1I9GA

Crystal structure of an adomet dependent methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
264
Chain Sequence
TGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN RV2118C
total genus 74
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1i9gA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i9gA02
4X1OA 3BWCA 3DXZA 3OPNA 2NXJA 5EHIA 4O29A 5EPEA 1JG1A 3NWEA 4HGYA 1VLMA 5C9ZA 1O9HA 4YV0A 4QPPA 4BLUA 5EIWA 3KPUA 3JWJA 3Q87B 3UJ7A 3DTNA 3TOSA 5T64A 1SKMA 4DF3A 3JWIA 3LDGA 4KW7A 2OB1A 4RVFA 2PT6A 3A7DA 3DULA 1VQ1A 5E1DA 5IKMA 1YFLA 1FP2A 4OX9Y 3ERCA 5CVDA 4PYQA 1YB2A 4IWNA 3O7WA 2PY6A 3ER8A 4ER0A 2G8NA 2ZIEA 3FYCA 5BW4A 3CBGA 1ZHFA 3TKYA 2YTZA 5KYGA 2PKWA 4GUAA 2IBSA 3GCZA 5K0GA 2P3LA 2PXCA 4NECA 1WS6A 4CTJA 4E2XA 5DWQA 4YMGA 4GC9A 4HGZA 2BR5A 3HA5A 4CTKA 3OCJA 1DCTA 5CD1A 5ICFA 3NMUF 5EZSA 2NP6A 1JR4A 4PYNA 2AOVA 5GOZA 4RVHA 5HOQA 2Q41A 3C0KA 4YV1A 3U81A 1KXZA 2OKCA 3E8SA 3AXTA 1QANA 4U7PB 3NJRA 3GGDA 3JWGA 2IH4A 1KPIA 3EMDA 1RJDA 3KPJA 4GOND 3RIEA 1I1NA 4CKEA 2UYCA 2ZZMA 2ZCJA 1KPGA 2FPOA 3NW9A 2BR4A 4GC5A 3CVOA 1XDSA 3LPMA 2PXAA 2JHPA 5E9QA 3GRVA 5CVUA 3OFJA 3KR9A 4X63A 3FZGA 4YUWA 4RTLA 2K4MA 2PVCA 4AZSA 2P35A 4R6WA 3I64A 2ERCA 1SQGA 2O0LA 3MB5A 2AN5A 2PV0A 2NXNA 2PX4A 3HCCA 1YFJA 1L9KA 1M6YA 4QTTB 1VE3A 3TM5A 4F85A 3MCTA 4P7GA 4E2YA 5FWAA 3EEOA 1D2GA 5U4XA 5K0NA 1Q0TA 5CIYA 1Y8CA 2VS1A 5EQJB 4FGZA 3SGLA 5GWXA 4AUKA 3EVBA 2YVLA 4YV2A 3KQVA 3KR2A 3GRUA 1KHHA 4E30A 4E32A 1AQJA 2ZW9A 4AZVA 2IDKA 1FJXA 3BZBA 3GJYA 3KKZA 3B3FA 5EVJA 2ZWVA 2EJTA 3GO4A 1XDZA 2OBFA 3M6VA 2AR0A 5CVEA 3UWPA 3HVKA 2PSSA 3FUVA 2IBTA 2WA1A 2ZIFA 3LSTA 2WA2A 2ZTHA 3NDIA 2B25A 4U7TB 5DM1A 4BP1A 2C7OA 2H11A 2O05A 4CKBA 5DSTA 3G88A 1YUBA 5BXYA 2YXEA 4PCLA 2OY0A 3FTFA 3KPWA 3EVFA 3PT9A 1NV9A 3FPJA 4GF5A 1XJ5A 3M6XA 3GWZA 2PX5A 3CC8A 5DM4A 4RTQA 2IP2A 3KPVA 2NNWB 2UZ4A 5K8VA 3LL7A 1JTFA 1ZGAA 3TQSA 3TPZA 3P9KA 4QVKA 3LCVB 5JUWA 3EVAA 3MTEA 3EGEA 2CMGA 3Q7EA 4PIPA 5HZMA 1VPTA 3HA7A 4OQDA 1G38A 3KHKA 4PYMA 2Z6UA 3SSNA 4P7KA 3G2PA 3BWMA 3OFKA 1UFKA 5DXJA 4WVLA 4LG1A 1F3LA 4OQEA 3QOWA 2ZVJA 3P9CA 4H0NA 4RWZA 5DTRA 2R6ZA 3G2OA 2ZZNA 5K0FA 1WY7A 4HRAA 5B1SA 1Q0SA 2HTEA 3UJ6A 3UJ8A 2G1PA 3EEYA 3A27A 2OPBA 3KQSA 3DR5A 2I9KA 4EQZA 3R3HA 5LQCA 4E31A 4X41A 3ER9A 3LHDA 2AN4A 2VDUE 3AWIA 3LCUA 4IKPA 3OE5A 4P7JA 4FT2A 4PWYA 2ZBQA 4A6EA 3THSA 4BLWA 5LQUA 4IV8A 1IXKA 2ORED 1N2XA 3CGGA 4PIMA 5FQNA 2R3SA 3FRHA 2GS9A 3P8ZA 3FUWA 2BM8A 4GOMD 4EK9A 4RTNA 9MHTA 2ONYA 3MCZA 3G8AA 2PT9A 3KQTA 3P97A 4FSDA 4M7RA 5LSAA 3R9XB 5EIFA 4KVZA 2HR1A 3ELYA 1RI4A 1N7JA 1JG3A 2P40A 2Y1WA 5CVJA 5K0LA 3OU7A 2CMHA 3EGVA 1ORIA 5E2AA 5FHRA 1R8YA 2XYVA 3OU6A 1WXXA 1RJEA 3HCFA 3OZRA 4PYOA 1R74A 3HEMA 3LBFA 5DX8A 3PTAA 4KDRA 3CCFA 5E9WA 4MQ4A 3TKAA 3P2EA 5D1NA 3UFBA 2JG3A 5K0JA 3GRRA 5F2NA 1XTPA 3F4KA 1MJFA 1UIRA 1I9GA 2JHCA 3I53A 5ICEA 2PWYA 5EKXA 1HMYA 2AOTA 2AOWA 4GOOD 5G02A 4G56A 5E8JA 4C07A 5DSXA 2FYTA 2BZGA 2CKDA 4CWAA 1M0EA 3UJ9A 2B9EA 1SQFA 2ESRA 3H2BA 2IH2A 2UYHA 1SG9A 3FRIA 1NBHA 2QYOA 1X1AA 2YX1A 4F86A 1QAQA 4LWPA 5DPMA 5GIPE 1L3IA 1EIZA 5F2OA 1EG2A 1I4WA 2DULA 2QE6A 3DXXA 4R6XA 3E7PA 5EC8A 3P2IA 5GP1A 2JHAA 4EKGA 7MHTA 4HTFA 5DX1A 3ELWA 5T67A 3EVZA 5EHGA 3L8DA 2AN3A 1L3CA 5E1OA 5EGSA 4YMHA 8MHTA 3K6RA 1BKYA 1KIAA 2QRVB 3DOUA 3FTDA 3LCCA 2NP7A 2GA9A 1AF7A 3G8BA 2AZTA 2FK8A 2PBFA 3HCDA 4QDJA 4EVIA 1NT2A 4RVGA 1G8SA 2AVDA 2PXXA 4ISCA 3WSTA 5LQNA 2GH1A 2YR0A 5DTMA 2EX4A 1WZNA 3DXYA 4QPNA 5EMMA 4E2WA 2G70A 4C4AA 2V7EA 4M37A 3BKXA 2CWWA 2ZIGA 4ER5A 5K03A 3SVZA 1KYWA 2Z6QA 2B78A 2GB4A 1XCJA 3MAGA 3KQPA 3B7PA 1DUSA 4PGHA 1U2ZA 5FA8A 5KQSA 2Z6AA 3S68A 5EEGA 1Z3CA 5BP7A 5FUBA 1NE2A 1KYZA 3DMFA 3EVDA 1R00A 3VC2A 1PJZA 3KQQA 2I7CA 4RSRA 3V97A 1NV8A 3G5TA 2UYQA 3ELDA 5KS2A 2HMYB 2JH8A 5ICGA 2C7QA 4FZVA 4LWOA 5E1MA 3MERA 4JXJA 5EMJA 4KRGA 4DZRA 2C7RA 3K0BA 5KVAA 2OYRA 3I9FA 5EMKA 3M4XA 5E9JA 4A6DA 4EMSA 3GRYA 