3QC8A

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 48
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qc8A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qc8A02
2KI8A 4GA5A 4D7ZB 2PMZA 2NYAA 1FDIA 2EEOB 2VPYA 3GTJA 4AOKB 1TWAA 4QIWA 1E60A 3HU1A 3HU2A 1Y1WA 1SIWA 3GTOA 1PPYA 3QWZA 5B6CA 4KO8A 3IR5A 4DMRA 1I50A 2R92A 1Y5IA 1KQGA 3QQ7A 2JIQA 1IW7D 2VPWA 3ML1A 1PQEA 4AZDA 1Q16A 3QC8A 1PYQA 3PLXB 3HU3A 2JIOA 1R7RA 2E7ZA 2JIPA 1VC3B 3GTKA 2VPZA 1AA6A 3CF2A 2C45A 2JA7A 2B63A 1YLEA 4AYBA 2YU9A 2JA6A 2NAPA 3FKIA 4CRZA 2R93A 5FTJA 4C2MA 4KODA 3IR7A 1FDOA 3O5AA 1TWCA 5GLFA 1E18A 1UHEA 5FTNA 5T5MD 1Y1VA 3H0GA 3TM7B 4AONB 5C1BA 5FTLA 2VPXA 4KLNA 3GTLA 1AW8B 1PQHA 5FTMA 2V45A 3HKZA 4KDIA 2JIMA 1TWFA 1ZC1A 2NVYA 2R7ZA 1R27A 1G8KA 5C18A 1I3QA 1QCSA 2WAQA 1E32A 3OUGA 3IR6A 3GTGA 4CS0A 1PQFA 4CRYG 4GA6A 5DYIA 4AAYA 4RV0A 2IV2X 2E2IA 1E5VA 3CQZA 1S3SA 3DMRA 1SFOA 1WLFA 5EPPA 3TIWA 2JA5A 2E2HA 1PYUB 1CZ5A 1CR5A 2JIRA 1EU1A 2V3VA 2YUJA 1K83A 1R9TA 3QQ8A 1CZ4A 1PT0A 2JV2A 1TMOA 2NVXA 1E61A 1QDNA 1H0HA 1UHDA 1TWGA 2PJHB 2DMRA 2WB1A 1KQFA 1PT1A 5DYGA 1DMRA 3GTPA 1WCMA 1DMSA 5FTKA 1H5NA 1OGYA 5T5ID 1TWHA 3GTMA 2VUMA 1G8JA 2Y0SA 4KDLA 3GTQA 1Y4ZA
chains in the Genus database with same CATH superfamily
1N10A 2KI8A 4ZM7A 2PWYA 4GA5A 4D7ZB 3X2GA 2PMZA 2QQRA 2PJJA 2NYAA 3SUKA 1FDIA 2EEOB 2VPYA 3X2OA 3GTJA 3LHDA 4AOKB 1TWAA 4FG2A 1E60A 2PICA 3HU1A 4QIWA 3FPTA 4FG4A 3HU2A 2GF7A 1Y1WA 1SIWA 2BH0A 3MB5A 3GTOA 2GAEA 4AQ7A 3X2MA 1PPYA 3QWZA 1I9GA 3SUJA 4KO8A 5B6CA 3IR5A 4ARCA 3ZGZA 3X2JA 4DMRA 1I50A 2R92A 2LW6A 1Y5IA 1KQGA 2XDPA 3QQ7A 2JIQA 4CQNA 2MM2A 1IW7D 5GLXA 2VPWA 3SULA 3ML1A 3BQBA 3X2HA 1PQEA 4AZDA 1Q16A 3QC8A 1PYQA 3PLXB 3HU3A 2GFAA 4FIBA 2YVLA 3LGAA 2KQAA 5CCBA 2JIOA 4AVRA 1R7RA 4UC4A 1YNND 2QQSA 2E7ZA 2JIPA 1VC3B 3GTKA 2VPZA 1AA6A 3CF2A 3X2PA 4FFTA 1SMYD 2C45A 3CZBA 2JA7A 2B63A 1YLEA 5GLYA 4AYBA 2YU9A 5EQJB 4ENGA 2JA6A 2BE5D 2NAPA 3FKIA 4JS7A 4CRZA 2R93A 2Q1CX 5FTJA 4C2MA 4KODA 2O5JD 3FPUA 2Q18X 3M3GA 3IR7A 2Q1DX 1FDOA 2PI8A 3O5AA 1TWCA 5GLFA 1E18A 1L8FA 2B25A 1UHEA 4NOHA 5FTNA 4ARIA 5T5MD 1Y1VA 3H0GA 1BW3A 2Q19X 3TM7B 5CCXA 4AONB 1ZYRD 5C1BA 5FTLA 4FERA 2VPXA 1BW4A 4KLNA 