  1Y1W A;  2WAQ A;  2JIM A;  3CQZ A;  3H0G A;  1E61 A;  1PYQ A;  2WB1 A;  1OGY A;  2PMZ A;  3IR7 A;  4GA6 A;  1R9T A;  5T5I D;  4D7Z B;  2NVY A;  2JA6 A;  2JIO A;  2JA7 A;  3GTQ A;  4KDL A;  1DMS A;  1S3S A;  2C45 A;  5C1B A;  2NVX A;  2VPW A;  1E18 A;  5FTN A;  4C2M A;  5DYI A;  4RV0 A;  3ML1 A;  1E5V A;  3IR5 A;  1WCM A;  4KO8 A;  1QDN A;  1PT1 A;  3DMR A;  1EU1 A;  4KOD A;  4CRZ A;  5FTJ A;  5FTK A;  4GA5 A;  3GTM A;  1TWF A;  2VUM A;  1H0H A;  1G8J A;  2IV2 X;  1YLE A;  1ZC1 A;  2V3V A;  1TWH A;  3GTO A;  2Y0S A;  1R27 A;  5GLF A;  1H5N A;  3CF2 A;  1PQF A;  1VC3 B;  2DMR A;  3TM7 B;  3GTJ A;  2E7Z A;  1PT0 A;  3GTG A;  2NAP A;  4CRY G;  4QIW A;  4KDI A;  3GTL A;  3QC8 A;  3HKZ A;  2EEO B;  4AYB A;  1TWC A;  1WLF A; 
#chains in the Genus database with same CATH topology
 1SFO A;  2YU9 A;  1Y5I A;  1CZ4 A;  1Q16 A;  2PJH B;  1PQE A;  3QWZ A;  3HU3 A;  4ARI A;  2PI8 A;  3X2G A;  5D6Y A;  2Q1D X;  5D6W A;  5EQJ B;  5ERG B;  2QQS A;  1SIW A;  2GAE A;  4FIB A;  3HU2 A;  3QQ7 A;  4AS1 A;  1BW4 A;  2JIP A;  3MB5 A;  3X2O A;  1PQH A;  3GTK A;  4AZD A;  1TWG A;  4JCW A;  1I50 A;  4L48 A;  4FER A;  2VPY A;  5FTM A;  5T5M D;  3X2H A;  1KQF A;  2E2H A;  2MM0 A;  5GLX A;  1HD5 A;  1R7R A;  2A68 D;  2CW0 D;  2JIQ A;  2YUJ A;  1UHE A;  3FKI A;  2R92 A;  3LGA A;  1CZ5 A;  2Q1C X;  3D30 A;  4ARC A;  1E60 A;  1TWA A;  1Y4Z A;  3X2P A;  2R7Z A;  4AON B;  1L8F A;  1K83 A;  1Y1V A;  1BW3 A;  5EPP A;  1E32 A;  2JA5 A;  4AOK B;  2PWY A;  2QQR A;  4DMR A;  3GTP A;  2B63 A;  2A69 D;  5B6C A;  1QCS A;  2KI8 A;  2JIR A;  2VPZ A;  1AW8 B;  3X2K A;  5C18 A;  2PJJ A;  2BE5 D;  3TIW A;  5GLY A;  3O5A A;  1TMO A;  3QQ8 A;  1FDO A;  3HU1 A;  3X2M A;  4ZM7 A;  2AE0 X;  1G8K A;  2V45 A;  2E2I A;  3ZJV A;  1PYU B;  3SUL A;  3FPT A;  1UHD A;  2A6E D;  4KLN A;  2GF7 A;  2A6H D;  2ENG A;  5FTL A;  2VPX A;  2KY9 A;  3IR6 A;  1PPY A;  1I3Q A;  5GM9 A;  2JV2 A;  1FDI A;  1WC2 A;  1ZYR D;  1CR5 A;  2R93 A;  3PLX B;  3ZGZ A;  3OUG A;  3X2L A;  5CD1 A;  4AAY A;  4CS0 A;  1IW7 D;  1N10 A;  4FFT A;  1AA6 A;  1KQG A;  1DMR A;  2NYA A;  1O54 A;  5DYG A;  4NOH A;  1Y1W A;  2WAQ A;  2XDP A;  5CCB A;  2JIM A;  3ENG A;  3M3G A;  3SUM A;  2G6G A;  3CQZ A;  3ZJT A;  3H0G A;  1SMY D;  5H4U A;  1E61 A;  1PYQ A;  2WB1 A;  4CQN A;  1OGY A;  2PMZ A;  3IR7 A;  3ZJU A;  2B25 A;  4GA6 A;  1R9T A;  5T5I D;  4D7Z B;  2NVY A;  2JA6 A;  2JIO A;  4JP7 A;  2JA7 A;  3GTQ A;  4KDL A;  1DMS A;  1S3S A;  2C45 A;  5C1B A;  2NVX A;  3FPU A;  2VPW A;  3SUJ A;  1E18 A;  3LHD A;  5FTN A;  4C2M A;  2HCZ X;  5DYI A;  4RV0 A;  3ML1 A;  2Q18 X;  1E5V A;  2Q1A X;  3IR5 A;  2PNW A;  3CZB A;  4AVR A;  1WCM A;  2KQA A;  4KO8 A;  1QDN A;  2PIC A;  3X2I A;  3BQB A;  1PT1 A;  4ENG A;  3DMR A;  1EU1 A;  1YNN D;  4KOD A;  2GFA A;  1OA9 A;  4CRZ A;  