3QC8A

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
b'PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 48
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3qc8A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3qc8A02
3QWZA 5B6CA 1UHDA 3DMRA 1TMOA 4DMRA 1WLFA 5DYIA 1PYUB 2JIOA 3IR7A 4GA6A 2WB1A 3QC8A 1E32A 2R92A 5FTJA 2VPZA 1QCSA 1E5VA 2E2HA 1Y1VA 3CQZA 4AOKB 5FTLA 2PJHB 1H5NA 2DMRA 2V3VA 1S3SA 5FTNA 1CZ5A 5GLFA 2B63A 2PMZA 1Y1WA 3GTPA 2YUJA 1UHEA 1E61A 1I50A 1IW7D 4CRZA 2JA7A 4GA5A 1PPYA 1R9TA 1G8JA 1VC3B 5FTKA 1CZ4A 1R27A 4KLNA 3FKIA 4KDLA 2VPYA 2VPWA 2C45A 3GTQA 1TWGA 1WCMA 2E7ZA 1FDOA 5FTMA 4AZDA 1AA6A 2R93A 1KQGA 2JIRA 2NVXA 3IR6A 2JV2A 3GTLA 2EEOB 1Y5IA 5T5ID 2VUMA 2YU9A 1E18A 1QDNA 3OUGA 3GTGA 1PQHA 1TWFA 1G8KA 1YLEA 3O5AA 3GTOA 1PT0A 5T5MD 5EPPA 2R7ZA 4KDIA 3TM7B 2JIQA 3HU3A 3HU2A 1R7RA 2NYAA 2NAPA 3GTKA 1K83A 2JA5A 2JIMA 1AW8B 1Q16A 2JIPA 3QQ8A 1H0HA 1PQEA 2KI8A 3TIWA 4C2MA 1TWHA 4AYBA 2IV2X 3ML1A 2WAQA 5C1BA 2Y0SA 2JA6A 1TWCA 4AONB 1DMRA 1PT1A 3HKZA 3GTJA 4D7ZB 1Y4ZA 1DMSA 1ZC1A 1CR5A 3PLXB 1E60A 3HU1A 3CF2A 2VPXA 1PYQA 4CRYG 4AAYA 4QIWA 2E2IA 1OGYA 5DYGA 4KODA 1KQFA 1SIWA 3IR5A 4RV0A 1EU1A 5C18A 3QQ7A 4KO8A 1SFOA 4CS0A 1PQFA 1I3QA 2V45A 3GTMA 3H0GA 1TWAA 1FDIA 2NVYA
chains in the Genus database with same CATH superfamily
3QWZA 5B6CA 1UHDA 1I9GA 4FG4A 3DMRA 1TMOA 2A6ED 4JP7A 4DMRA 1WLFA 5DYIA 1PYUB 2JIOA 3IR7A 4GA6A 1L8FA 4ZM7A 2WB1A 3QC8A 1N10A 1E32A 2R92A 5FTJA 2VPZA 3SUMA 4FG2A 1QCSA 1E5VA 3FPTA 2E2HA 3SUKA 1Y1VA 3CQZA 1OA7A 4FERA 1WC2A 4AOKB 5FTLA 2PJHB 4FIBA 5GM9A 1H5NA 2DMRA 2V3VA 1S3SA 5FTNA 1CZ5A 3ZJUA 5GLFA 2A68D 2B63A 1BW4A 2PMZA 4AS1A 2YUJA 4JJOA 3X2HA 3GTPA 1Y1WA 1UHEA 3D30A 2GF7A 1YNJD 4ENGA 3BQBA 1E61A 1I50A 2Q1CX 1IW7D 4CRZA 2JA7A 4GA5A 5EQJB 3ZGZA 1PPYA 1R9TA 5CD1A 3FPUA 1G8JA 1VC3B 5FTKA 1CZ4A 3X2JA 4JCWA 4AVRA 1R27A 4KLNA 3FKIA 4KDLA 1BW3A 2VPYA 2VPWA 2C45A 3GTQA 1TWGA 1WCMA 2E7ZA 4JP6A 1FDOA 5FTMA 4AZDA 1AA6A 3LHDA 2R93A 1KQGA 2JIRA 2NVXA 3IR6A 2QQRA 2PNWA 3X2GA 5D6XA 3M3GA 2JV2A 3GTLA 3X2LA 2EEOB 1Y5IA 2PJJA 3ENGA 5T5ID 2YU9A 2HCZX 1E18A 2VUMA 1QDNA 2LW6A 5H4UA 2BH0A 2YVLA 3OUGA 2CW0D 1OA9A 1PQHA 1TWFA 4NOHA 3GTGA 1G8KA 4L48A 