2Q1AX 3GTLA 1AW8B 1PQHA 5FTMA 2V45A 3HKZA 4KDIA 1ZC1A 1TWFA 1HD5A 2JIMA 1OA7A 5D6XA 2NVYA 3X2LA 2R7ZA 1R27A 1G8KA 2HCZX 5C18A 3ZJUA 5ERGB 1I3QA 1QCSA 2A68D 2WAQA 1E32A 2AE0X 5H4UA 5CD1A 4JCWA 3ENGA 3D30A 3OUGA 5D6WA 3IR6A 3GTGA 4CS0A 1PQFA 4CRYG 4GA6A 5DYIA 4AAYA 4RV0A 2IV2X 2E2IA 1E5VA 3CQZA 1S3SA 3ZJTA 3DMRA 1SFOA 1WLFA 5EPPA 4JP6A 3TIWA 2JA5A 2E2HA 2A6HD 1WC2A 1PYUB 2CW0D 1CZ5A 1CR5A 2A6ED 2JIRA 1EU1A 4AS1A 2V3VA 2YUJA 3X2NA 2ENGA 1K83A 1O54A 1R9TA 3QQ8A 2G5DA 1CZ4A 1PT0A 2JV2A 1TMOA 4JJOA 2NVXA 1E61A 1QDNA 1H0HA 1UHDA 1TWGA 2PJHB 4JP7A 5GM9A 2DMRA 2WB1A 2KY9A 4L48A 1KQFA 1PT1A 5DYGA 1DMRA 3GTPA 1WCMA 2PNWA 3FPRA 3SUMA 1DMSA 5FTKA 1H5NA 3X2KA 1OA9A 1YNJD 1OGYA 5T5ID 1TWHA 2G6GA 3GTMA 2VUMA 1G8JA 3ZJVA 2Y0SA 3X2IA 2MM0A 5D6YA 4KDLA 3GTQA 2A69D 1Y4ZA
chains in the Genus database with same CATH topology
2KI8A 2PWYA 4GA5A 4D7ZB 2PMZA 2QQRA 2PJJA 2NYAA 1FDIA 2EEOB 2VPYA 3GTJA 3LHDA 4AOKB 1TWAA 4QIWA 1E60A 2PICA 3HU1A 3FPTA 2GF7A 3HU2A 1Y1WA 1SIWA 3MB5A 4AQ7A 3GTOA 2GAEA 1PPYA 3QWZA 1I9GA 5B6CA 4KO8A 3IR5A 4ARCA 3ZGZA 4DMRA 1I50A 2R92A 2LW6A 1Y5IA 1KQGA 2XDPA 3QQ7A 2JIQA 4CQNA 2MM2A 1IW7D 2VPWA 3ML1A 3BQBA 1PQEA 4AZDA 1Q16A 3QC8A 1PYQA 3PLXB 3HU3A 2GFAA 4FIBA 2YVLA 3LGAA 5CCBA 2JIOA 1R7RA 4UC4A 1YNND 2QQSA 2E7ZA 2JIPA 1VC3B 3GTKA 2VPZA 1AA6A 3CF2A 1SMYD 2C45A 3CZBA 2JA7A 2B63A 1YLEA 4AYBA 2YU9A 5EQJB 2JA6A 2BE5D 2NAPA 3FKIA 4CRZA 2R93A 2Q1CX 5FTJA 4C2MA 4KODA 2O5JD 3FPUA 2Q18X 3IR7A 2Q1DX 1FDOA 2PI8A 3O5AA 1TWCA 5GLFA 1E18A 2B25A 1UHEA 4NOHA 5FTNA 4ARIA 5T5MD 1Y1VA 3H0GA 2Q19X 3TM7B 5CCXA 4AONB 1ZYRD 5C1BA 5FTLA 2VPXA 2Q1AX 4KLNA 3GTLA 1AW8B 1PQHA 5FTMA 2V45A 3HKZA 4KDIA 1ZC1A 1TWFA 2JIMA 5D6XA 2NVYA 2R7ZA 1R27A 1G8KA 3ZJUA 5C18A 5ERGB 1I3QA 1QCSA 2A68D 2WAQA 1E32A 2AE0X 5CD1A 3OUGA 5D6WA 3IR6A 3GTGA 4CS0A 1PQFA 4CRYG 4GA6A 5DYIA 4AAYA 4RV0A 2IV2X 2E2IA 1E5VA 3CQZA 1S3SA 3ZJTA 3DMRA 1SFOA 1WLFA 5EPPA 3TIWA 2JA5A 2E2HA 2A6HD 1PYUB 2CW0D 1CZ5A 1CR5A 2A6ED 2JIRA 1EU1A 4AS1A 2V3VA 2YUJA 1O54A 1K83A 1R9TA 3QQ8A 2G5DA 1CZ4A 1PT0A 2JV2A 1TMOA 2NVXA 1E61A 1QDNA 1H0HA 1UHDA 1TWGA 2PJHB 2DMRA 2WB1A 2KY9A 1KQFA 1PT1A 5DYGA 1DMRA 3GTPA 1WCMA 2PNWA 3FPRA 1DMSA 5FTKA 1H5NA 1YNJD 