4DM3A 4YUXA 3UA3A 4KIFA 3FUTA 2G72A 5LQRA 1X1BA 4K6MA 4FSXA 1OR8A 4HTFB 2IIPA 3GU3A 4GBED 2YQZA 5BW5A 1D2HA 1JG2A 3EPPA 5CCXA 4F84A 4C05A 5K05A 2B3TA 3M6UA 1FPQA 1YF3A 3PB3A 2PX2A 3C6KA 3OU2A 3LKZA 4QQNA 3UBTA 3P9IA 3P71T 4DCMA 3CJTA 5HIMA 3A4TA 3X0DA 2PJDA 5LQAA 2WK1A 3D2LA 4BP3A 4KWCA 1DL5A 5D1HA 2FHPA 1ORHA 2O06A 2XVAA 3BUSA 5DM0A 2EJUA 4V0QA 5FADA 4ER7A 2IH5A 3KQWA 3HVHA 2P41A 3B3JA 3GRZA 4IV0A 4BLVA 2QY6A 2VZ9A 2QRVA 1NW7A 2N47A 5H02A 3LECA 2O07A 2BR3A 3KQYA 4M36A 4RYLA 5CVVA 4PYIA 3C3YA 3R0QA 1D2CA 1R8XA 5EOVA 5GM2A 2V74B 4C03A 3EVCA 5MHTA 4RV9A 3THRA 3FTEA 4HSGA 1KPHA 1KP9A 2H00A 4QQKA 4B17A 1JTEA 1NW8A 1VIDA 2OB2A 3KR0A 4P58A 5GM1A 3RW9A 5DXAA 4RTOA 3GNLA 2ZSUA 4AZTA 3FUUA 3BKWA 3SSOA 1L3BA 1X19A 3SM3A 2HNKA 5HIKA 1RI3A 4KDCA 3VC1A 4X61A 3UJAA 3T0IA 1TW2A 2IDJA 2PX8A 1P1CA 1O54A 2I6GA 3NVMB 5E1BA 4M38A 3TR6A 4YUVA 2JH9A 5P8WA 4QTUB 1EJ6A 5CCBA 3UJDA 3NDJA 4FP9A 3B3GA 4QDKA 5K0BA 1WXWA 1XVAA 1XDUA 4GQBA 3LDFA 3ORHA 3HVJA 3HCAA 1P91A 4P7FA 4X60A 5FULA 5LR6A 2YUIA 1JSXA 3M33A 3HP7A 5FCDA 4DKJA 5HIIA 3KQOA 1QAOA 2XVMA 4HH4A 1ZGJA 2ZZKA 1X1CA 10MHA 1X1DA 3M70A 2GPYA 1EJ0A 1HNNA 2ZFUA 1L1EA 5FQOA 5GINE 4DA4A 2AOUB 3T7RA 5K09A 1QAMA 2DPMA 1IM8A 3BT7A 5DRTA 2BH2A 3CKKA 2YXDA 2ZULA 3QOXA 3C6MA 4FS8A 2IFTA 2UYOA 2OXTA 4QVGA 5DX0A 3PX2A 1YZHA 3TRKA 5HILA 3V8VA 1NKVA 1EQAA 5DM2A 4DQ0A 3BWBA 3PVCA 5DRYA 4Y30A 1ZG3A 3OZTA 4R8SA 4XUDA 5CUQA 2AVNA 1N7IA 1TW3A 4HG2A 1RJGA 1VBFA 4OA5A 1H1DA 5EKUA 2VP3A 4XUCA 2E5WA 4POOA 4RTMA 3DUWA 1G6Q1 1V39A 2FCAA 2FK7A 3DH0A 5HIJA 1UWVA 3FPGA 3DMHA 5K01A 1RI1A 2ONZA 2XYRA 1JQEA 3MQ2A 4DMGA 2AOXA 2EG5A 4DCGA 4ER3A 2ZBPA 3IHTA 1G55A 1ZQ9A 3KPYA 3TMAA 3AJDA 3KQMA 4RVDA 1M6EX 3UJBA 3ELUA 3MHTA 3RODA 1VP9A 1SUIA 4RTKA 4CKCA 2QM3A 5M5BA 2P1DA 5FA5A 5LQJA 3PFGA 3KR1A 3TM4A 5HFJA 3BGDA 4BY9E 5FTWA 3FPHA 4OBWA 2YXLA 3NVKI 1AV6A 4UOEA 3A7EA 5C0OE 3DLIA 3EVEA 5CM2Z 3AXSA 3M6WA 5IH3A 4PONA 1INLA 3CJRA 1XCLA 3HM2A 3AY0A 3SX0A 3A25A 1B42A 1XXLA 2ZLBA 2HV9A 4GEKA 2PGXA 3PFHA 5E8RA 5C1IA 2P3OA 3R24A 1QYRA 5KQRA 3SXJA 4AX8A 3T7TA 2Y1XA 5ERGB 1BC5A 1SVUA 3VYWA 4Z2YA 3PLAE 2GAFA 4EKIA 3ME5A 4CXMA 5JR3A 2F8LA 1O9GA 2G71A 1JQDA 4AZWA 3UZUA 3FTCA 3G7UA 3BGVA 2JJQA 1EAMA 3E05A 3HCBA 1AQIA 2O57A 2NYUA 3G5LA 4MTLA 4PYLA 4RX1A 1JSZA 3SMQA 2A14A 4PYJA 5ICCA 2XYQA 5EG5A 4RTJA 3HVIA 1R6AA 3KU1A 3LX6A 3GXOA 1RI5A 1G60A 3SR4A 1PRYA 1IY9A 5HEKA 2EFJA 4Y2HA 2NXEA 2P7HA 3OZSA 3OE4A 1JG4A 5T6BA 5LQKA 3P2KA 4C04A 5DTQA 2IGTA 1FP1D 2ADMA 2P8JA 3IV6A 3O31A 4FR0A 3FUXA 4PNEA 2C7PA 2IPXA 3DP7A 4PCAA 2BM9A 3EGIA 3I58A 3LDUA 1MHTA 4RTRA 2VDVE 5EMLA 5K0EA 3G89A 1BOOA 4E70A 3ID6C 3I5UA 4YUZA 2OZVA 2NXCA 3EMBA 2AS0A 1NW5A 3GDHA 4ER6A 3DMGA 2OO3A 5DT2A 3VSEA 2P3QA 2GLUA 5DLYA 1KR5A 3G2MA 3PS9A 4L7VA 3C3PA 1TPYA 4PINA 3T7SA 3NWBA 3BXOA 4YUYA 3MGGA 2XBMA 1FBNA 4R8RA 3LKDA 3P9NA 4XUEA 3REOA 3DLCA 4ATNA 5GIOE 4R05A 2H1RA 2LD4A 2ZWAA 2PLWA 4OBXA 4V0RA 2FRXA 4FT4A 4PGGA 5E2BA 3E23A 2PWPA 2CL5A 4RTSA 1RJFA 3BWYA 3LBYA 2AOTB 3CJQA 4C06A 5FWDA 3PX3A 4C08A 1BHJA 1VL5A 3LGAA 3GIWA 3O4FA 3QV2A 2VDWA 1F38A 1QZZA 3TFWA 4GOLD 2P7IA 5F2KA 3UJCA 1G8AA 3HCEA 2B2CA 3FPFA 3UA4A 1NW6A 1VP3A 3A26A 3B5IA 3FPEA 3TLJA 3B89A 1P1BA 3G2QA 3HNRA 4KIGA 5FHQA 2AOUA 4WXHA 1RI2A 5EZQA 4MHTA 5EEHA 1NBIA 4E2ZA 3IYLW 1JQ3A 4MIKA 3FYDA 4E33A 3IEIA 4HC4A 2HWKA 3ANXA 1SUSA 3HA3A 3JWHA 4LECA 2ZBRA 3SSMA 3R6TA 1ZKDA 1WG8A 1T43A 1R18A 4OA8A 3EVGA 4ZTBA 3BGIA 3NTVA 1NW3A 4MWZA 3MTIA 1YZ3A 4PYKA 3HTXA 2KW5A 1P39A 4XCXA 2I62A 4RTPA 5K0CA
chains in the Genus database with same CATH superfamily
