3QC8A

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
b'PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
molecule tags Protein binding
source organism Homo sapiens
publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
total genus 48
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qc8A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qc8A02
5FTMA 1AA6A 3GTLA 3GTOA 4KLNA 2DMRA 1R9TA 5T5MD 1DMRA 1TWAA 3TIWA 1KQGA 1QDNA 1PYUB 1TMOA 1SFOA 1G8KA 3HU2A 2NYAA 5DYGA 1E5VA 3O5AA 4CRZA 2V45A 3IR6A 3QC8A 2Y0SA 4QIWA 3H0GA 2JIPA 1CZ5A 5FTNA 2R93A 2E2HA 2JA6A 2WAQA 2JA5A 3TM7B 2B63A 2VPXA 1TWFA 3GTGA 2VPZA 4KDLA 1G8JA 1CZ4A 2JIRA 4KO8A 3QWZA 1PQFA 2R92A 1EU1A 1R27A 1Y5IA 2NAPA 2VUMA 1R7RA 1AW8B 1E60A 4AAYA 1PT0A 3GTPA 1FDIA 3CF2A 1TWCA 4DMRA 1OGYA 1SIWA 1Y1WA 1IW7D 4AOKB 1TWHA 1I50A 1ZC1A 1E18A 4RV0A 1DMSA 1UHEA 4KDIA 1Y1VA 3GTQA 1WCMA 2YU9A 2JIMA 1PQHA 3FKIA 3QQ8A 2JIQA 1PT1A 5GLFA 4AONB 3HKZA 4CRYG 3CQZA 1Q16A 2C45A 2V3VA 5C1BA 1VC3B 1E32A 1I3QA 1H5NA 4AZDA 1K83A 5FTKA 1QCSA 3HU1A 4CS0A 2E7ZA 4KODA 2R7ZA 2NVXA 3GTMA 3DMRA 2EEOB 1WLFA 4D7ZB 2NVYA 1S3SA 1CR5A 5T5ID 2JA7A 2JIOA 1E61A 2JV2A 4GA5A 3PLXB 2KI8A 1KQFA 5FTLA 3OUGA 1YLEA 5DYIA 3QQ7A 1TWGA 3ML1A 3IR7A 5EPPA 1H0HA 2VPYA 2E2IA 4AYBA 2PJHB 2YUJA 2VPWA 3IR5A 1PPYA 3GTKA 4C2MA 3GTJA 2PMZA 5B6CA 1PQEA 5C18A 5FTJA 3HU3A 1Y4ZA 4GA6A 2WB1A 1PYQA 1UHDA 2IV2X 1FDOA
chains in the Genus database with same CATH superfamily
1YNJD 5FTMA 1AA6A 1N10A 2PNWA 3GTLA 3GTOA 4KLNA 2DMRA 1R9TA 2YVLA 5T5MD 3FPTA 1DMRA 1TWAA 3TIWA 1KQGA 5CCBA 1QDNA 1PYUB 1TMOA 2PI8A 4JJOA 4NOHA 1SFOA 1G8KA 2HCZX 3HU2A 4AVRA 3X2IA 1HD5A 2NYAA 4AS1A 3X2OA 1BW3A 4ARCA 2Q1AX 1OA9A 2O5JD 5DYGA 4FERA 4CQNA 1E5VA 3O5AA 2A68D 4CRZA 1O54A 2V45A 2AE0X 3IR6A 3LGAA 3QC8A 2Y0SA 4QIWA 2Q1DX 3H0GA 2JIPA 1CZ5A 5FTNA 4L48A 4AQ7A 2R93A 2XDPA 3ZGZA 2G6GA 2E2HA 2JA6A 2WAQA 3X2KA 2JA5A 3TM7B 3LHDA 2B63A 2GFAA 2CW0D 1TWFA 2VPXA 3SUKA 3GTGA 3FPRA 2VPZA 4KDLA 1G8JA 1CZ4A 4FG2A 2JIRA 2A6HD 5D6YA 5D6XA 4KO8A 5D6WA 3CZBA 3QWZA 4JCWA 1SMYD 1PQFA 2G5DA 4JP6A 2Q19X 3X2PA 2PJJA 2R92A 1EU1A 1R27A 1Y5IA 2NAPA 2VUMA 1R7RA 4FFTA 1BW4A 1ZYRD 1AW8B 1E60A 4AAYA 1PT0A 3GTPA 1FDIA 3CF2A 1TWCA 5CCXA 4DMRA 1OGYA 5H4UA 