3QC8A

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 48
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qc8A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qc8A02
2C45A 2R92A 1UHEA 1K83A 3CF2A 1FDIA 2VPYA 1TWGA 1PQEA 2PJHB 1TWHA 3QQ7A 3HU3A 2JIQA 1G8KA 1FDOA 1PQFA 2PMZA 3TM7B 1EU1A 1PYUB 1ZC1A 1E18A 4AONB 3GTPA 4KDIA 4GA6A 2EEOB 1DMRA 2JV2A 2R7ZA 5FTKA 1Y1WA 3GTKA 3IR6A 1G8JA 1QDNA 5FTMA 3H0GA 1SFOA 4KLNA 1AW8B 3GTJA 2IV2X 5GLFA 2JIOA 2E7ZA 2WAQA 2KI8A 2VPWA 2VUMA 2NVXA 1E5VA 1WLFA 3TIWA 1Y1VA 4GA5A 5B6CA 4KODA 3QC8A 3HU1A 1TWCA 4AZDA 1SIWA 1OGYA 2R93A 2JA7A 3IR7A 3GTMA 1H0HA 3HKZA 3HU2A 1IW7D 4C2MA 5C18A 1AA6A 2YU9A 1KQFA 3GTOA 3PLXB 1PT1A 4QIWA 5T5MD 1CZ5A 1PT0A 2Y0SA 2WB1A 2YUJA 2JA6A 4RV0A 1CR5A 3DMRA 1KQGA 2JA5A 1E32A 3FKIA 2NAPA 3OUGA 5DYGA 2JIPA 2JIRA 1DMSA 5FTNA 5T5ID 2VPZA 2JIMA 1TMOA 1VC3B 4AOKB 1PYQA 5EPPA 1E60A 1PQHA 1TWFA 5DYIA 1CZ4A 1R9TA 2NYAA 1E61A 2VPXA 5FTJA 1TWAA 3CQZA 2DMRA 1Y4ZA 3ML1A 2NVYA 1I50A 1R27A 1PPYA 1S3SA 1R7RA 1QCSA 3GTGA 5FTLA 5C1BA 1Q16A 4D7ZB 2E2HA 1UHDA 1H5NA 1Y5IA 4KO8A 4KDLA 4CRZA 1I3QA 3O5AA 2B63A 4CRYG 4DMRA 3QWZA 2V3VA 3GTQA 3IR5A 1YLEA 3GTLA 2E2IA 4AYBA 2V45A 3QQ8A 4AAYA 4CS0A 1WCMA
chains in the Genus database with same CATH superfamily
2C45A 2R92A 2KY9A 1UHEA 1K83A 3CF2A 1ZYRD 4JP7A 1FDIA 2VPYA 3SUMA 1TWGA 1PQEA 2PJHB 1TWHA 3QQ7A 4L48A 3HU3A 4AVRA 4FG2A 2Q1CX 2JIQA 1G8KA 1FDOA 1PQFA 2PMZA 3CZBA 1EU1A 3TM7B 1PYUB 3X2NA 3X2KA 2A68D 4ENGA 1ZC1A 1E18A 4JJOA 4AONB 3GTPA 3X2IA 2PI8A 4GA6A 4KDIA 4JS7A 2EEOB 1DMRA 2JV2A 4JP6A 2R7ZA 2KQAA 5FTKA 3GTKA 1Y1WA 3IR6A 3ZJUA 1G8JA 1N10A 1QDNA 5FTMA 2A6ED 3H0GA 4ARCA 1SFOA 2Q19X 4KLNA 1AW8B 3GTJA 2HCZX 2LW6A 2CW0D 3SUKA 2IV2X 4FG4A 5GLFA 5D6XA 2JIOA 2E7ZA 2WAQA 4UC4A 2BE5D 2MM2A 2KI8A 2Q1AX 5EQJB 2VPWA 2ENGA 3SULA 2VUMA 2NVXA 3ENGA 1E5VA 1WLFA 3TIWA 1Y1VA 4GA5A 5B6CA 4KODA 3QC8A 3HU1A 1TWCA 1WC2A 1SIWA 4AZDA 1BW4A 5H4UA 1OGYA 3X2OA 2R93A 3X2PA 3X2MA 2JA7A 2XDPA 2G6GA 3IR7A 3GTMA 1I9GA 3MB5A 1H0HA 3HKZA 3HU2A 1IW7D 4C2MA 1SMYD 5C18A 4AS1A 1L8FA 2AE0X 1AA6A 1BW3A 4FERA 2YU9A 1KQFA 3GTOA 5CCBA 3PLXB 1PT1A 4QIWA 5T5MD 1CZ5A 1PT0A 3LHDA 2Y0SA 2Q1DX 2WB1A 3X2LA 2YUJA 5CCXA 2JA6A 