1YLEA 3O5AA 3X2NA 1PT0A 3GTOA 5T5MD 2G5DA 3SUJA 5EPPA 1O54A 1HD5A 1YNND 2A69D 5CCBA 2R7ZA 5CCXA 1SMYD 4KDIA 3TM7B 2JIQA 2KQAA 3HU3A 2PI8A 3HU2A 1R7RA 2NYAA 2NAPA 3GTKA 1K83A 2JA5A 4CQNA 2JIMA 1AW8B 1Q16A 2JIPA 3QQ8A 4ARCA 1H0HA 2ENGA 3X2OA 5D6WA 1PQEA 2KI8A 2B25A 3TIWA 4C2MA 1TWHA 2Q1DX 4AYBA 2IV2X 3ML1A 2WAQA 2Q1AX 4ARIA 5C1BA 2O5JD 2Y0SA 2JA6A 2KY9A 1TWCA 4AONB 1DMRA 2QQSA 2AE0X 1PT1A 3HKZA 2BE5D 3GTJA 4D7ZB 2GAEA 3X2MA 1ZC1A 1DMSA 1Y4ZA 1CR5A 3X2PA 2G6GA 3PLXB 1E60A 3HU1A 3SULA 2PWYA 3MB5A 3CF2A 2VPXA 5D6YA 4AQ7A 3ZJVA 1PYQA 4CRYG 2Q19X 4AAYA 3LGAA 2MM2A 4QIWA 2MM0A 3X2KA 1OGYA 1ZYRD 2E2IA 5DYGA 3FPRA 2A6HD 4KODA 1KQFA 3CZBA 1SIWA 3IR5A 2XDPA 5ERGB 4RV0A 1EU1A 5C18A 3QQ7A 4FFTA 4KO8A 3X2IA 1SFOA 4CS0A 5GLYA 1PQFA 1I3QA 2V45A 3GTMA 2PICA 3H0GA 4UC4A 5GLXA 1TWAA 2GFAA 2Q18X 4JS7A 1FDIA 2NVYA 3ZJTA
chains in the Genus database with same CATH topology
3QWZA 5B6CA 1UHDA 1I9GA 3DMRA 1TMOA 2A6ED 4DMRA 1WLFA 5DYIA 1PYUB 2JIOA 3IR7A 4GA6A 2WB1A 3QC8A 1E32A 2R92A 5FTJA 2VPZA 1QCSA 1E5VA 3FPTA 2E2HA 1Y1VA 3CQZA 4AOKB 5FTLA 2PJHB 4FIBA 3ZJUA 1H5NA 2DMRA 2V3VA 1S3SA 5FTNA 1CZ5A 4AS1A 5GLFA 2A68D 2B63A 2PMZA 2YUJA 3GTPA 1Y1WA 2GF7A 3BQBA 1UHEA 1YNJD 1E61A 1I50A 2Q1CX 1IW7D 4CRZA 2JA7A 4GA5A 5EQJB 3ZGZA 1PPYA 1R9TA 5CD1A 3FPUA 1G8JA 1VC3B 5FTKA 1CZ4A 1R27A 4KLNA 3FKIA 4KDLA 2VPYA 2VPWA 2C45A 3GTQA 1TWGA 1WCMA 2E7ZA 1FDOA 5FTMA 4AZDA 1AA6A 3LHDA 2R93A 1KQGA 2JIRA 2NVXA 3IR6A 2QQRA 2PNWA 5D6XA 2JV2A 3GTLA 2EEOB 1Y5IA 2PJJA 5T5ID 2VUMA 2YU9A 2LW6A 1E18A 2YVLA 1QDNA 3OUGA 2CW0D 4NOHA 1PQHA 1TWFA 3GTGA 1G8KA 4ARIA 1YLEA 3O5AA 3GTOA 1PT0A 1O54A 5T5MD 2G5DA 5EPPA 1YNND 2A69D 5CCBA 2R7ZA 5CCXA 1SMYD 4KDIA 3TM7B 2JIQA 3HU3A 2PI8A 3HU2A 1R7RA 2NYAA 2NAPA 3GTKA 1K83A 2JA5A 4CQNA 2JIMA 1AW8B 1Q16A 2JIPA 3QQ8A 4ARCA 1H0HA 5D6WA 1PQEA 2KI8A 2B25A 3TIWA 4C2MA 1TWHA 2Q1DX 4AYBA 2IV2X 3ML1A 2WAQA 2Q1AX 5C1BA 2O5JD 2Y0SA 2JA6A 2KY9A 1TWCA 4AONB 1DMRA 2QQSA 2AE0X 1PT1A 3HKZA 2BE5D 3GTJA 4D7ZB 2GAEA 1ZC1A 1DMSA 1Y4ZA 1CR5A 2G6GA 3PLXB 1E60A 3HU1A 2PWYA 3MB5A 3CF2A 2VPXA 5D6YA 4AQ7A 3ZJVA 1PYQA 4CRYG 2Q19X 4AAYA 3LGAA 2MM2A 4QIWA 2MM0A 2E2IA 1OGYA 1ZYRD 3FPRA 5DYGA 2A6HD 4KODA 1KQFA 3CZBA 1SIWA 3IR5A 2XDPA 