1SIWA 1Y1WA 2PWYA 5EQJB 1IW7D 4AOKB 1TWHA 1ZC1A 3X2LA 1I50A 1E18A 4RV0A 1DMSA 1UHEA 4ZM7A 4KDIA 1Y1VA 3GTQA 1WCMA 3D30A 2YU9A 2QQRA 2BH0A 3SUJA 2JIMA 1PQHA 3M3GA 1WC2A 5GLXA 4ENGA 3FKIA 3QQ8A 2PICA 2JIQA 1PT1A 5GLFA 4AONB 1YNND 3HKZA 4CRYG 3MB5A 4JP7A 5ERGB 1OA7A 2GF7A 5GM9A 3CQZA 1Q16A 2C45A 2V3VA 5GLYA 1VC3B 3X2JA 5C1BA 3FPUA 1E32A 1I3QA 1H5NA 4AZDA 2GAEA 1K83A 5FTKA 1QCSA 2MM2A 3HU1A 4CS0A 2A69D 2E7ZA 4KODA 3X2NA 4JS7A 3X2GA 2R7ZA 3GTMA 2NVXA 3DMRA 2EEOB 1WLFA 4D7ZB 3ZJTA 2NVYA 1S3SA 1CR5A 5T5ID 2JA7A 3X2MA 2JIOA 1E61A 2JV2A 4GA5A 3PLXB 1I9GA 2KI8A 1KQFA 4UC4A 5FTLA 3OUGA 3SULA 1YLEA 2MM0A 3ZJUA 2B25A 2KY9A 5DYIA 3QQ7A 1TWGA 2LW6A 3ENGA 2ENGA 2BE5D 2Q18X 1L8FA 3ML1A 3IR7A 5EPPA 1H0HA 3ZJVA 2VPYA 2Q1CX 2E2IA 4ARIA 4AYBA 2PJHB 2YUJA 2VPWA 3IR5A 1PPYA 2A6ED 3GTKA 2KQAA 4C2MA 3GTJA 2PMZA 5B6CA 1PQEA 4FG4A 5C18A 5FTJA 2QQSA 3HU3A 5CD1A 1Y4ZA 4FIBA 4GA6A 2WB1A 1PYQA 1UHDA 3X2HA 2IV2X 3BQBA 3SUMA 1FDOA
chains in the Genus database with same CATH topology
1YNJD 5FTMA 1AA6A 3GTLA 2PNWA 3GTOA 4KLNA 2DMRA 1R9TA 2YVLA 5T5MD 3FPTA 1DMRA 1TWAA 3TIWA 1KQGA 5CCBA 1QDNA 1PYUB 1TMOA 2PI8A 4NOHA 1SFOA 1G8KA 3HU2A 2NYAA 4AS1A 4ARCA 2Q1AX 2O5JD 5DYGA 4CQNA 1E5VA 3O5AA 2A68D 4CRZA 1O54A 2V45A 2AE0X 3IR6A 3LGAA 3QC8A 2Y0SA 4QIWA 2Q1DX 3H0GA 2JIPA 1CZ5A 5FTNA 4AQ7A 2R93A 2XDPA 3ZGZA 2G6GA 2E2HA 2JA6A 2WAQA 2JA5A 3LHDA 3TM7B 2B63A 2GFAA 2CW0D 1TWFA 2VPXA 3GTGA 3FPRA 2VPZA 4KDLA 1G8JA 1CZ4A 2JIRA 2A6HD 5D6YA 5D6XA 4KO8A 5D6WA 3CZBA 3QWZA 1SMYD 1PQFA 2G5DA 2Q19X 2R92A 2PJJA 1EU1A 1R27A 1Y5IA 2NAPA 2VUMA 1R7RA 1ZYRD 1AW8B 1E60A 4AAYA 1PT0A 3GTPA 1FDIA 3CF2A 1TWCA 5CCXA 4DMRA 1OGYA 1SIWA 1Y1WA 2PWYA 5EQJB 1IW7D 4AOKB 1TWHA 1ZC1A 1I50A 1E18A 4RV0A 1DMSA 1UHEA 4KDIA 1Y1VA 3GTQA 1WCMA 2YU9A 2QQRA 2JIMA 1PQHA 3FKIA 3QQ8A 2PICA 2JIQA 1PT1A 5GLFA 4AONB 1YNND 3HKZA 4CRYG 3MB5A 5ERGB 2GF7A 3CQZA 1Q16A 2C45A 2V3VA 5C1BA 1VC3B 3FPUA 1E32A 1I3QA 1H5NA 4AZDA 2GAEA 1K83A 5FTKA 1QCSA 2MM2A 3HU1A 4CS0A 2A69D 2E7ZA 4KODA 2R7ZA 2NVXA 3GTMA 3DMRA 2EEOB 1WLFA 4D7ZB 3ZJTA 2NVYA 1S3SA 1CR5A 5T5ID 2JA7A 2JIOA 1E61A 2JV2A 4GA5A 3PLXB 1I9GA 2KI8A 1KQFA 4UC4A 5FTLA 3OUGA 1YLEA 2MM0A 3ZJUA 2B25A 2KY9A 5DYIA 3QQ7A 1TWGA 2LW6A 2BE5D 2Q18X 3ML1A 3IR7A 