1OGYA 5T5ID 1TWHA 2G6GA 3GTMA 2VUMA 1G8JA 3ZJVA 2Y0SA 2MM0A 5D6YA 4KDLA 3GTQA 2A69D 1Y4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI8 A;  4GA5 A;  4D7Z B;  2PMZ A;  2NYA A;  1FDI A;  2EEO B;  2VPY A;  3GTJ A;  4AOK B;  1TWA A;  4QIW A;  1E60 A;  3HU1 A;  3HU2 A;  1Y1W A;  1SIW A;  3GTO A;  1PPY A;  3QWZ A;  5B6C A;  4KO8 A;  3IR5 A;  4DMR A;  1I50 A;  2R92 A;  1Y5I A;  1KQG A;  3QQ7 A;  2JIQ A;  1IW7 D;  2VPW A;  3ML1 A;  1PQE A;  4AZD A;  1Q16 A;  3QC8 A;  1PYQ A;  3PLX B;  3HU3 A;  2JIO A;  1R7R A;  2E7Z A;  2JIP A;  1VC3 B;  3GTK A;  2VPZ A;  1AA6 A;  3CF2 A;  2C45 A;  2JA7 A;  2B63 A;  1YLE A;  4AYB A;  2YU9 A;  2JA6 A;  2NAP A;  3FKI A;  4CRZ A;  2R93 A;  5FTJ A;  4C2M A;  4KOD A;  3IR7 A;  1FDO A;  3O5A A;  1TWC A;  5GLF A;  1E18 A;  1UHE A;  5FTN A;  5T5M D;  1Y1V A;  3H0G A;  3TM7 B;  4AON B;  5C1B A;  5FTL A;  2VPX A;  4KLN A;  3GTL A;  1AW8 B;  1PQH A;  5FTM A;  2V45 A;  3HKZ A;  4KDI A;  2JIM A;  1TWF A;  1ZC1 A;  2NVY A;  2R7Z A;  1R27 A;  1G8K A;  5C18 A;  1I3Q A;  1QCS A;  2WAQ A;  1E32 A;  3OUG A;  3IR6 A;  3GTG A;  4CS0 A;  1PQF A;  4CRY G;  4GA6 A;  5DYI A;  4AAY A;  4RV0 A;  2IV2 X;  2E2I A;  1E5V A;  3CQZ A;  1S3S A;  3DMR A;  1SFO A;  1WLF A;  5EPP A;  3TIW A;  2JA5 A;  2E2H A;  1PYU B;  1CZ5 A;  1CR5 A;  2JIR A;  1EU1 A;  2V3V A;  2YUJ A;  1K83 A;  1R9T A;  3QQ8 A;  1CZ4 A;  1PT0 A;  2JV2 A;  1TMO A;  2NVX A;  1E61 A;  1QDN A;  1H0H A;  1UHD A;  1TWG A;  2PJH B;  2DMR A;  2WB1 A;  1KQF A;  1PT1 A;  5DYG A;  1DMR A;  3GTP A;  1WCM A;  1DMS A;  5FTK A;  1H5N A;  1OGY A;  5T5I D;  1TWH A;  3GTM A;  2VUM A;  1G8J A;  2Y0S A;  4KDL A;  3GTQ A;  1Y4Z A; 
#chains in the Genus database with same CATH topology
 1N10 A;  2KI8 A;  4ZM7 A;  2PWY A;  4GA5 A;  4D7Z B;  3X2G A;  2PMZ A;  2QQR A;  2PJJ A;  2NYA A;  3SUK A;  1FDI A;  2EEO B;  2VPY A;  3X2O A;  3GTJ A;  3LHD A;  4AOK B;  1TWA A;  4FG2 A;  1E60 A;  2PIC A;  3HU1 A;  4QIW A;  3FPT A;  4FG4 A;  3HU2 A;  2GF7 A;  1Y1W A;  1SIW A;  2BH0 A;  3MB5 A;  3GTO A;  2GAE A;  4AQ7 A;  3X2M A;  1PPY A;  3QWZ A;  1I9G A;  3SUJ A;  4KO8 A;  5B6C A;  3IR5 A;  4ARC A;  3ZGZ A;  3X2J A;  4DMR A;  1I50 A;  