5ERGB 4RV0A 1EU1A 5C18A 3QQ7A 4KO8A 1SFOA 4CS0A 1PQFA 1I3QA 2V45A 3GTMA 2PICA 3H0GA 4UC4A 1TWAA 2GFAA 2Q18X 1FDIA 2NVYA 3ZJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWZ A;  5B6C A;  1UHD A;  3DMR A;  1TMO A;  4DMR A;  1WLF A;  5DYI A;  1PYU B;  2JIO A;  3IR7 A;  4GA6 A;  2WB1 A;  3QC8 A;  1E32 A;  2R92 A;  5FTJ A;  2VPZ A;  1QCS A;  1E5V A;  2E2H A;  1Y1V A;  3CQZ A;  4AOK B;  5FTL A;  2PJH B;  1H5N A;  2DMR A;  2V3V A;  1S3S A;  5FTN A;  1CZ5 A;  5GLF A;  2B63 A;  2PMZ A;  1Y1W A;  3GTP A;  2YUJ A;  1UHE A;  1E61 A;  1I50 A;  1IW7 D;  4CRZ A;  2JA7 A;  4GA5 A;  1PPY A;  1R9T A;  1G8J A;  1VC3 B;  5FTK A;  1CZ4 A;  1R27 A;  4KLN A;  3FKI A;  4KDL A;  2VPY A;  2VPW A;  2C45 A;  3GTQ A;  1TWG A;  1WCM A;  2E7Z A;  1FDO A;  5FTM A;  4AZD A;  1AA6 A;  2R93 A;  1KQG A;  2JIR A;  2NVX A;  3IR6 A;  2JV2 A;  3GTL A;  2EEO B;  1Y5I A;  5T5I D;  2VUM A;  2YU9 A;  1E18 A;  1QDN A;  3OUG A;  3GTG A;  1PQH A;  1TWF A;  1G8K A;  1YLE A;  3O5A A;  3GTO A;  1PT0 A;  5T5M D;  5EPP A;  2R7Z A;  4KDI A;  3TM7 B;  2JIQ A;  3HU3 A;  3HU2 A;  1R7R A;  2NYA A;  2NAP A;  3GTK A;  1K83 A;  2JA5 A;  2JIM A;  1AW8 B;  1Q16 A;  2JIP A;  3QQ8 A;  1H0H A;  1PQE A;  2KI8 A;  3TIW A;  4C2M A;  1TWH A;  4AYB A;  2IV2 X;  3ML1 A;  2WAQ A;  5C1B A;  2Y0S A;  2JA6 A;  1TWC A;  4AON B;  1DMR A;  1PT1 A;  3HKZ A;  3GTJ A;  4D7Z B;  1Y4Z A;  1DMS A;  1ZC1 A;  1CR5 A;  3PLX B;  1E60 A;  3HU1 A;  3CF2 A;  2VPX A;  1PYQ A;  4CRY G;  4AAY A;  4QIW A;  2E2I A;  1OGY A;  5DYG A;  4KOD A;  1KQF A;  1SIW A;  3IR5 A;  4RV0 A;  1EU1 A;  5C18 A;  3QQ7 A;  4KO8 A;  1SFO A;  4CS0 A;  1PQF A;  1I3Q A;  2V45 A;  3GTM A;  3H0G A;  1TWA A;  1FDI A;  2NVY A; 
#chains in the Genus database with same CATH topology
 3QWZ A;  5B6C A;  1UHD A;  1I9G A;  4FG4 A;  3DMR A;  1TMO A;  2A6E D;  4JP7 A;  4DMR A;  1WLF A;  5DYI A;  1PYU B;  2JIO A;  3IR7 A;  4GA6 A;  1L8F A;  4ZM7 A;  2WB1 A;  3QC8 A;  1N10 A;  1E32 A;  2R92 A;  5FTJ A;  2VPZ A;  3SUM A;  4FG2 A;  1QCS A;  1E5V A;  3FPT A;  2E2H A;  3SUK A;  1Y1V A;  3CQZ A;  1OA7 A;  4FER A;  1WC2 A;  4AOK B;  5FTL A;  2PJH B;  4FIB A;  5GM9 A;  1H5N A;  2DMR A;  2V3V A;  1S3S A;  