5EPPA 1H0HA 3ZJVA 2VPYA 2Q1CX 2E2IA 4ARIA 4AYBA 2PJHB 2YUJA 2VPWA 3IR5A 1PPYA 2A6ED 3GTKA 4C2MA 3GTJA 2PMZA 5B6CA 1PQEA 5C18A 5FTJA 2QQSA 3HU3A 5CD1A 1Y4ZA 4FIBA 4GA6A 2WB1A 1PYQA 1UHDA 2IV2X 3BQBA 1FDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTM A;  1AA6 A;  3GTL A;  3GTO A;  4KLN A;  2DMR A;  1R9T A;  5T5M D;  1DMR A;  1TWA A;  3TIW A;  1KQG A;  1QDN A;  1PYU B;  1TMO A;  1SFO A;  1G8K A;  3HU2 A;  2NYA A;  5DYG A;  1E5V A;  3O5A A;  4CRZ A;  2V45 A;  3IR6 A;  3QC8 A;  2Y0S A;  4QIW A;  3H0G A;  2JIP A;  1CZ5 A;  5FTN A;  2R93 A;  2E2H A;  2JA6 A;  2WAQ A;  2JA5 A;  3TM7 B;  2B63 A;  2VPX A;  1TWF A;  3GTG A;  2VPZ A;  4KDL A;  1G8J A;  1CZ4 A;  2JIR A;  4KO8 A;  3QWZ A;  1PQF A;  2R92 A;  1EU1 A;  1R27 A;  1Y5I A;  2NAP A;  2VUM A;  1R7R A;  1AW8 B;  1E60 A;  4AAY A;  1PT0 A;  3GTP A;  1FDI A;  3CF2 A;  1TWC A;  4DMR A;  1OGY A;  1SIW A;  1Y1W A;  1IW7 D;  4AOK B;  1TWH A;  1I50 A;  1ZC1 A;  1E18 A;  4RV0 A;  1DMS A;  1UHE A;  4KDI A;  1Y1V A;  3GTQ A;  1WCM A;  2YU9 A;  2JIM A;  1PQH A;  3FKI A;  3QQ8 A;  2JIQ A;  1PT1 A;  5GLF A;  4AON B;  3HKZ A;  4CRY G;  3CQZ A;  1Q16 A;  2C45 A;  2V3V A;  5C1B A;  1VC3 B;  1E32 A;  1I3Q A;  1H5N A;  4AZD A;  1K83 A;  5FTK A;  1QCS A;  3HU1 A;  4CS0 A;  2E7Z A;  4KOD A;  2R7Z A;  2NVX A;  3GTM A;  3DMR A;  2EEO B;  1WLF A;  4D7Z B;  2NVY A;  1S3S A;  1CR5 A;  5T5I D;  2JA7 A;  2JIO A;  1E61 A;  2JV2 A;  4GA5 A;  3PLX B;  2KI8 A;  1KQF A;  5FTL A;  3OUG A;  1YLE A;  5DYI A;  3QQ7 A;  1TWG A;  3ML1 A;  3IR7 A;  5EPP A;  1H0H A;  2VPY A;  2E2I A;  4AYB A;  2PJH B;  2YUJ A;  2VPW A;  3IR5 A;  1PPY A;  3GTK A;  4C2M A;  3GTJ A;  2PMZ A;  5B6C A;  1PQE A;  5C18 A;  5FTJ A;  3HU3 A;  1Y4Z A;  4GA6 A;  2WB1 A;  1PYQ A;  1UHD A;  2IV2 X;  1FDO A; 
#chains in the Genus database with same CATH topology
 1YNJ D;  5FTM A;  1AA6 A;  1N10 A;  2PNW A;  3GTL A;  3GTO A;  4KLN A;  2DMR A;  1R9T A;  2YVL A;  5T5M D;  3FPT A;  1DMR A;  1TWA A;  3TIW A;  1KQG A;  5CCB A;  1QDN A;  1PYU B;  1TMO A;  2PI8 A;  4JJO A;  4NOH A;  1SFO A;  1G8K A;  2HCZ X;  3HU2 A;  4AVR A;  3X2I A;  1HD5 A;  2NYA A;  4AS1 A;  3X2O A;  1BW3 A;  4ARC A;  2Q1A X;  1OA9 A;  2O5J D;  5DYG A;  4FER