3GLIE 1SZDA 1WPXA 2RIRA 3QW4B 3TJRA 1DX4A 3DVAA 5EHIA 4PM4A 5EPEA 2AI1A 3WLMA 1P4HA 1TCAA 1NVTA 2QAGB 3CM0A 3UXEA 1MD9A 4LEIA 3UJ7A 2QEQA 3ZJ4A 3IBCA 4WZBB 4D8UA 1SD2A 2G9ZA 3B60A 4FU0A 3RIGA 5CLFA 1D2EA 3PC3A 4NKRA 1DBQA 4X1IB 2V8BA 4NFLA 5FYDA 5BUQA 5K0TA 5LQSA 2XTAA 1W44A 2PY6A 3RT9A 2A0FA 3VOSA 4LSGA 4PFKA 1QCCA 5BO5A 4ZZ3A 4G1MB 1Z35A 3FNIA 1A27A 1L5MA 4IRXA 4M8LA 4BN0A 5K0GA 4GKKB 1CUCA 2FPGA 2O0HA 3BSWA 3S2IA 1M8KA 5BV0A 1WCIB 3A6JA 5AUOB 1VSVA 1JA1A 1DEXA 1SCIA 1M83A 3GBVA 3EIXA 2AF4C 4HT3B 4XWOA 4R1UA 1TL7C 3B53X 3PIRA 1PDWA 4M7WA 2B4QA 4QJ4A 4LS3A 3IELA 3S7ZA 5BSHA 2VP0A 5AK4A 1F5SA 4R2WA 3UW3A 3LW8A 3RUFA 5TEWA 3CXUA 1E3LA 1XTRA 2X19A 1E1QA 4FFDA 1LF0A 1XEWX 3H3JA 1DX9A 1MJGA 5DCUA 4PG6A 1ICIA 1O89A 1XTZA 5JLAA 1TD9A 1NMEA 3Q3VA 5CEJA 1TQ2A 4RD4A 2FPOA 2C97A 1S1CA 1U0JA 1DBRA 2V4ZA 2FPPB 2WDZA 2ZQ5A 3PTLA 2EIHA 4W6QA 4HP8A 5A3VA 4YUWA 2ZYRA 2K4MA 3N74A 1X8KA 3Q9LA 5JZVA 2PMCA 4YAJA 1NVKA 2ERCA 4YQYA 2OFPA 1LDBA 3HJBA 1PQWA 2I6QA 2X0IA 2Y76A 4ND1A 5ELLA 3TOZA 2VYVA 4ENPA 5AD1A 2O8FA 1OBVA 2PV0A 1CLEA 3K53A 4EJSB 5K8JB 4Q4HA 3EG9B 5KNDH 3TM5A 1DBSA 3ADPA 1WOYA 2E4WA 2ID7A 4FDTA 4E2YA 1L5HB 2G7ZA 4LRQA 1KJWA 4JI6B 5K0NA 2PCJA 4K7JA 1Y8QB 2JD2A 2YC2C 1NYTA 1FF9A 1USKA 2Q5JA 3L2OB 3D6FA 4FGZA 2YVLA 2QX4A 4DMKA 2DB3A 2X7XA 1D4ZA 1DJQA 5F1OA 4I4TA 4EBFA 1E3MA 4DEXA 3W8FA 3QP9A 4AZVA 5EIEA 5JCZA 1IMOA 4XWAA 4OQYA 1W4BA 1N4AA 2EJTA 4K28A 3B2EA 4JUBA 4FDMA 3RFUA 1KFEB 1XVUA 2FQ1A 4CG1A 1MEJA 4O0MA 2Y8EA 3GT4A 3NDIA 1YNOA 2FWMX 3NHRA 1DDOA 4WLOA 1BWQA 1N32B 2IZ6A 2DUWA 4MKZA 2O5CA 1CZRA 4PCLA 4B8ZA 4D80A 2GD0A 2QLJA 2QUJA 1ZH6A 3RTBA 2JJ2D 4N4AA 4E08A 5EHZA 1OLSA 4YXWD 2OXRA 3RABA 3CC8A 3KVOA 5D3QA 3VJLA 4RTQA 2ODPA 1RACA 4GQAA 4DMFA 1VLLA 4G1CA 1Y6ZA 3OOWA 5F12A 1QG0A 4MCIA 2FA9A 1Z38A 2YIMA 1TM4E 1ZA1A 3AERA 1J9GA 3FPAA 3LQFA 5EIAA 1E60A 4JX8A 1YJXA 4PYMA 1BMFA 5THXA 1N3BA 3N8IA 1Z7WA 4OK3A 5C7YA 1KTIA 4KGZA 1PZEA 3IUJA 2Q5EA 3P9RA 1AQLA 4UNIA 2SHKA 2W8BA 2QVLA 3H13A 4AX4A 2PFKA 3IDQA 3Q8WA 1YBHA 2OL4A 1JLMA 3I23A 1F0YA 3DF7A 1PJLA 3ZZ0A 1IHOA 1Z13A 1ADFA 4BVFA 4C0KA 4Y1RB 5K6AC 4HWGA 3UMJA 3CVUA 4KR9A 2ZGVA 2PFSA 5FUXA 4K88A 2R8ZA 2IXFA 1ZOOA 1FRQA 3E70C 4D25A 1I7LA 2QPAA 1OYOA 2OFFA 3GV0A 1I5EA 3LHDA 4YMVA 3LCRA 4TMYA 4G5SA 3AUXA 2ZBQA 3MTQA 4ZO6A 4MR7A 3H1FA 2AQHA 4WN3A 3THSA 5LQUA 4Q48A 1U0RA 4JCCA 5FWXB 4PIMA 2J0QA 1AE1A 5IG2A 5HA5A 3G9ZA 2GMWA 3DF9A 5L7WA 5JWHA 5E4JA 1XMPA 4UMEA 1NR1A 2PG3A 1L7BA 1RI4A 3ABIA 3WLSA 4MDHA 3BCUA 5KINB 2Y1WA 1FRNA 4A0FA 2DBZA 1HQYE 4GKAA 5DHPA 5E2AA 1EFTA 3C7TA 3KKNA 1R74A 4AY6A 1RZVA 2SCUB 4XLZA 2CW5A 4UMDA 5E9WA 4MQ4A 4AJ9A 1PFGA 1USVA 4TTSA 3P2EA 2OVBA 2CUTA 3H11A 1SKUA 3ZNQA 5FWYA 2QZZA 5JRJA 5IJ9B 3S6JA 3KG2A 5TF0A 4ZYXA 2QW0X 1ZM7A 3F4KA 5LNK6 1SKBA 4MQEB 1UR5A 3JVIA 4Y1RA 2NUAA 3SS9X 1NBAA 4D8VA 4EHHA 3VRHA 2PSHA 5H9WA 2XQJA 2WZQA 4TWBA 2IY9A 1NMXA 2NU7B 4O4JF 4O4LA 4AP5A 1M0EA 1OVGA 4V38A 4DYHA 2ESRA 4FKMA 3LHKA 1T6YA 3DHVA 3S0JA 3H2BA 3EDYA 3NI2A 1UEJA 4MMZB 5EE5B 4GVPA 5REQB 3F7NA 3M4YA 2ZTSA 3EG5A 3MWDA 5A4JA 2X5NA 1N57A 4GL4A 3AFHA 4MUXA 3JQGA 1RRFA 2TRSB 1KP2A 4JR2A 4N7RA 5DBIA 4Q00A 5F21A 4KXLA 3I2KA 3P2IA 1XKXA 3SJAA 1T34A 1Q84A 5EHGA 2GM9A 1CS0B 2YY7A 1OI3A 1VI5A 1S01A 3L0OA 3OICA 3ADBA 4DDTA 5ERXA 2AZTA 1ECJA 3FCUB 3Q0EA 4L9SA 4N5DA 3PPIA 2JRCA 4ZT3A 1N6OA 2WJAA 4FXPA 5LQNA 5DTMA 4BEWA 3FE2A 1NNUA 2DWQA 4OHCA 4CV3A 4QUIA 1E7SA 1ZD8A 2AX4A 2RHJA 4K9NA 3U3RA 4ZN6A 5LDHA 1IONA 5C5DA 3O84A 2Q5LA 1GGJA 1P2TA 3E5RA 4EVRA 1U2ZA 3MYRA 3S68A 1TJ4A 5A7HA 1I3KA 4EAQA 1IPFA 2HI0A 2N75A 1NQTA 4HMQA 3VAZA 3IUQA 3H1PA 2BWJA 4NI5A 4QO7A 3RTCA 1FS6A 2QRMA 2O0MA 1ZOIA 5KSYA 4Y67A 2HMYB 4GE0A 4F4DA 1WLFA 1LZKA 1H66A 5DU2A 2C7QA 2IHKA 1GPWB 3OM8A 3QU2A 3IJEB 2NU6B 2Z09A 2ZJ1A 4F3CA 2C8LA 3PPWA 2IUFA 3RVBA 3BIXA 4QNMA 1D2NA 4ASUD 1R0WA 3MOIA 5BQOA 1YQEA 4F6CA 3QMPA 4ID9A 1R9MA 4JOCA 1TM2A 4CGZA 4J3FA 3ESBA 2H2FA 3OT5A 2JA2A 3GU3A 4EGQA 3PFWO 5IZCA 3M0EA 1GG5A 1QH1A 3L46A 3IPAA 3AEUA 3JASA 2GERA 5I4IA 5A06A 1C29B 2FZKA 3NTXA 3S28A 1X7GA 4J76A 2IU6A 4EOGA 1V95A 1QHIA 3PR1A 1Z0UA 4D44A 5HRCA 2PYDA 1DC8A 3PWKA 4LA4A 4OXKA 1G1AA 4E12A 1JSRA 4DDKA 4YMTA 2Y66A 4DADA 5JCXA 2PAFA 2FHPA 3N2LA 2HIHA 1EVLA 4R01A 1OYYA 2DPXA 4V0QA 3VKUA 2PAAA 