5FTN A;  1CZ5 A;  3ZJU A;  5GLF A;  2A68 D;  2B63 A;  1BW4 A;  2PMZ A;  4AS1 A;  2YUJ A;  4JJO A;  3X2H A;  3GTP A;  1Y1W A;  1UHE A;  3D30 A;  2GF7 A;  1YNJ D;  4ENG A;  3BQB A;  1E61 A;  1I50 A;  2Q1C X;  1IW7 D;  4CRZ A;  2JA7 A;  4GA5 A;  5EQJ B;  3ZGZ A;  1PPY A;  1R9T A;  5CD1 A;  3FPU A;  1G8J A;  1VC3 B;  5FTK A;  1CZ4 A;  3X2J A;  4JCW A;  4AVR A;  1R27 A;  4KLN A;  3FKI A;  4KDL A;  1BW3 A;  2VPY A;  2VPW A;  2C45 A;  3GTQ A;  1TWG A;  1WCM A;  2E7Z A;  4JP6 A;  1FDO A;  5FTM A;  4AZD A;  1AA6 A;  3LHD A;  2R93 A;  1KQG A;  2JIR A;  2NVX A;  3IR6 A;  2QQR A;  2PNW A;  3X2G A;  5D6X A;  3M3G A;  2JV2 A;  3GTL A;  3X2L A;  2EEO B;  1Y5I A;  2PJJ A;  3ENG A;  5T5I D;  2YU9 A;  2HCZ X;  1E18 A;  2VUM A;  1QDN A;  2LW6 A;  5H4U A;  2BH0 A;  2YVL A;  3OUG A;  2CW0 D;  1OA9 A;  1PQH A;  1TWF A;  4NOH A;  3GTG A;  1G8K A;  4L48 A;  1YLE A;  3O5A A;  3X2N A;  1PT0 A;  3GTO A;  5T5M D;  2G5D A;  3SUJ A;  5EPP A;  1O54 A;  1HD5 A;  1YNN D;  2A69 D;  5CCB A;  2R7Z A;  5CCX A;  1SMY D;  4KDI A;  3TM7 B;  2JIQ A;  2KQA A;  3HU3 A;  2PI8 A;  3HU2 A;  1R7R A;  2NYA A;  2NAP A;  3GTK A;  1K83 A;  2JA5 A;  4CQN A;  2JIM A;  1AW8 B;  1Q16 A;  2JIP A;  3QQ8 A;  4ARC A;  1H0H A;  2ENG A;  3X2O A;  5D6W A;  1PQE A;  2KI8 A;  2B25 A;  3TIW A;  4C2M A;  1TWH A;  2Q1D X;  4AYB A;  2IV2 X;  3ML1 A;  2WAQ A;  2Q1A X;  4ARI A;  5C1B A;  2O5J D;  2Y0S A;  2JA6 A;  2KY9 A;  1TWC A;  4AON B;  1DMR A;  2QQS A;  2AE0 X;  1PT1 A;  3HKZ A;  2BE5 D;  3GTJ A;  4D7Z B;  2GAE A;  3X2M A;  1ZC1 A;  1DMS A;  1Y4Z A;  1CR5 A;  3X2P A;  2G6G A;  3PLX B;  1E60 A;  3HU1 A;  3SUL A;  2PWY A;  3MB5 A;  3CF2 A;  2VPX A;  5D6Y A;  4AQ7 A;  3ZJV A;  1PYQ A;  4CRY G;  2Q19 X;  4AAY A;  3LGA A;  2MM2 A;  4QIW A;  2MM0 A;  3X2K A;  1OGY A;  1ZYR D;  2E2I A;  5DYG A;  3FPR A;  2A6H D;  4KOD A;  1KQF A;  3CZB A;  1SIW A;  3IR5 A;  2XDP A;  5ERG B;  4RV0 A;  1EU1 A;  5C18 A;  3QQ7 A;  4FFT A;  4KO8 A;  3X2I A;  1SFO A;  4CS0 A;  5GLY A;  1PQF A;  1I3Q A;  2V45 A;  3GTM A;  2PIC A;  3H0G A;  4UC4 A;  5GLX A;  1TWA A;  2GFA A;  2Q18 X;  4JS7 A;  1FDI A;  2NVY A;  3ZJT A; 
#chains in the Genus database with same CATH homology