A;  4CQN A;  1E5V A;  3O5A A;  2A68 D;  4CRZ A;  1O54 A;  2V45 A;  2AE0 X;  3IR6 A;  3LGA A;  3QC8 A;  2Y0S A;  4QIW A;  2Q1D X;  3H0G A;  2JIP A;  1CZ5 A;  5FTN A;  4L48 A;  4AQ7 A;  2R93 A;  2XDP A;  3ZGZ A;  2G6G A;  2E2H A;  2JA6 A;  2WAQ A;  3X2K A;  2JA5 A;  3TM7 B;  3LHD A;  2B63 A;  2GFA A;  2CW0 D;  1TWF A;  2VPX A;  3SUK A;  3GTG A;  3FPR A;  2VPZ A;  4KDL A;  1G8J A;  1CZ4 A;  4FG2 A;  2JIR A;  2A6H D;  5D6Y A;  5D6X A;  4KO8 A;  5D6W A;  3CZB A;  3QWZ A;  4JCW A;  1SMY D;  1PQF A;  2G5D A;  4JP6 A;  2Q19 X;  3X2P A;  2PJJ A;  2R92 A;  1EU1 A;  1R27 A;  1Y5I A;  2NAP A;  2VUM A;  1R7R A;  4FFT A;  1BW4 A;  1ZYR D;  1AW8 B;  1E60 A;  4AAY A;  1PT0 A;  3GTP A;  1FDI A;  3CF2 A;  1TWC A;  5CCX A;  4DMR A;  1OGY A;  5H4U A;  1SIW A;  1Y1W A;  2PWY A;  5EQJ B;  1IW7 D;  4AOK B;  1TWH A;  1ZC1 A;  3X2L A;  1I50 A;  1E18 A;  4RV0 A;  1DMS A;  1UHE A;  4ZM7 A;  4KDI A;  1Y1V A;  3GTQ A;  1WCM A;  3D30 A;  2YU9 A;  2QQR A;  2BH0 A;  3SUJ A;  2JIM A;  1PQH A;  3M3G A;  1WC2 A;  5GLX A;  4ENG A;  3FKI A;  3QQ8 A;  2PIC A;  2JIQ A;  1PT1 A;  5GLF A;  4AON B;  1YNN D;  3HKZ A;  4CRY G;  3MB5 A;  4JP7 A;  5ERG B;  1OA7 A;  2GF7 A;  5GM9 A;  3CQZ A;  1Q16 A;  2C45 A;  2V3V A;  5GLY A;  1VC3 B;  3X2J A;  5C1B A;  3FPU A;  1E32 A;  1I3Q A;  1H5N A;  4AZD A;  2GAE A;  1K83 A;  5FTK A;  1QCS A;  2MM2 A;  3HU1 A;  4CS0 A;  2A69 D;  2E7Z A;  4KOD A;  3X2N A;  4JS7 A;  3X2G A;  2R7Z A;  3GTM A;  2NVX A;  3DMR A;  2EEO B;  1WLF A;  4D7Z B;  3ZJT A;  2NVY A;  1S3S A;  1CR5 A;  5T5I D;  2JA7 A;  3X2M A;  2JIO A;  1E61 A;  2JV2 A;  4GA5 A;  3PLX B;  1I9G A;  2KI8 A;  1KQF A;  4UC4 A;  5FTL A;  3OUG A;  3SUL A;  1YLE A;  2MM0 A;  3ZJU A;  2B25 A;  2KY9 A;  5DYI A;  3QQ7 A;  1TWG A;  2LW6 A;  3ENG A;  2ENG A;  2BE5 D;  2Q18 X;  1L8F A;  3ML1 A;  3IR7 A;  5EPP A;  1H0H A;  3ZJV A;  2VPY A;  2Q1C X;  2E2I A;  4ARI A;  4AYB A;  2PJH B;  2YUJ A;  2VPW A;  3IR5 A;  1PPY A;  2A6E D;  3GTK A;  2KQA A;  4C2M A;  3GTJ A;  2PMZ A;  5B6C A;  1PQE A;  4FG4 A;  5C18 A;  5FTJ A;  2QQS A;  3HU3 A;  5CD1 A;  1Y4Z A;  4FIB A;  4GA6 A;  2WB1 A;  1PYQ A;  1UHD A;  3X2H A;  2IV2 X;  3BQB A;  3SUM A;  1FDO A; 
#chains in the Genus database with same CATH homology