5FADA 1SM4A 3TFOA 4CG0A 4P3XA 4PPNA 1QYVA 3KDPA 4IV0A 2C98A 4IIEA 3EGXA 4ZXFA 2QY6A 5JDCC 3TSOA 1GUYA 1S0UA 2O6LA 2Q9AA 3DCYA 4C7XA 3OURA 3C3CA 3DAGA 1XEWY 3OTHA 2GZ3A 4X64B 5MFPA 2YBDA 4Q3AA 5A7GA 3T38A 5LKAA 2VXBA 4I1VA 4MO2A 1JTEA 2X8WA 5AXAA 2GN2A 2NVUA 4JP5A 4ZK6A 1F0NA 1NVVR 2B94A 1I30A 1OZGA 3BE8A 3B1JA 4OKSA 4DLVA 3T3NA 4N41A 4JEMA 4BUJA 2FQYA 2ZU0C 4JNKA 1EP9A 1V9LA 2FPMA 3G23A 1YKGA 1C2TA 2OESA 2BFDA 4B3BA 4E46A 3FMVA 1IVYA 5E1BA 2OEPA 2P9EA 4WA7A 3K35A 3RYHA 1BX3A 4JJ8A 3O94A 2DKOA 2G80A 3VZCA 3TZKA 4DQVA 2QD2A 3KJFA 1QE5A 3ESRA 3W90A 4AU1A 1EM8B 4MW9A 4C03A 4J6EA 1Y0BA 2ZKIA 1B2LA 2CE7A 3OI7A 1XOIA 1QRSA 2IYOA 4PSDA 1U4SA 5FOWA 1JG7A 3MK31 1QGDA 4B4WA 5I47A 1EK0A 2Q46A 1NUSA 2R85A 1Y9JA 4DR1B 3EXHC 5DRTA 3SVLA 1E5QA 1NFRA 2MINA 4NU0A 1KZ7B 2UYOA 3QA9A 2HPVA 2WOJA 3BL5A 4L5JA 1V6SA 3O03A 4HDNB 5DM2A 4INPA 2IOQA 1OYVA 3WK5A 4LYEA 4ZYWA 3ZHQA 5AUQA 1NF9A 3SC2B 4A8JB 4J03A 4WXRA 1DGQA 5TQ0B 1TC1A 3KETA 4EJSA 4NG5A 1N2CA 5LZ4A 1XU7A 1TAHA 5G1PA 1W0JD 3UGTA 1G41A 2A1TR 4WBSA 3PNKA 4FZJA 4J1NA 1QDNA 1U0OC 4D81A 1GRRA 1NMQA 1E62A 4E88A 3HWWA 4DCGA 3VQTA 2XVYA 2LBPA 4MVCA 3OEED 3F1LA 3IJPA 1GZVA 1Z2DA 4PVDA 3LFTA 1YONA 4NAVA 4MPDA 4H7FA 4RGQA 2CT8A 1K2VN 3K30A 1YQDA 4R9UC 5FA5A 3TDMA 4JI3B 1IEXA 1L9XA 1QJ4A 1YHNA 2FQXA 2C95A 2PMFA 3D6NB 3NHZA 3DTVA 5F1YA 5LA6F 3IPXA 4BO3A 4GMFA 4L22A 1JLHA 4FS3A 1PVOA 1O6ZA 2TMGA 2GT1A 2HHAA 2RBGA 1WSDA 3GCWA 5AJTA 3IILA 1SOAA 2AFHB 1FY2A 2E18A 2X4LA 5KTOA 4TN5A 2NZ8A 3UGJA 1TYCA 3G1WA 2X2OA 1XROA 2YVAA 2YWGA 3A1FA 3I2JA 4W9RA 4NH0A 4TLBA 1MZPA 2PGXA 4RY8A 5IBRA 2VTBB 2EJVA 1FEZA 3R24A 3X2EA 5KQRA 3MCUA 5JNWA 5IW8A 5LOVF 1ENPA 1YVUA 2JFVA 1CJTC 2WFAA 4XM0A 2JLVA 1K7YA 2G71A 4HAYA 4RA6B 2PFGA 1HXHA 1PWYE 4UBNA 3RC2A 5BQ3A 1WW2A 2MMCA 2PUWA 3Q3HA 1S89A 2Q1DX 3IAM1 1UFRA 2FZVA 2WZCA 4ZWNA 3IEXA 2GEJA 1L4BA 1A76A 1BCRB 1YULA 2CLCX 3LCJA 4J7AA 4MCAA 2R8XA 4PYJA 4YJGB 3WTBA 3NEYA 3L7KA 4J2TA 1SXJA 1Z47A 2B7BA 1JSCA 1RI5A 3CPJB 1EUQA 3QEMB 4EELA 3CBQA 4EG1A 4KCGA 1XU4A 5HEKA 3WNBA 3EZGA 1WNTA 4HI0E 2BI8A 1V7QA 4JC8A 5TPWA 1L4GA 1CF4A 1IU9A 2Z56A 1HR0B 3DV0B 2GK6A 5EI5A 4EHFA 2XWQA 2I78A 5CH5A 1YMVA 4IXDA 2A58A 1K6IA 3SZGA 3TI9A 2R68A 3FKSA 3NDPA 4LDQA 1KE1A 3ZNOA 4CN9A 2UYYA 5JDIA 3UUFA 2FR8A 4KAJA 4EFLA 1SKQA 5DHFA 5C5IA 2OGTA 4MQ5A 3A1CA 4E70A 3FM9A 5EP4A 1SEVA 3GDFA 2IYSA 4P84A 4EABA 5C7OO 5JS6A 4KWEA 1XF1A 4I3HA 4R2MA 4ZKDA 3OCUA 1FMFA 3FW1A 5EYPB 3FMOB 1G3MA 5JEDA 3PS9A 3MGAA 1L7XA 4M1ZA 2HBZA 1RKVA 2JAOA 1Q0LA 3ICOA 4PZZA 4X1YA 5IBCA 3U39A 2PKCA 1Q1ZA 2A9VA 3O8RA 1B76A 2H92A 1CY1A 3O1HB 5JD6A 4R9NA 5K9ZA 3VSCA 2YDYA 4N5MA 1NURA 5KJEA 1BDHA 3Q2OA 3MIZA 3CJQA 3SNKA 4ZTUB 3U7RA 5E6UB 3W4JA 3MBKA 3ZG6A 1HSOA 2Y6UA 1F38A 1IWPB 3SBXA 4B84A 2V7UA 2VBCA 4A82A 1GQSA 1P4SA 1OF1A 2JIDA 1IEQA 3CUSA 4HQRA 4MQMA 4ROTA 5B1DA 2GJKA 4GZLA 1NVWQ 1E8NA 2P27A 3CRRA 4OQLA 2Q1SA 3IR7A 4XWKA 1QGZA 5INTA 3TBFA 1P1BA 3H65A 1KVUA 2Q1CX 1UBKS 1CZHA 3JVEA 4RLSA 2ZSJA 1MAVA 3DBOB 5IC5A 5JS2A 4EHIA 1JDJA 2DFTA 1YBVA 2GVDC 5IHPA 3LYUA 2ZJ0A 4LN1A 3QE2A 3ILYA 4DKXA 3KDAA 4OP3A 1T43A 4KOEC 1DC3A 2XNDA 3LT2A 1I5RA 4TGLA 5HQTA 1MG5A 3K9GA 3JQAB 1S2DA 3R0IA 4N48A 1NJ5A 1RNLA 3GIDA 5B7QA 1JAYA 5A6SB 4NATA 3MG9A 3HPQA 4YJGA 1ZM2A 1O2DA 1HLDA 2C4MA 1X7YB 2GPBA 5L45A 1N5DA 1SXHA 2V59A 2YICA 3L02A 3MGBA 4YV0A 4WBXC 3HYNA 4OLHA 3TDKA 4RD2A 1S3GA 3OJ0A 1G21E 3Q87B 1U6IA 4XDYA 4B83A 3UFXB 3RANA 5ANRB 4DC1A 2GWHA 1MEEA 4RUKA 4A9AA 1P1KA 5KVCA 2VSQA 1JILA 3DZFA 2CFIA 1KY2A 3CX3A 3EXFA 1A9TA 3Q9NA 1PJRA 2ZIEA 2ZUSA 4JITA 4HDCA 4L9WA 3ER8A 5KYGA 3EGDB 3R6WA 2YTZA 5ERYA 1PT7A 2G6BA 5LB4A 2HJGA 1I1HA 4KQFA 1RHRA 3QMVA 1XC7A 4QYTA 4EPRA 3D4NA 2QD4A 1CKEA 2GBCA 3ONNA 3R9XA 4LNUB 4NDZA 3D6TB 2FXVA 2PVSA 3ES9A 3HZOA 4WY5A 4HDSA 4Y1EA 1RLUA 3U61B 4D5GA 4PX2A 1KK2A 5FEMA 1J2JA 1UBEA 2HDWA 4C89A 5K8LA 4RV0A 3AXTA 3FZQA 3A2NA 1R4AA 4LRUA 2IDMA 1KFCB 2IEDA 4PU0A 1W2HA 