3BQBA 1OA9A 1CR5A 3DMRA 4RV0A 1KQGA 2BH0A 3ZJVA 2MM0A 2JA5A 1E32A 4JCWA 3FKIA 2PWYA 2NAPA 3OUGA 5DYGA 3SUJA 2JIPA 5ERGB 2JIRA 1DMSA 2QQRA 5FTNA 5T5ID 2VPZA 4FIBA 2JIMA 1TMOA 1VC3B 5GM9A 4AOKB 1PYQA 5EPPA 5GLYA 1HD5A 2PNWA 3FPTA 3LGAA 1E60A 1PQHA 1TWFA 5DYIA 5D6YA 4AQ7A 1CZ4A 1R9TA 2NYAA 1E61A 2VPXA 5FTJA 1TWAA 3CQZA 2DMRA 3FPRA 1Y4ZA 4CQNA 3ML1A 2NVYA 1I50A 1R27A 1PPYA 1S3SA 1R7RA 2A69D 2GAEA 2B25A 1QCSA 3GTGA 3X2HA 5FTLA 5C1BA 1Q16A 2A6HD 4D7ZB 2GFAA 3M3GA 2E2HA 1UHDA 1YNJD 2QQSA 3ZGZA 2PJJA 3D30A 1H5NA 4FFTA 1Y5IA 4ZM7A 2G5DA 4KO8A 2Q18X 4NOHA 1O54A 3ZJTA 1OA7A 4KDLA 4CRZA 1I3QA 2O5JD 5CD1A 3O5AA 2B63A 4CRYG 3X2GA 3X2JA 4DMRA 4ARIA 3QWZA 2V3VA 5D6WA 3GTQA 2GF7A 3FPUA 3IR5A 1YLEA 3GTLA 2E2IA 4AYBA 2V45A 2PICA 3QQ8A 5GLXA 4AAYA 1YNND 4CS0A 2YVLA 1WCMA
chains in the Genus database with same CATH topology
2C45A 2R92A 2KY9A 1UHEA 1K83A 3CF2A 1ZYRD 1FDIA 2VPYA 1TWGA 1PQEA 2PJHB 1TWHA 3QQ7A 3HU3A 2Q1CX 2JIQA 1G8KA 1FDOA 1PQFA 2PMZA 3CZBA 1EU1A 3TM7B 1PYUB 2A68D 1ZC1A 1E18A 4AONB 3GTPA 2PI8A 4GA6A 4KDIA 2EEOB 1DMRA 2JV2A 2R7ZA 5FTKA 1Y1WA 3GTKA 3IR6A 3ZJUA 1G8JA 1QDNA 5FTMA 2A6ED 3H0GA 4ARCA 1SFOA 2Q19X 4KLNA 1AW8B 3GTJA 2LW6A 2CW0D 2IV2X 5GLFA 5D6XA 2JIOA 2E7ZA 2WAQA 4UC4A 2BE5D 2MM2A 2KI8A 2Q1AX 5EQJB 2VPWA 2VUMA 2NVXA 1E5VA 1WLFA 3TIWA 1Y1VA 4GA5A 5B6CA 4KODA 3QC8A 3HU1A 1TWCA 4AZDA 1SIWA 1OGYA 2R93A 2JA7A 3MB5A 2XDPA 2G6GA 3IR7A 3GTMA 1I9GA 1H0HA 3HKZA 3HU2A 1IW7D 4C2MA 1SMYD 5C18A 4AS1A 2AE0X 1AA6A 2YU9A 1KQFA 3GTOA 5CCBA 3PLXB 1PT1A 4QIWA 5T5MD 1CZ5A 1PT0A 3LHDA 2Y0SA 2Q1DX 2WB1A 5CCXA 2YUJA 2JA6A 3BQBA 4RV0A 1CR5A 3DMRA 1KQGA 3ZJVA 2MM0A 2JA5A 1E32A 3FKIA 2PWYA 2NAPA 3OUGA 5DYGA 2JIPA 5ERGB 2JIRA 1DMSA 2QQRA 5FTNA 5T5ID 2VPZA 4FIBA 2JIMA 1TMOA 1VC3B 4AOKB 1PYQA 5EPPA 2PNWA 3FPTA 3LGAA 1E60A 1PQHA 1TWFA 5DYIA 5D6YA 4AQ7A 1CZ4A 1R9TA 2NYAA 1E61A 2VPXA 5FTJA 1TWAA 3CQZA 2DMRA 3FPRA 1Y4ZA 4CQNA 3ML1A 2NVYA 1I50A 1R27A 1PPYA 1S3SA 1R7RA 2A69D 2GAEA 2B25A 1QCSA 3GTGA 5FTLA 5C1BA 1Q16A 2A6HD 4D7ZB 2GFAA 2E2HA 1UHDA 1YNJD 2QQSA 3ZGZA 2PJJA 1H5NA 1Y5IA 2G5DA 4KO8A 2Q18X 4NOHA 1O54A 3ZJTA 4KDLA 4CRZA 1I3QA 2O5JD 5CD1A 3O5AA 2B63A 4CRYG 4ARIA 4DMRA 3QWZA 2V3VA 5D6WA 3GTQA 