2R92 A;  2LW6 A;  1Y5I A;  1KQG A;  2XDP A;  3QQ7 A;  2JIQ A;  4CQN A;  2MM2 A;  1IW7 D;  5GLX A;  2VPW A;  3SUL A;  3ML1 A;  3BQB A;  3X2H A;  1PQE A;  4AZD A;  1Q16 A;  3QC8 A;  1PYQ A;  3PLX B;  3HU3 A;  2GFA A;  4FIB A;  2YVL A;  3LGA A;  2KQA A;  5CCB A;  2JIO A;  4AVR A;  1R7R A;  4UC4 A;  1YNN D;  2QQS A;  2E7Z A;  2JIP A;  1VC3 B;  3GTK A;  2VPZ A;  1AA6 A;  3CF2 A;  3X2P A;  4FFT A;  1SMY D;  2C45 A;  3CZB A;  2JA7 A;  2B63 A;  1YLE A;  5GLY A;  4AYB A;  2YU9 A;  5EQJ B;  4ENG A;  2JA6 A;  2BE5 D;  2NAP A;  3FKI A;  4JS7 A;  4CRZ A;  2R93 A;  2Q1C X;  5FTJ A;  4C2M A;  4KOD A;  2O5J D;  3FPU A;  2Q18 X;  3M3G A;  3IR7 A;  2Q1D X;  1FDO A;  2PI8 A;  3O5A A;  1TWC A;  5GLF A;  1E18 A;  1L8F A;  2B25 A;  1UHE A;  4NOH A;  5FTN A;  4ARI A;  5T5M D;  1Y1V A;  3H0G A;  1BW3 A;  2Q19 X;  3TM7 B;  5CCX A;  4AON B;  1ZYR D;  5C1B A;  5FTL A;  4FER A;  2VPX A;  1BW4 A;  4KLN A;  2Q1A X;  3GTL A;  1AW8 B;  1PQH A;  5FTM A;  2V45 A;  3HKZ A;  4KDI A;  1ZC1 A;  1TWF A;  1HD5 A;  2JIM A;  1OA7 A;  5D6X A;  2NVY A;  3X2L A;  2R7Z A;  1R27 A;  1G8K A;  2HCZ X;  5C18 A;  3ZJU A;  5ERG B;  1I3Q A;  1QCS A;  2A68 D;  2WAQ A;  1E32 A;  2AE0 X;  5H4U A;  5CD1 A;  4JCW A;  3ENG A;  3D30 A;  3OUG A;  5D6W A;  3IR6 A;  3GTG A;  4CS0 A;  1PQF A;  4CRY G;  4GA6 A;  5DYI A;  4AAY A;  4RV0 A;  2IV2 X;  2E2I A;  1E5V A;  3CQZ A;  1S3S A;  3ZJT A;  3DMR A;  1SFO A;  1WLF A;  5EPP A;  4JP6 A;  3TIW A;  2JA5 A;  2E2H A;  2A6H D;  1WC2 A;  1PYU B;  2CW0 D;  1CZ5 A;  1CR5 A;  2A6E D;  2JIR A;  1EU1 A;  4AS1 A;  2V3V A;  2YUJ A;  3X2N A;  2ENG A;  1K83 A;  1O54 A;  1R9T A;  3QQ8 A;  2G5D A;  1CZ4 A;  1PT0 A;  2JV2 A;  1TMO A;  4JJO A;  2NVX A;  1E61 A;  1QDN A;  1H0H A;  1UHD A;  1TWG A;  2PJH B;  4JP7 A;  5GM9 A;  2DMR A;  2WB1 A;  2KY9 A;  4L48 A;  1KQF A;  1PT1 A;  5DYG A;  1DMR A;  3GTP A;  1WCM A;  2PNW A;  3FPR A;  3SUM A;  1DMS A;  5FTK A;  1H5N A;  3X2K A;  1OA9 A;  1YNJ D;  1OGY A;  5T5I D;  1TWH A;  2G6G A;  3GTM A;  2VUM A;  1G8J A;  3ZJV A;  2Y0S A;  3X2I A;  2MM0 A;  5D6Y A;  4KDL A;  3GTQ A;  2A69 D;  1Y4Z A; 
#chains in the Genus database with same CATH homology