2XLBA 2JCVA 2ZCJA 1OY1A 1Y4DE 2BDTA 3QELB 4X8OA 2X0KA 2PXAA 3NRJA 4IJKA 4QYIB 3TW8A 4B2PA 4F4UA 1TIPA 4LWZA 3QYAA 3LRPA 1Q21A 1B0AA 3C3EA 5HW0A 1ZSVA 5M34A 4K40A 4XM2A 3FCSB 1NP3A 2P35A 2WD9A 4NFHA 4BNGA 3I64A 2HKIA 2HNBA 4UHEA 4B74A 3D4IA 3DHNA 4B4OA 1YI1A 3ZCTA 3FAZA 3X1KA 1ODKA 1RYHA 4V1CB 3EZ2A 2A9OA 4JK3A 4HDQB 2QLBA 1PUXA 1ZS9A 1XZGA 3MRVA 3QEMA 4FFWA 4L0MA 1NL3A 1ZNWA 2FVYA 3LIPA 1E79A 1QFJA 1F5NA 1VSBA 2C88A 3FOAA 3M89A 3SGLA 1T4GA 2YWXA 1B4DA 3EVBA 1N6RA 2JZNA 3KO8A 3LTEA 4AUKA 4ED9A 1NA5A 1A5ZA 4MS4A 4BS9A 1OFHA 2BC9A 3U7HB 1JDZA 1Y6RA 1JH8A 2IPMA 5JRDS 4OXNA 4H3KB 3GJYA 1PJTA 3DO6A 5EJ7A 3KQKA 3QY0A 3WK8A 3GLGE 1P8JA 3STWA 4UBJA 3H5OA 3HVKA 2FQQA 2ZIFA 2HFKA 2QQEA 2YRXA 4CEIA 2GXSA 3DOHA 3MMXA 4N1AA 2J3JA 1JA0A 3U7GA 3K70B 2A78A 5IFKA 3QKSA 2H1OA 2Q1AX 2GRUA 1NV9A 4W8GA 3ZLUA 3U60B 1L5HA 1MGOA 3IUSA 2VZLA 1XHFA 2RAUA 3AZPA 2OAP1 4TLDA 4E22A 1S8OA 4EG4A 4OREX 4EVIA 1NJFA 3JRNA 4D8XA 2VHVA 1GT91 4DA6A 2NQ2C 3W6ZA 3EXEA 4J1QA 5BN3A 4L4RA 3P9KA 3X3HA 2CXNA 3MTEA 3Q7EA 2W6ZA 1ZK3A 4YXWA 4L4ZA 2C9DA 2OORC 5JSYA 1TMOA 1XK7A 1UC8A 2JCXA 3IO3A 3BG5A 1Y9DA 3NHFA 2PWBA 4OK5A 2O8VA 3DJFA 3SSNA 3OFKA 3QTBA 4TROA 3MCAA 1R8SA 3HDHA 3ST7A 1VKZA 4REQB 2GXQA 4IJ5A 5G0WA 1PU2A 4FJ0A 1JFFB 1GJRA 2QN8A 1T0BA 4NJEB 4EYEA 1RC1A 1S4MA 1Q1NA 1FX1A 3RS8A 2QL9A 4FDLA 5K0FA 4KR2A 3DBLA 2HTEA 4IFIA 4A2WA 3R7BA 1ZIOA 5DM60 4N76A 5G2OA 3L9WA 4QYIA 3R7LA 3LRTA 3DDOA 1QRRA 4P2BA 4AMUA 2E87A 3KHTA 1I2ZA 3OOSA 3OEYA 4WTOA 1S7CA 1XX6A 1NUQA 1T0HB 4KQWA 2R3SA 1Z7GA 3HHPA 3R09A 1LSJA 4KR3A 2XRMA 2V3VA 2ONYA 3EZ9A 4OGLA 1YE5A 2NV0A 1I7NA 3GVCA 2ZIXA 1UKVY 3R2JA 3SF8A 3TGLA 1UMCA 2F62A 1MX9A 3AF0A 3AIMA 3HRIA 3JYOA 4FDVA 4M55A 1PJAA 2P30A 5EIHA 1YR3A 4TKUB 5CFQA 3FHTA 1LPOA 4U9IS 1FS5A 5KYKA 2QT0A 4M7OA 4UNPA 2LKDA 4TQGA 1J8FA 5HJEA 1FNNA 1NZFA 1E0DA 4I4NA 4GFDA 5LM3A 3A04A 1KAGA 3PDCA 3ZOKA 3LUPA 1THTA 3E5NA 1C8KA 4I46A 4PE5B 2BM1A 1C1XB 1UF9A 4ZQIA 2AC7A 4R1TA 4WUVA 2PX3A 5F2NA 3IQXA 3UHPA 3MHPA 1UPTA 5EXPA 3M5DA 1XPRA 3JR7A 3L0IB 2PRIA 4AWXA 4JCOA 5H4HA 2J9YB 4YBZA 2O8NA 3L43A 5KKCA 3N2GA 4GWLA 3MA0A 4H15A 1V3QE 3RKUA 1LJ8A 5KYXB 2XZOA 5EZ6B 2EFDB 1M66A 4O2BB 5B4TA 3QUSA 4OHPA 2A7QA 2GVZC 2VDMB 3G2NA 4M86A 5J59A 2ODEA 3ZV5A 2SKEA 5K4AA 5ALEA 3KBBA 1R0BA 5ALPA 4ARBA 4NFSA 2WILA 2O5RA 1RVDA 5H1YA 5B2FA 2UUAB 2XXAA 1JL3A 3DPSA 3Q7PA 2IV7A 3BSFA 3TLKA 1BXRB 3STYA 5JH7A 1P0MA 1DCKA 2EGUA 2HL6A 3MELA 5EMNA 3TSWA 1APBA 5EGSA 4QTYA 3LCCA 4WK4B 5DEIA 4KGDA 2ECPA 4G8BA 4JYMA 1AF7A 1D4AA 2FK8A 2XCOA 5IVIA 4V39A 2Y71A 3EH1A 4FN4A 3K9FC 5H81A 1W36C 1KXJA 3RG8A 2IXAA 3MFQA 4WZBA 2NYAA 1VA4A 4L5YA 5HUJA 2V7EA 5A2GA 4D57A 4ER5A 2BBTA 3ORSA 1KYWA 2ZXEA 2B78A 3DGFC 1DOZA 1XO1A 1XFDA 1E9SA 4HSEA 5FFNA 3SR3A 3WS7A 3U7FB 2GPWA 3P26A 4YK7A 1DC5A 4PGHA 3QQ8A 5FA8A 1JAIA 4M9QA 4YAOA 4BASA 3GLGB 3ZY6A 1OX4A 1BVHA 4Q9DA 3QNMA 1CQZA 3T34A 4FOLA 1XYGA 2YASA 2A1UA 4GLJA 4LF6B 1E2QA 1W9MA 4NR0A 4Y6SA 4BVAA 3H04A 1FTSA 4M87A 3U3ZA 1EE2A 3N0WA 4YREA 3CEHA 1DBVO 1HV8A 3DS8A 1M7GA 1Q0UA 3OETA 3D7SA 4RHTA 2JGRA 3CNHA 3ZVNA 1YJBA 3ENWA 1E1RD 1E3DA 1ADBA 2Q6LA 4LE2A 1EEHA 4OL0A 3EDRA 5HBRA 2QDKA 4RJ2A 5JTUA 3L3BA 2GTHA 3FKQA 1Z75A 4C7KA 2R6CA 3LGSA 4MUYA 1G8FA 1IC6A 1KJQA 1MO5A 1C8BA 4UUNA 1KEVA 1UM8A 1W30A 3BBPA 4D3YA 4R1MA 2IXBA 3WWDA 1H3FA 2C9YA 4W5HA 4KWCA 5BMOA 4L2IB 4ARUA 1ILWA 1S2LA 3A8TA 1JHAA 3IESA 1E1CB 2WFZA 4J0KA 3NO4A 4D45A 5GONF 3EXHA 4IS3A 2ZR9A 1YC5A 1ZLXA 1EX9A 2FWJA 1ZICA 2GAOA 1ZWKA 3N76A 3IUPA 5H02A 4NBWA 2RHMA 3LECA 2Q7OE 3KQYA 4A2PA 2OXFA 5EOVA 5K45A 3IAEA 1G5IA 4B31A 5F4BA 5K8CA 2KY9A 3R4CA 1Z6QA 4II3A 3KZVA 5K3BA 4IYJA 3VR6D 2HCTA 2B4KA 1NULA 4IJMA 1JIJA 1SUWA 2HD4A 2I87A 4RPCA 1G19A 3TTVA 4M0PA 2EATA 3EFOA 3WBJA 3FYUC 3WL8A 4ETNA 4BKRA 4MDYA 2IOFA 1U9CA 4KDCA 4YRTA 1M3SA 3QVTA 3VPSA 4B3XA 1OBCA 1S2GA 3CVJA 3KXDA 1T4BA 4WZZA 2R1ZA 1MA0A 3C3BA 1P1CA 3G5AA 4AWBA 1TPZA 1Z6AA 1H4VB 2WJPA 3LT5A 