2GF7A 3FPUA 3IR5A 1YLEA 3GTLA 2E2IA 4AYBA 2V45A 2PICA 3QQ8A 4AAYA 1YNND 4CS0A 2YVLA 1WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C45 A;  2R92 A;  1UHE A;  1K83 A;  3CF2 A;  1FDI A;  2VPY A;  1TWG A;  1PQE A;  2PJH B;  1TWH A;  3QQ7 A;  3HU3 A;  2JIQ A;  1G8K A;  1FDO A;  1PQF A;  2PMZ A;  3TM7 B;  1EU1 A;  1PYU B;  1ZC1 A;  1E18 A;  4AON B;  3GTP A;  4KDI A;  4GA6 A;  2EEO B;  1DMR A;  2JV2 A;  2R7Z A;  5FTK A;  1Y1W A;  3GTK A;  3IR6 A;  1G8J A;  1QDN A;  5FTM A;  3H0G A;  1SFO A;  4KLN A;  1AW8 B;  3GTJ A;  2IV2 X;  5GLF A;  2JIO A;  2E7Z A;  2WAQ A;  2KI8 A;  2VPW A;  2VUM A;  2NVX A;  1E5V A;  1WLF A;  3TIW A;  1Y1V A;  4GA5 A;  5B6C A;  4KOD A;  3QC8 A;  3HU1 A;  1TWC A;  4AZD A;  1SIW A;  1OGY A;  2R93 A;  2JA7 A;  3IR7 A;  3GTM A;  1H0H A;  3HKZ A;  3HU2 A;  1IW7 D;  4C2M A;  5C18 A;  1AA6 A;  2YU9 A;  1KQF A;  3GTO A;  3PLX B;  1PT1 A;  4QIW A;  5T5M D;  1CZ5 A;  1PT0 A;  2Y0S A;  2WB1 A;  2YUJ A;  2JA6 A;  4RV0 A;  1CR5 A;  3DMR A;  1KQG A;  2JA5 A;  1E32 A;  3FKI A;  2NAP A;  3OUG A;  5DYG A;  2JIP A;  2JIR A;  1DMS A;  5FTN A;  5T5I D;  2VPZ A;  2JIM A;  1TMO A;  1VC3 B;  4AOK B;  1PYQ A;  5EPP A;  1E60 A;  1PQH A;  1TWF A;  5DYI A;  1CZ4 A;  1R9T A;  2NYA A;  1E61 A;  2VPX A;  5FTJ A;  1TWA A;  3CQZ A;  2DMR A;  1Y4Z A;  3ML1 A;  2NVY A;  1I50 A;  1R27 A;  1PPY A;  1S3S A;  1R7R A;  1QCS A;  3GTG A;  5FTL A;  5C1B A;  1Q16 A;  4D7Z B;  2E2H A;  1UHD A;  1H5N A;  1Y5I A;  4KO8 A;  4KDL A;  4CRZ A;  1I3Q A;  3O5A A;  2B63 A;  4CRY G;  4DMR A;  3QWZ A;  2V3V A;  3GTQ A;  3IR5 A;  1YLE A;  3GTL A;  2E2I A;  4AYB A;  2V45 A;  3QQ8 A;  4AAY A;  4CS0 A;  1WCM A; 
#chains in the Genus database with same CATH topology
 2C45 A;  2R92 A;  2KY9 A;  1UHE A;  1K83 A;  3CF2 A;  1ZYR D;  4JP7 A;  1FDI A;  2VPY A;  3SUM A;  1TWG A;  1PQE A;  2PJH B;  1TWH A;  3QQ7 A;  4L48 A;  3HU3 A;  4AVR A;  4FG2 A;  2Q1C X;  2JIQ A;  1G8K A;  1FDO A;  1PQF A;  2PMZ A;  3CZB A;  1EU1 A;  3TM7 B;  1PYU B;  3X2N A;  3X2K A;  2A68 D;  4ENG A;  1ZC1 A;  1E18 A;  4JJO A;  4AON B;  3GTP A;  3X2I A;  2PI8 A;  4GA6 A;  4KDI A;  4JS7 A;  2EEO B;  1DMR A;  2JV2 A;  4JP6 A;  2R7Z A;  