 1YNJ D;  5FTM A;  1AA6 A;  3GTL A;  2PNW A;  3GTO A;  4KLN A;  2DMR A;  1R9T A;  2YVL A;  5T5M D;  3FPT A;  1DMR A;  1TWA A;  3TIW A;  1KQG A;  5CCB A;  1QDN A;  1PYU B;  1TMO A;  2PI8 A;  4NOH A;  1SFO A;  1G8K A;  3HU2 A;  2NYA A;  4AS1 A;  4ARC A;  2Q1A X;  2O5J D;  5DYG A;  4CQN A;  1E5V A;  3O5A A;  2A68 D;  4CRZ A;  1O54 A;  2V45 A;  2AE0 X;  3IR6 A;  3LGA A;  3QC8 A;  2Y0S A;  4QIW A;  2Q1D X;  3H0G A;  2JIP A;  1CZ5 A;  5FTN A;  4AQ7 A;  2R93 A;  2XDP A;  3ZGZ A;  2G6G A;  2E2H A;  2JA6 A;  2WAQ A;  2JA5 A;  3LHD A;  3TM7 B;  2B63 A;  2GFA A;  2CW0 D;  1TWF A;  2VPX A;  3GTG A;  3FPR A;  2VPZ A;  4KDL A;  1G8J A;  1CZ4 A;  2JIR A;  2A6H D;  5D6Y A;  5D6X A;  4KO8 A;  5D6W A;  3CZB A;  3QWZ A;  1SMY D;  1PQF A;  2G5D A;  2Q19 X;  2R92 A;  2PJJ A;  1EU1 A;  1R27 A;  1Y5I A;  2NAP A;  2VUM A;  1R7R A;  1ZYR D;  1AW8 B;  1E60 A;  4AAY A;  1PT0 A;  3GTP A;  1FDI A;  3CF2 A;  1TWC A;  5CCX A;  4DMR A;  1OGY A;  1SIW A;  1Y1W A;  2PWY A;  5EQJ B;  1IW7 D;  4AOK B;  1TWH A;  1ZC1 A;  1I50 A;  1E18 A;  4RV0 A;  1DMS A;  1UHE A;  4KDI A;  1Y1V A;  3GTQ A;  1WCM A;  2YU9 A;  2QQR A;  2JIM A;  1PQH A;  3FKI A;  3QQ8 A;  2PIC A;  2JIQ A;  1PT1 A;  5GLF A;  4AON B;  1YNN D;  3HKZ A;  4CRY G;  3MB5 A;  5ERG B;  2GF7 A;  3CQZ A;  1Q16 A;  2C45 A;  2V3V A;  5C1B A;  1VC3 B;  3FPU A;  1E32 A;  1I3Q A;  1H5N A;  4AZD A;  2GAE A;  1K83 A;  5FTK A;  1QCS A;  2MM2 A;  3HU1 A;  4CS0 A;  2A69 D;  2E7Z A;  4KOD A;  2R7Z A;  2NVX A;  3GTM A;  3DMR A;  2EEO B;  1WLF A;  4D7Z B;  3ZJT A;  2NVY A;  1S3S A;  1CR5 A;  5T5I D;  2JA7 A;  2JIO A;  1E61 A;  2JV2 A;  4GA5 A;  3PLX B;  1I9G A;  2KI8 A;  1KQF A;  4UC4 A;  5FTL A;  3OUG A;  1YLE A;  2MM0 A;  3ZJU A;  2B25 A;  2KY9 A;  5DYI A;  3QQ7 A;  1TWG A;  2LW6 A;  2BE5 D;  2Q18 X;  3ML1 A;  3IR7 A;  5EPP A;  1H0H A;  3ZJV A;  2VPY A;  2Q1C X;  2E2I A;  4ARI A;  4AYB A;  2PJH B;  2YUJ A;  2VPW A;  3IR5 A;  1PPY A;  2A6E D;  3GTK A;  4C2M A;  3GTJ A;  2PMZ A;  5B6C A;  1PQE A;  5C18 A;  5FTJ A;  2QQS A;  3HU3 A;  5CD1 A;  1Y4Z A;  4FIB A;  4GA6 A;  2WB1 A;  1PYQ A;  1UHD A;  2IV2 X;  3BQB A;  1FDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...