3MVEA 4GG1A 4LZAA 4UAJA 3KP1A 1EIWA 1EEXB 5JARA 2C5GA 1GO2A 1CCWA 1KZ9A 2J87A 1U7HA 2J3HA 4FP9A 5DHQA 2PZBA 3V4RA 4DRZA 4XPIB 3KZOA 5A71A 3GAMA 3HP7A 2DFVA 2GFHA 1XKQA 1OPRA 2CMKA 2HRQA 3HUUA 3H1AA 3UV6A 2C58A 5IT4A 1GCOA 1HNNA 3MT7A 4RCYA 1ZJZA 3G7NA 4GMHA 4QXRA 3ZVRA 2NUTB 1C1XA 4K9SA 4F93B 4UFNA 4LE0A 5IJ9A 3WKCA 4B0PA 1OASA 3LO8A 1WBJB 3JZAA 2HC9A 3O2SB 4CVNA 4DT1A 2APJA 1YOVA 2I29A 2AXNA 5JE8A 2KJQA 4MYCA 4DPKA 4BQOA 3K20A 4RZUA 1JR3D 3B5EA 1N33B 3B5JA 5HZGA 1XTKA 3GPIA 5KHOC 2Y0EA 2Y1LA 3A2LA 3SDSA 1UZLA 2PGJA 5AW5A 4ZO4A 2ZBUA 4AC9A 4MINA 1IXZA 2JJYA 1Z0KA 3EZ7A 4RZQA 1CUWA 3DTYA 3DUWA 1PFVA 2QTVB 3NHSA 3V6MA 2DQZA 2AGVA 2BIFA 4GLBA 1YD7A 3GUUA 3H8WA 3LUBA 4K6HA 2BKLA 4AQDA 4M1QA 1AHNA 1TVMA 5I7OA 2ZI5A 2ZT5A 3ROXA 4BLRA 4Z5XA 1K6JA 4D74A 4KE8A 3OCWA 2I1WA 1NPDA 4WZAE 4YWHA 3RU3A 1K8RA 1O4VA 2WNIA 2QM3A 3EDMA 1DKLA 3EXHB 3RF6A 1Y82A 5GJBA 4ID3A 2PUAA 4NJOA 4WDQA 4N5LA 1Y1QA 4XWTA 3TW0A 1US8A 3D6JA 4C6SA 4D9IA 4LGYA 3K9WA 1FYDA 2WFMA 1JKIA 4B45A 1UJ2A 1PS8A 4IMRA 5I9BA 2H18A 4ENUA 4YACA 3EBOA 1B2RA 5ALUA 2BGWA 1CJBA 4H3SA 2PU7A 3A1EA 3KJNA 4IVNA 3VX3A 3IAS1 4IWYA 5BV2P 1CR5A 2B4RO 5KSPA 3ZYZA 5HMLA 3V1UA 1DARA 3DP9A 5D87A 2P3OA 3UXHA 5TVKA 2GF0A 2OM2A 1DUVG 1U3DA 3SXJA 5BRAA 4ETMA 1DEKA 5ERGB 3RUDA 1DLIA 3WGVA 1N6LA 4BRUA 1YJ8A 1H2RS 2CK3D 3L7BA 2H0AA 3IQEA 2RK4A 1JQDA 2EF1A 2GPNA 1RAIA 3FTCA 5CH3A 2FFAA 1P62B 3PYXA 4O2AF 1TF7A 4LKRA 2VJMA 4KQ1A 2N3ZA 4I4TB 2RH5A 3GC6A 3A9CA 4F2DA 4IV5A 5C8YA 3ZS9A 4PYLA 5DNCA 3QLUA 1KY3A 1S8FA 1T8PA 2CHUA 2CUZA 3D0QA 2ROQA 2P6MA 5TDHA 5FDFA 2HBQA 4ES6A 1IOWA 1R6AA 1XAGA 4OHBA 2G40A 1F6WA 1M2GA 1MXFA 4JLBA 1SVKA 1HE8B 1R15A 3G9UA 2JIMA 2EFJA 4JENA 4TQAA 3NBXX 3CLRC 3TZLA 1DU4A 5JO0A 3MILA 1XRLA 3E4CA 3H5LA 3HGQA 3PHJA 4JB3A 4KRYA 3A1TA 4S1TA 5TIIA 1TECE 2B6HA 1QR6A 2VJOA 2FW0A 5DTQA 1Z2OX 3PU6A 2FW7A 1ZMBA 2B36A 1Z3IX 3II6X 4P3PA 5DBFA 3ND6A 5BR8B 3R5XA 3WGJA 3ANLA 3LDUA 2K7FA 1P29A 1O5TA 1XPJA 2PHZA 4RF3A 5C7LO 1FIUA 3G2KA 4Q6BA 1Z7YA 4OHKA 2VSFA 1XFAA 1G2QA 5EJGA 2W0SA 3RSOA 2Y77A 5HNKA 3K0SA 2AS0A 3THXB 3I4FA 4DNPA 3OQJA 1A7KA 3O8OB 5DXFA 4LOHA 4YAWA 2H85A 3HEBA 2FMFA 4YQZA 3AVVA 1QLWA 1RQPA 1S2OA 1EHYA 3FYHA 3BYZA 4NH4A 5FJJA 3AW8A 1DFHA 3L82B 3EFBA 4ZQHA 3GJ4A 4GI7A 1NU6A 3V7YA 5DASA 1RC8A 1JEAA 1RRVA 3JYNA 5E2BA 5CPFA 1PHPA 2WKPA 5KMGA 3ADKA 4Y2SA 4P33A 2D4HA 3LBYA 1JH9A 2F67A 4MW4A 4HNSA 1WULS 4YWJA 3I5AA 3TTWA 3BSSA 3WRYC 3DWFA 1QS0A 3OO1A 1EH5A 1XEAA 4QUDA 4JKYA 3VKVA 1I1OA 1QIKA 3GLUA 4U7JA 4ZODA 2CYCA 2GXAA 5J4LA 3FSJX 2VLBA 1WCV1 1YC2A 2IVZA 3FPFA 5G4KA 2PKXA 1RTTA 2EKQA 2IU3A 3PHBE 1VHLA 1KMMA 4M21A 1DAHA 1IUNA 3EGDA 3HBNA 4O4IB 3TD6A 4ACAA 1ZD4A 5BXQC 1SC3A 1SUDA 1XWFA 3DZJA 1ZA2A 4E33A 1AKNA 1CUYA 3IEIA 4LJ8A 1JLLB 1ZNXA 1SUSA 1T3HA 1A8QA 1N0UA 3R3VA 2PJHB 4GYYA 5E7QA 5JCOC 1EUDB 3ZU6A 4TZ6A 2QYHA 3DE6X 3FWYA 5ED0A 4CM8A 5AIBA 3V9AA 4AL4A 3GGSA 1RM0A 1BMTA 2AR7A 2FWNA 3R5KA 4MCJA 4UEQA 1YZLA 5CW2A 3UK7A 4UXHA 2Z1MA 4XQGA 4UM7A 3CZ4A 1JR3A 5EXXA 5JY1A 1BW9B 4FSHA 3WYFA 3ZE2B 4EJ0A 3NWOA 3WWOA 3QVXA 2NXJA 1XQWA 3CH5A 3QFHA 1G66A 2YDXA 4O29A 3R7WA 3VR2D 4BZWA 4V0SA 2X1HA 1F0PA 1Y3CE 4B6OA 5FR2A 1HYGA 3QWFA 4BFSA 2R1TA 1GL3A 3IO5A 3L4SO 3V2HA 2ZAIA 5IKMA 1R6TA 2VK1A 3CR7A 1N2CB 4XSHA 1FJHA 3DAHA 2ZSBA 2EWMA 2VL7A 4DBZA 3CBGA 4MQFB 2BEWA 2ZYIA 4NULA 1FP7A 2CHGA 2C29D 4RLQA 3KYJB 5HTKA 3EWAA 3RSHA 1OI4A 2WINI 4FYWA 4ZPJA 4P0PB 8ADHA 2C3UA 1RWPA 1G59A 2F1HA 2TYSB 1A4RA 2VTEA 4CDGA 1JMKC 2CN1A 1KMHB 3BULA 1IZZA 2HRZA 1WP4A 4GHWA 4BNNA 4URVR 2OZKA 1F6DA 1BH6A 3CLKA 3H5IA 4PHCA 3GRFA 1PT9A 5BURA 4INJA 4XW2A 2OKCA 1SBHA 1QO7A 5L4SA 1LK0A 1R1DA 3DBHA 1RAFA 3GGDA 3PI6A 3PUJA 4L5AA 2FSVA 4XASA 4EW6A 5FBVB 4DV6B 2R48A 3N2EA 1BFUA 4U7WA 1CRZA 1TT7A 3PJEA 4FDAA 4CL3A 3TG2A 3CVOA 1XDSA 4MI3A 2D5CA 1YXMA 1WDKA 2BW0A 3ETCA 4L0QA 2CLMB 4MI1A 1ETHA 3KR9A 4TTQA 4X3PA 3EZLA 5DBGA 4ZYUA 1U3TA 1WV1A 2XAAA 1SCBA 4H17A 