 3QWZ A;  5B6C A;  1UHD A;  1I9G A;  3DMR A;  1TMO A;  2A6E D;  4DMR A;  1WLF A;  5DYI A;  1PYU B;  2JIO A;  3IR7 A;  4GA6 A;  2WB1 A;  3QC8 A;  1E32 A;  2R92 A;  5FTJ A;  2VPZ A;  1QCS A;  1E5V A;  3FPT A;  2E2H A;  1Y1V A;  3CQZ A;  4AOK B;  5FTL A;  2PJH B;  4FIB A;  3ZJU A;  1H5N A;  2DMR A;  2V3V A;  1S3S A;  5FTN A;  1CZ5 A;  4AS1 A;  5GLF A;  2A68 D;  2B63 A;  2PMZ A;  2YUJ A;  3GTP A;  1Y1W A;  2GF7 A;  3BQB A;  1UHE A;  1YNJ D;  1E61 A;  1I50 A;  2Q1C X;  1IW7 D;  4CRZ A;  2JA7 A;  4GA5 A;  5EQJ B;  3ZGZ A;  1PPY A;  1R9T A;  5CD1 A;  3FPU A;  1G8J A;  1VC3 B;  5FTK A;  1CZ4 A;  1R27 A;  4KLN A;  3FKI A;  4KDL A;  2VPY A;  2VPW A;  2C45 A;  3GTQ A;  1TWG A;  1WCM A;  2E7Z A;  1FDO A;  5FTM A;  4AZD A;  1AA6 A;  3LHD A;  2R93 A;  1KQG A;  2JIR A;  2NVX A;  3IR6 A;  2QQR A;  2PNW A;  5D6X A;  2JV2 A;  3GTL A;  2EEO B;  1Y5I A;  2PJJ A;  5T5I D;  2VUM A;  2YU9 A;  2LW6 A;  1E18 A;  2YVL A;  1QDN A;  3OUG A;  2CW0 D;  4NOH A;  1PQH A;  1TWF A;  3GTG A;  1G8K A;  4ARI A;  1YLE A;  3O5A A;  3GTO A;  1PT0 A;  1O54 A;  5T5M D;  2G5D A;  5EPP A;  1YNN D;  2A69 D;  5CCB A;  2R7Z A;  5CCX A;  1SMY D;  4KDI A;  3TM7 B;  2JIQ A;  3HU3 A;  2PI8 A;  3HU2 A;  1R7R A;  2NYA A;  2NAP A;  3GTK A;  1K83 A;  2JA5 A;  4CQN A;  2JIM A;  1AW8 B;  1Q16 A;  2JIP A;  3QQ8 A;  4ARC A;  1H0H A;  5D6W A;  1PQE A;  2KI8 A;  2B25 A;  3TIW A;  4C2M A;  1TWH A;  2Q1D X;  4AYB A;  2IV2 X;  3ML1 A;  2WAQ A;  2Q1A X;  5C1B A;  2O5J D;  2Y0S A;  2JA6 A;  2KY9 A;  1TWC A;  4AON B;  1DMR A;  2QQS A;  2AE0 X;  1PT1 A;  3HKZ A;  2BE5 D;  3GTJ A;  4D7Z B;  2GAE A;  1ZC1 A;  1DMS A;  1Y4Z A;  1CR5 A;  2G6G A;  3PLX B;  1E60 A;  3HU1 A;  2PWY A;  3MB5 A;  3CF2 A;  2VPX A;  5D6Y A;  4AQ7 A;  3ZJV A;  1PYQ A;  4CRY G;  2Q19 X;  4AAY A;  3LGA A;  2MM2 A;  4QIW A;  2MM0 A;  2E2I A;  1OGY A;  1ZYR D;  3FPR A;  5DYG A;  2A6H D;  4KOD A;  1KQF A;  3CZB A;  1SIW A;  3IR5 A;  2XDP A;  5ERG B;  4RV0 A;  1EU1 A;  5C18 A;  3QQ7 A;  4KO8 A;  1SFO A;  4CS0 A;  1PQF A;  1I3Q A;  2V45 A;  3GTM A;  2PIC A;  3H0G A;  4UC4 A;  1TWA A;  2GFA A;  2Q18 X;  1FDI A;  2NVY A;  3ZJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...