5FTJ A;  5FTK A;  4GA5 A;  3GTM A;  1TWF A;  2O5J D;  2MM2 A;  2VUM A;  1H0H A;  2Q19 X;  1G8J A;  3FPR A;  4JS7 A;  2IV2 X;  3X2J A;  2LW6 A;  1YLE A;  1ZC1 A;  2V3V A;  2BH0 A;  1TWH A;  5D6X A;  3GTO A;  2Y0S A;  1R27 A;  4JJO A;  5GLF A;  5CCX A;  4UC4 A;  3SUK A;  1H5N A;  1I9G A;  3CF2 A;  1PQF A;  2G5D A;  2YVL A;  1VC3 B;  2DMR A;  3TM7 B;  3GTJ A;  2E7Z A;  4AQ7 A;  4FG4 A;  1PT0 A;  4FG2 A;  1YNJ D;  2NAP A;  4JP6 A;  4QIW A;  4CRY G;  4KDI A;  3GTG A;  3GTL A;  3X2N A;  3QC8 A;  3HKZ A;  2EEO B;  1OA7 A;  4AYB A;  1TWC A;  1WLF A; 
#chains in the Genus database with same CATH homology
 1SFO A;  2YU9 A;  1Y5I A;  1CZ4 A;  1Q16 A;  2PJH B;  1PQE A;  3QWZ A;  3HU3 A;  4ARI A;  2PI8 A;  5D6Y A;  5EQJ B;  2Q1D X;  5D6W A;  5ERG B;  2QQS A;  1SIW A;  2GAE A;  4FIB A;  3HU2 A;  3QQ7 A;  4AS1 A;  2JIP A;  3MB5 A;  1PQH A;  3GTK A;  4AZD A;  1TWG A;  1I50 A;  5FTM A;  2VPY A;  1KQF A;  5T5M D;  2E2H A;  2MM0 A;  2XDP A;  2YUJ A;  1R7R A;  2A68 D;  2CW0 D;  2JIQ A;  3FKI A;  1UHE A;  2R92 A;  3LGA A;  1CZ5 A;  2Q1C X;  4ARC A;  1E60 A;  1TWA A;  1Y4Z A;  2R7Z A;  4AON B;  1K83 A;  1Y1V A;  5EPP A;  1E32 A;  2JA5 A;  4AOK B;  2PWY A;  2QQR A;  4DMR A;  3GTP A;  2B63 A;  2A69 D;  5B6C A;  1QCS A;  2KI8 A;  2JIR A;  2VPZ A;  1AW8 B;  5C18 A;  2PJJ A;  2BE5 D;  3TIW A;  3O5A A;  1TMO A;  3QQ8 A;  1FDO A;  3HU1 A;  2AE0 X;  1G8K A;  2V45 A;  2E2I A;  3ZJV A;  1PYU B;  3FPT A;  1UHD A;  2A6E D;  4KLN A;  2GF7 A;  2A6H D;  5FTL A;  2VPX A;  2KY9 A;  3IR6 A;  1PPY A;  1I3Q A;  2JV2 A;  1FDI A;  1ZYR D;  1CR5 A;  2R93 A;  3PLX B;  3ZGZ A;  3OUG A;  5CD1 A;  4AAY A;  4CS0 A;  1IW7 D;  1KQG A;  1AA6 A;  1DMR A;  2NYA A;  1O54 A;  5DYG A;  4NOH A;  1Y1W A;  2WAQ A;  5CCB A;  2JIM A;  2G6G A;  3CQZ A;  3ZJT A;  3H0G A;  1SMY D;  1E61 A;  1PYQ A;  2WB1 A;  4CQN A;  1OGY A;  2PMZ A;  3IR7 A;  3ZJU A;  2B25 A;  4GA6 A;  1R9T A;  5T5I D;  4D7Z B;  2NVY A;  2JA6 A;  2JIO A;  2JA7 A;  3GTQ A;  4KDL A;  1DMS A;  1S3S A;  2C45 A;  5C1B A;  2NVX A;  3FPU A;  2VPW A;  1E18 A;  3LHD A;  5FTN A;  4C2M A;  5DYI A;  4RV0 A;  3ML1 A;  2Q18 X;  1E5V A;  2Q1A X;  3IR5 A;  2PNW A;  3CZB A;  1WCM A;  4KO8 A;  3BQB A;  1QDN A;  2PIC A;  1PT1 A;  3DMR A;  1EU1 A;  1YNN D;  4KOD A;  2GFA A;  4CRZ A;  5FTJ A;  5FTK A;  4GA5 A;  3GTM A;  1TWF A;  2O5J D;  2MM2 A;  2VUM A;  1H0H A;  2Q19 X;  1G8J A;  3FPR A;  2IV2 X;  2LW6 A;  1YLE A;  1ZC1 A;  2V3V A;  1TWH A;  5D6X A;  3GTO A;  2Y0S A;  1R27 A;  5GLF A;  5CCX A;  4UC4 A;  1H5N A;  1I9G A;  3CF2 A;  1PQF A;  2G5D A;  2YVL A;  1VC3 B;  2DMR A;  3TM7 B;  3GTJ A;  2E7Z A;  4AQ7 A;  1PT0 A;  3GTG A;  2NAP A;  4CRY G;  4QIW A;  4KDI A;  3GTL A;  3QC8 A;  3HKZ A;  2EEO B;  1YNJ D;  4AYB A;  1TWC A;  1WLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...