5KJFA 4CLOB 1A2KC 1Y9ZA 4LJ7A 4K6OA 3PUIA 1RYFA 4CKZA 3BIFA 1FDWA 2AH5A 4G6ZA 5A04A 1YFJA 1E2NA 2E7ZA 1H23A 3EXEB 5DGCA 4J0IA 2VAWA 3C48A 2R86A 3AC0A 5A05A 1MO4A 3I4LA 1GSAA 4G4SP 3V1KA 4FHZA 4PLTA 1TB4A 5DHSA 1Z16A 3K94A 2DHDA 4Y2UA 1Y8CA 4RIIA 3K70C 1C1HA 2OK8A 3H9BA 4QXQA 4X45A 3D2CA 5AK5A 4M2LA 5EIXA 3WLFA 1YIOA 5TPWB 3ZU2A 1NW9B 3G82C 2O0JA 2H1HA 4QASA 5CX1B 3I0MA 3K1AA 1X39A 1SKYE 2GCNA 4OB8A 4U2BA 3SC3A 5LWHA 1AMOA 3HXOA 2PTHA 2VHJA 3PLNA 1CV2A 1P5RA 2ZQYA 2QZJA 3E9DA 3I9V1 4QLAA 2G67A 5DGIA 5BR4A 2FEMA 3HB9A 1CDZA 3H1GA 1ZK4A 2PCLA 2WI8A 1GKLA 4IXNA 3B1YA 4FWIB 1TO2E 4YCBA 3OWXA 4LI0A 1U9JA 4TPKA 3V2UA 8LDHA 4ZI7B 3ETNA 3ESXA 4OGFA 1XJ5A 1SIOA 4V3BA 4MUKA 1LTQA 2G04A 1YKSA 2JFGA 2Y4OA 2ZJ2A 4WX2B 2O59A 4ZGBA 3C8DA 4IRUB 1Y8QA 3TQSA 3H2JA 3SHOA 4XOUA 3QLVC 1RXYA 1J5XA 4MAMA 5HZMA 4PIPA 1O94D 1VKHA 1UEIA 2Z6UA 4C1NA 1PR9A 5JJBA 2NSLA 4MVJM 2JAHA 3PDHA 4Q12A 4B1FA 8OHMA 2BDUA 3L7OA 4N3NA 4WVLA 4JQYA 1F3LA 3QENA 4FGLA 4EIWA 2Q49A 1X1QA 2CHQA 4ML3A 5DTRA 3G2OA 1FA9A 1P72A 3IT0A 5D85A 2ZZNA 2FN8A 4HRAA 5B1SA 2JLCA 4OH1A 3KFLA 5DKFA 5JZBA 2D2EA 3D6HA 4CKXA 3GG9A 2Z5FA 1NJ1A 4KRXA 1XMIA 2XE6A 3TRHA 1TIBA 2BFWA 3WRYA 1D8TA 1MC4A 3BRQA 2IUYA 3PL1A 4AJOA 4UE6A 3RGGA 1KI7A 2O3JA 4QJ3A 3T7KA 1KDTA 2ORED 3H4IA 2WWVD 7YASA 1PQPA 1TZ2A 4EK9A 2X1LA 5A7FA 3A9TA 1VC2A 4KVFA 1CUBA 2JGFA 2WVAA 3PXAA 2CXHA 4FSDA 4JU9A 4DLBA 2OHOA 3R9XB 4XGRA 2ZTVA 5E6SB 4FFRA 4QSHA 1WBBA 3ELYA 2QI9C 4CDMA 3T12A 1N0WA 3FVQA 1M2HA 1JG3A 2VJAA 4IO1A 3ZDDA 5BVGA 2YFQA 3O26A 3FOFC 2QN3A 1I14A 2CMHA 1P5FA 1L0BA 1USGA 3LNCA 4QGFA 3CSDA 4ZV9A 1R8YA 2ISCA 4HK4A 4EDFA 4TYMA 4TLEA 2F9MA 1KJZA 1ZH0A 3I52A 3CCFA 4UMVA 3ZNPA 5BR7A 3WQQA 2WE8A 1FYVA 1K0UA 3D7LA 3K8OE 4QLOA 4ALJA 5CDFE 2VJQA 4MHSA 3U44A 2QUZA 4WN9A 2VQSA 4NXNB 3IMGA 3NAGA 3IEPA 2F1RA 4WI1A 5DIFA 2X7JA 3SS8A 2ZRQA 2IDZA 2H7YA 2FR8C 1PT8A 4F72A 1OLOA 2W6IA 1K7XB 4W9NC 2VT7A 3IQWA 2CLEB 4JYBA 4P0TA 3SYKA 2FW8A 1FQOA 4LDJA 1FTQA 2JEYA 5ES4B 4NZPA 1WV0A 2JHFA 3OOHA 4Z54A 1X6VA 3N87A 1I4LD 2BZGA 3U5TA 3BFVA 2C04A 3WRXC 2NTEA 4B7UA 1OT3A 1NXQA 3C4QA 3L0BA 2OSVA 3A2KA 4HQKA 1J56A 1KMHA 3QVLA 5BSMA 5I01A 4MGKR 5KYYB 2QMOA 4UUPA 1JECA 1O97D 2EEPA 3G68A 2PXHA 2X23A 5JU6A 1ZM9A 4RANA 4YV7A 1IYZA 3W5SA 5A6VA 3WLQA 4UTVA 4FFNA 2PVPA 3Q85A 4PQGA 5CBKA 1ZD3A 2VT2A 2QRHA 4EUHA 5FO1A 2ORWA 3L8DA 4CLXA 2CDBA 1RZRD 8ABPA 2I7DA 3B1ZA 2FFQA 2PO7A 1PBTA 2WG0A 4U3JA 3R9WA 4RHFA 2AVDA 3DYBA 4NMXB 1G17A 4EA7A 2G6TA 1IDOA 4QPNA 4NL4H 3HBMA 4XEUA 2G70A 3FHCB 3QBDA 1OC4A 3RFXA 1NYLA 2B5OA 2H59A 2CF6A 2H4YA 4D8TA 4EENA 4HV4A 2XUJA 1XB2A 2JGKA 1QGOA 1P7ZA 2A84A 1EZ4A 1MC1A 4RNCA 3WJAA 3MAGA 1L7VC 3DAPA 3LZDA 3B6IA 4MRPA 1HMPA 5DTIA 2PIDA 2IS4A 2ID8A 3CEPB 1Q14A 1RKXA 2BFAA 1KYXA 3PGXA 4L4UA 5JCJA 1H0HA 2V7XA 2Z43A 3EXG2 3NIFB 5KC8A 1J2YA 4X7RA 3VC2A 4XD7A 2GO1A 3K1YA 3KQQA 2R00C 1PAUA 2ILTA 1EUDA 2AWNA 3INNA 5LLSA 3TZBA 2X7HA 4I55B 3RYCB 4BNVA 1SRQA 3IPYA 3I28A 4EHLA 3IUNA 2P91A 1KQ3A 3HB1A 4UATA 2B1QA 3N2KB 3SZLA 4YUXA 4CDNA 2YWRA 1RPZA 5EXTA 4FEEA 1Y37A 5ESRA 4R83A 1IHDA 4OLAA 4MUNA 4CR7A 2ZYVX 2XNDD 1T9BA 5BOVA 5BW5A 4XA8A 3MUOA 2J0UA 1L7OA 1K88A 1W5TA 1GZUA 2QVGA 1U0BB 1EFCA 3CZ9A 3ZWMA 2IPLA 1G3QA 4Q39A 3BFKA 2ZUCA 2V9ZA 5LIRA 3GEEA 5HTOA 4DR7B 4ENRA 1WETA 3KSZO 4IXWA 5DNAA 1RYYA 1T1JA 3ET5A 3LLSA 1Y63A 1DG9A 4M60A 4JOSA 3TLCA 1KBQA 2FTKE 1IM5A 1J97A 3GRKA 2EJUA 4X1YB 2I1VB 5L51A 5HCIA 3WZMA 2FEAA 3K4HA 3D0OA 4IHAA 4OV6B 3RUPA 3BAZA 3L1HA 2P41A 4OXYA 4E6PA 5LKRA 1K97A 1WW3A 5KYTA 2IS1A 3ASYA 3A1DA 3GNTA 4WY2A 3AKZA 1DAKA 1SHKA 3DDZX 3FOEC 1QHSA 3ZZTA 4NJEA 1H0SA 2XSZA 3M1IA 2A5YB 2JDID 4AY3A 4REQA 4N8SA 1SXPA 1RCFA 1L3BA 1IOZA 1WUYA 3SLGA 1WU7A 4ZCMA 1HTWA 1HEIA 1GFZA 4F5YA 1TM5E 4U6NA 2FMXA 1T9HA 2IYLD 3QVOA 1P7PA 3GFQA 2HRDA 4Q4HB 3V1YA 3NVMB 1GR0A 2NSHA 2VHUA 5LPNA 3CZMA 2W48A 1EJ6A 4EO4A 3NDJA 5ENDA 2W6MA 4JVOA 1YBMA 4QDKA 3TCKA 3LDFA 1FVHA 1P91A 1YO6A 