2KQA A;  5FTK A;  3GTK A;  1Y1W A;  3IR6 A;  3ZJU A;  1G8J A;  1N10 A;  1QDN A;  5FTM A;  2A6E D;  3H0G A;  4ARC A;  1SFO A;  2Q19 X;  4KLN A;  1AW8 B;  3GTJ A;  2HCZ X;  2LW6 A;  2CW0 D;  3SUK A;  2IV2 X;  4FG4 A;  5GLF A;  5D6X A;  2JIO A;  2E7Z A;  2WAQ A;  4UC4 A;  2BE5 D;  2MM2 A;  2KI8 A;  2Q1A X;  5EQJ B;  2VPW A;  2ENG A;  3SUL A;  2VUM A;  2NVX A;  3ENG A;  1E5V A;  1WLF A;  3TIW A;  1Y1V A;  4GA5 A;  5B6C A;  4KOD A;  3QC8 A;  3HU1 A;  1TWC A;  1WC2 A;  1SIW A;  4AZD A;  1BW4 A;  5H4U A;  1OGY A;  3X2O A;  2R93 A;  3X2P A;  3X2M A;  2JA7 A;  2XDP A;  2G6G A;  3IR7 A;  3GTM A;  1I9G A;  3MB5 A;  1H0H A;  3HKZ A;  3HU2 A;  1IW7 D;  4C2M A;  1SMY D;  5C18 A;  4AS1 A;  1L8F A;  2AE0 X;  1AA6 A;  1BW3 A;  4FER A;  2YU9 A;  1KQF A;  3GTO A;  5CCB A;  3PLX B;  1PT1 A;  4QIW A;  5T5M D;  1CZ5 A;  1PT0 A;  3LHD A;  2Y0S A;  2Q1D X;  2WB1 A;  3X2L A;  2YUJ A;  5CCX A;  2JA6 A;  3BQB A;  1OA9 A;  1CR5 A;  3DMR A;  4RV0 A;  1KQG A;  2BH0 A;  3ZJV A;  2MM0 A;  2JA5 A;  1E32 A;  4JCW A;  3FKI A;  2PWY A;  2NAP A;  3OUG A;  5DYG A;  3SUJ A;  2JIP A;  5ERG B;  2JIR A;  1DMS A;  2QQR A;  5FTN A;  5T5I D;  2VPZ A;  4FIB A;  2JIM A;  1TMO A;  1VC3 B;  5GM9 A;  4AOK B;  1PYQ A;  5EPP A;  5GLY A;  1HD5 A;  2PNW A;  3FPT A;  3LGA A;  1E60 A;  1PQH A;  1TWF A;  5DYI A;  5D6Y A;  4AQ7 A;  1CZ4 A;  1R9T A;  2NYA A;  1E61 A;  2VPX A;  5FTJ A;  1TWA A;  3CQZ A;  2DMR A;  3FPR A;  1Y4Z A;  4CQN A;  3ML1 A;  2NVY A;  1I50 A;  1R27 A;  1PPY A;  1S3S A;  1R7R A;  2A69 D;  2GAE A;  2B25 A;  1QCS A;  3GTG A;  3X2H A;  5FTL A;  5C1B A;  1Q16 A;  2A6H D;  4D7Z B;  2GFA A;  3M3G A;  2E2H A;  1UHD A;  1YNJ D;  2QQS A;  3ZGZ A;  2PJJ A;  3D30 A;  1H5N A;  4FFT A;  1Y5I A;  4ZM7 A;  2G5D A;  4KO8 A;  2Q18 X;  4NOH A;  1O54 A;  3ZJT A;  1OA7 A;  4KDL A;  4CRZ A;  1I3Q A;  2O5J D;  5CD1 A;  3O5A A;  2B63 A;  4CRY G;  3X2G A;  3X2J A;  4DMR A;  4ARI A;  3QWZ A;  2V3V A;  5D6W A;  3GTQ A;  2GF7 A;  3FPU A;  3IR5 A;  1YLE A;  3GTL A;  2E2I A;  4AYB A;  2V45 A;  2PIC A;  3QQ8 A;  5GLX A;  4AAY A;  1YNN D;  4CS0 A;  2YVL A;  1WCM A; 
#chains in the Genus database with same CATH homology