 2KI8 A;  2PWY A;  4GA5 A;  4D7Z B;  2PMZ A;  2QQR A;  2PJJ A;  2NYA A;  1FDI A;  2EEO B;  2VPY A;  3GTJ A;  3LHD A;  4AOK B;  1TWA A;  4QIW A;  1E60 A;  2PIC A;  3HU1 A;  3FPT A;  2GF7 A;  3HU2 A;  1Y1W A;  1SIW A;  3MB5 A;  4AQ7 A;  3GTO A;  2GAE A;  1PPY A;  3QWZ A;  1I9G A;  5B6C A;  4KO8 A;  3IR5 A;  4ARC A;  3ZGZ A;  4DMR A;  1I50 A;  2R92 A;  2LW6 A;  1Y5I A;  1KQG A;  2XDP A;  3QQ7 A;  2JIQ A;  4CQN A;  2MM2 A;  1IW7 D;  2VPW A;  3ML1 A;  3BQB A;  1PQE A;  4AZD A;  1Q16 A;  3QC8 A;  1PYQ A;  3PLX B;  3HU3 A;  2GFA A;  4FIB A;  2YVL A;  3LGA A;  5CCB A;  2JIO A;  1R7R A;  4UC4 A;  1YNN D;  2QQS A;  2E7Z A;  2JIP A;  1VC3 B;  3GTK A;  2VPZ A;  1AA6 A;  3CF2 A;  1SMY D;  2C45 A;  3CZB A;  2JA7 A;  2B63 A;  1YLE A;  4AYB A;  2YU9 A;  5EQJ B;  2JA6 A;  2BE5 D;  2NAP A;  3FKI A;  4CRZ A;  2R93 A;  2Q1C X;  5FTJ A;  4C2M A;  4KOD A;  2O5J D;  3FPU A;  2Q18 X;  3IR7 A;  2Q1D X;  1FDO A;  2PI8 A;  3O5A A;  1TWC A;  5GLF A;  1E18 A;  2B25 A;  1UHE A;  4NOH A;  5FTN A;  4ARI A;  5T5M D;  1Y1V A;  3H0G A;  2Q19 X;  3TM7 B;  5CCX A;  4AON B;  1ZYR D;  5C1B A;  5FTL A;  2VPX A;  2Q1A X;  4KLN A;  3GTL A;  1AW8 B;  1PQH A;  5FTM A;  2V45 A;  3HKZ A;  4KDI A;  1ZC1 A;  1TWF A;  2JIM A;  5D6X A;  2NVY A;  2R7Z A;  1R27 A;  1G8K A;  3ZJU A;  5C18 A;  5ERG B;  1I3Q A;  1QCS A;  2A68 D;  2WAQ A;  1E32 A;  2AE0 X;  5CD1 A;  3OUG A;  5D6W A;  3IR6 A;  3GTG A;  4CS0 A;  1PQF A;  4CRY G;  4GA6 A;  5DYI A;  4AAY A;  4RV0 A;  2IV2 X;  2E2I A;  1E5V A;  3CQZ A;  1S3S A;  3ZJT A;  3DMR A;  1SFO A;  1WLF A;  5EPP A;  3TIW A;  2JA5 A;  2E2H A;  2A6H D;  1PYU B;  2CW0 D;  1CZ5 A;  1CR5 A;  2A6E D;  2JIR A;  1EU1 A;  4AS1 A;  2V3V A;  2YUJ A;  1O54 A;  1K83 A;  1R9T A;  3QQ8 A;  2G5D A;  1CZ4 A;  1PT0 A;  2JV2 A;  1TMO A;  2NVX A;  1E61 A;  1QDN A;  1H0H A;  1UHD A;  1TWG A;  2PJH B;  2DMR A;  2WB1 A;  2KY9 A;  1KQF A;  1PT1 A;  5DYG A;  1DMR A;  3GTP A;  1WCM A;  2PNW A;  3FPR A;  1DMS A;  5FTK A;  1H5N A;  1YNJ D;  1OGY A;  5T5I D;  1TWH A;  2G6G A;  3GTM A;  2VUM A;  1G8J A;  3ZJV A;  2Y0S A;  2MM0 A;  5D6Y A;  4KDL A;  3GTQ A;  2A69 D;  1Y4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...