 2C45 A;  2R92 A;  2KY9 A;  1UHE A;  1K83 A;  3CF2 A;  1ZYR D;  1FDI A;  2VPY A;  1TWG A;  1PQE A;  2PJH B;  1TWH A;  3QQ7 A;  3HU3 A;  2Q1C X;  2JIQ A;  1G8K A;  1FDO A;  1PQF A;  2PMZ A;  3CZB A;  1EU1 A;  3TM7 B;  1PYU B;  2A68 D;  1ZC1 A;  1E18 A;  4AON B;  3GTP A;  2PI8 A;  4GA6 A;  4KDI A;  2EEO B;  1DMR A;  2JV2 A;  2R7Z A;  5FTK A;  1Y1W A;  3GTK A;  3IR6 A;  3ZJU A;  1G8J A;  1QDN A;  5FTM A;  2A6E D;  3H0G A;  4ARC A;  1SFO A;  2Q19 X;  4KLN A;  1AW8 B;  3GTJ A;  2LW6 A;  2CW0 D;  2IV2 X;  5GLF A;  5D6X A;  2JIO A;  2E7Z A;  2WAQ A;  4UC4 A;  2BE5 D;  2MM2 A;  2KI8 A;  2Q1A X;  5EQJ B;  2VPW A;  2VUM A;  2NVX A;  1E5V A;  1WLF A;  3TIW A;  1Y1V A;  4GA5 A;  5B6C A;  4KOD A;  3QC8 A;  3HU1 A;  1TWC A;  4AZD A;  1SIW A;  1OGY A;  2R93 A;  2JA7 A;  3MB5 A;  2XDP A;  2G6G A;  3IR7 A;  3GTM A;  1I9G A;  1H0H A;  3HKZ A;  3HU2 A;  1IW7 D;  4C2M A;  1SMY D;  5C18 A;  4AS1 A;  2AE0 X;  1AA6 A;  2YU9 A;  1KQF A;  3GTO A;  5CCB A;  3PLX B;  1PT1 A;  4QIW A;  5T5M D;  1CZ5 A;  1PT0 A;  3LHD A;  2Y0S A;  2Q1D X;  2WB1 A;  5CCX A;  2YUJ A;  2JA6 A;  3BQB A;  4RV0 A;  1CR5 A;  3DMR A;  1KQG A;  3ZJV A;  2MM0 A;  2JA5 A;  1E32 A;  3FKI A;  2PWY A;  2NAP A;  3OUG A;  5DYG A;  2JIP A;  5ERG B;  2JIR A;  1DMS A;  2QQR A;  5FTN A;  5T5I D;  2VPZ A;  4FIB A;  2JIM A;  1TMO A;  1VC3 B;  4AOK B;  1PYQ A;  5EPP A;  2PNW A;  3FPT A;  3LGA A;  1E60 A;  1PQH A;  1TWF A;  5DYI A;  5D6Y A;  4AQ7 A;  1CZ4 A;  1R9T A;  2NYA A;  1E61 A;  2VPX A;  5FTJ A;  1TWA A;  3CQZ A;  2DMR A;  3FPR A;  1Y4Z A;  4CQN A;  3ML1 A;  2NVY A;  1I50 A;  1R27 A;  1PPY A;  1S3S A;  1R7R A;  2A69 D;  2GAE A;  2B25 A;  1QCS A;  3GTG A;  5FTL A;  5C1B A;  1Q16 A;  2A6H D;  4D7Z B;  2GFA A;  2E2H A;  1UHD A;  1YNJ D;  2QQS A;  3ZGZ A;  2PJJ A;  1H5N A;  1Y5I A;  2G5D A;  4KO8 A;  2Q18 X;  4NOH A;  1O54 A;  3ZJT A;  4KDL A;  4CRZ A;  1I3Q A;  2O5J D;  5CD1 A;  3O5A A;  2B63 A;  4CRY G;  4ARI A;  4DMR A;  3QWZ A;  2V3V A;  5D6W A;  3GTQ A;  2GF7 A;  3FPU A;  3IR5 A;  1YLE A;  3GTL A;  2E2I A;  4AYB A;  2V45 A;  2PIC A;  3QQ8 A;  4AAY A;  1YNN D;  4CS0 A;  2YVL A;  1WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...