4OGGA 4W82A 4BBZA 1JSXA 3M33A 4A3SA 3L7CA 3M4NA 5I8WA 1VL1A 2YXBA 1X1CA 1E4OA 2QR5A 5JJ5A 1E2DA 1UWCA 3PD7A 1JHZA 1B8PA 3SDZA 3WG9A 4BJ1A 1L1EA 3K71B 1E5DA 5KTNA 1L5QA 1RYZA 3ZD8A 5J63A 1HDYA 2J3MA 5JG7A 2AMYA 1OWOA 2O1SA 4P80A 1BGWA 1DPFA 1TRKA 3CKKA 3E22A 3OPQA 4DG5A 1CRPA 4BYMA 5J5VA 1C3OA 4FS8A 4TTRA 4LJSA 4DSTA 1JSLA 4MVXA 1J7JA 1UBMS 1YZHA 3F6RA 2C5SA 3ZCXA 3CPHA 1GRQA 2YZKA 3KAKA 2F8TA 1G8GA 4KITB 2OCAA 3EXAA 3KL2A 2ZYAA 3ZY4A 4EP1A 3HN7A 3DBRB 3SQMA 1ZJJA 2LE0A 3BK2A 3LYHA 3T1YB 2VBFA 4WK6A 2GLTA 2GK3A 3D3WB 3L40A 4RULA 2QVXX 4JAVC 5EL0A 3MM4A 3MQ2A 1SGWA 1E98A 1GPUA 1W9HA 2PIAA 2I8CA 3CIFA 2BEUB 3CE6A 2QTRA 3K5IA 5BPFA 2YXPX 4CMGA 1EGVB 3V42A 1OB2A 3EQZA 1WZCA 3TIGA 3MHTA 3PX7A 3WKEA 3EIQA 3I6MA 3PFFA 3UK6A 1YE8A 1A4IA 3ND5A 3KSDO 2FUKA 3B6JA 1UKBA 2C54A 4YAFA 3WYAA 3FG9A 5HF6A 1U9ZA 3KTOA 4V0MA 2BFFA 3O0TA 1DRVA 2Q6OA 3EVEA 1BVRA 3VYSB 5KQPA 2C4UA 5KTRA 3O3MB 4M1YA 4BVEA 1P1FA 1SRRA 1V4VA 2JB9A 2WW8A 1GA1A 1U7OA 4L3WA 4OXRA 4Z7OB 5C80A 1VMIA 3HU5A 1VCOA 2W0MA 5AW1A 4M8IA 3KJGA 2ID9A 3N6XA 4MV1A 4EG8A 1X3LA 4BP8A 4GEKA 4JI1B 2QMUA 4CKYA 4OIMA 5K20A 1NYRA 3ANYB 1RJ9B 2NUPA 3S2EA 1Y9EA 1Y6QA 3F6CA 4YASA 2DH6A 3RTDA 3ZU4A 2Q6VA 4RV4A 5SY6A 4LF8B 3FGZA 3I5YA 3NGXA 4RM3A 4LYHA 2VAPA 2FMKA 1U3WA 1PSZA 2I3DA 4P92A 4ZEMA 2XT0A 4K9RA 2QL7A 3STUA 1VDMA 1E6LA 3CW8X 4IDHA 4IHJB 4P2GA 2IKSA 2VRWA 2VRCD 4XYGA 5IVDA 1V2GA 3ZLVA 3LPCA 3O82A 5JASA 3F49S 5J47A 5K2OA 3OLCX 2YS6A 4F60A 1PVVA 1A0OA 2UU9B 1X7WB 4MAFA 1DX6A 3LZCA 2FUEA 1GNTA 5H3HA 2P7HA 1HZZA 5LSAA 1J0BA 4YPFA 1JG4A 2C1XA 2Q6TA 1PR6A 1TK2A 1VIMA 4EQ6A 3NEJA 3TOCA 1G8YA 2CV2A 1KIMA 2BL4A 2NOAA 5K0ZA 3ACDA 2FLWA 1ZRNA 3FUXA 4F9EA 1I6KA 1WZUA 3DP7A 1DQRA 3UHAA 3COYA 3ZUGA 1BHSA 1UQTA 3IOYA 1AZSC 1ZUNA 1BOOA 2Z2ZA 3ID6C 3OZBA 2ZUEA 4CKBB 4YUZA 3W06A 3B70A 1BU8A 2BBSA 3VZDA 3B1VA 1R5NA 1JAHA 1CUZA 1HT1E 1T6NA 1Z74A 2YS7A 1EWRA 2B3DA 4IMIB 4KOAA 5I7VA 1TPYA 3V4FA 2EBHX 2RGGA 1J1UA 1KQPA 2O2JA 2F17A 1GL9B 4CPDA 4YRNA 2XBMA 1P5HA 4FFSA 2DTDA 5EWMB 4H59A 2OVFA 2PTGA 1K2WA 2VXCA 1ZD5A 2CF5A 1TQ8A 3NHLA 1CT9A 5IF3A 2BBWA 4E7OA 2PLNA 1DP4A 2CL5A 3EOZA 3BRWD 4US0R 3C24A 1C2YA 2HADA 1T10A 3GF4A 3K2EA 4CMKA 1LY1A 4MYDA 2PRSA 2ORVA 1FNBA 4S3MA 1YA6A 4J7UA 1FDSA 3RSFA 4MV5A 1LLCA 2BEKA 2DPLA 3O83A 3PE3A 2FGKA 4JUCA 4KU4A 5FAKA 3NM6B 4ND2A 2E37A 2GEDA 5FIUA 1G4HA 3AHDA 4HQFA 4BO7A 4MTCA 2GN8A 3JALB 3JAWB 4GRDA 1P45A 3HY6A 1QSGA 3GUZA 3HNRA 4ZCSA 1LSOA 4LV6A 4IDCA 3WICA 3WKBA 2X4GA 4A4DA 4O2AA 1OIXA 4DDUA 3S7TA 1RI2A 1L5OA 2PQMA 9LDBA 5JT1A 5K8UA 1AKQA 3ESCA 4A10A 1WF6A 3ZKWA 2QN7A 4OJQA 4KIUA 1HF3A 1SCJA 1OGIA 1A5SB 2EJBA 2HXGA 3R0JA 1MO3A 1Y5IA 3JRWA 3PP8A 4K9KA 5EE3A 5IJZA 2C9CA 3HLKA 4YFVA 4D3ZA 3QU7A 1CNFA 2GBLA 1NBEA 2VOEA 1Q5PA 1J42A 2R2AA 1SCUB 2YJZA 1T5LA 5LP1A 3LBAA 3OPNA 4MKHA 3GLSA 1P7CA 2BF7A 2VUIB 3PUXA 5CYFA 5ULLA 4BQSA 5HCNA 4MROA 4HGOA 3ZDEA 3TPFA 4CT5A 1CC1S 2RHRA 3STTA 3JWJA 4DEYA 4B9AA 3SLRA 1WPGA 2X2PA 3VVMA 4DLUA 4IH9A 1AGYA 2QGFA 1P2DA 1VQ1A 2QHXA 2JKZA 4I4LA 2FF7A 1Y42X 2DETA 2G8NA 5CK4A 2Q6IA 1A5BB 2VWQA 1Y9AA 1G7SA 1GPAA 3DGEC 1JXQA 1SUBA 3D59A 5C1BA 1P77A 1BXRA 1QVWA 5JH7B 1WS6A 5DWQA 2JFXA 1VHTA 1QGYA 4UEKA 2NX2A 4I99A 4MUIA 4RQUA 5EHQA 4A6XA 3VJRA 4H7KA 1XT6A 2NP6A 2JGLA 4HEHA 2AOVA 4BNZA 5IEJA 2Q8PA 4GWKA 3C0KA 2A30A 3STXA 3E8SA 4GYJA 1Z4QA 1QG2A 1LU9A 1UBNA 3MJTA 4JBXA 4BTLA 1GILA 1AKTA 4CLRA 2VDPB 1KPGA 3I42A 2MSDB 1XZMA 2BR4A 2IZOA 3ZBQA 4S1OA 4EY4A 4E6EA 3AI3A 3AUKA 1Y80A 3VPFA 5HZKA 2KSQA 2JIZD 4GR4A 4H18A 5DYTA 4AZSA 3I37X 5AK6A 5MFZA 2VXOA 5I4CA 3KTFA 4X44A 2CZGA 2WKQA 1DINA 2JV2A 4FC7A 3C7KA 1PJ8A 2PX4A 3H0CA 2FZWA 3IJRA 5E0KB 5F64A 4LYGA 2PBLA 4C20A 2MOKA 3LWDA 1HOXA 1YL7A 3MCTA 1P74A 2J3QA 2WJZB 3QHAA 4EL5A 1JJ7A 4ZVTA 1GKUB 2P2SA 5CT4A 5CBPA 2VSOA 3ZQ4A 3HWRA 1ITZA 2VS1A 1W88A 2EDAA 5CDHA 1H1TA 1X14A 4UXIA 4G4IA 2P0YA 1X0VA 1J24A 1QWSA 5IKXA 3V3KA 3AVTA 4O0LA 4R3NA 5IX8A 1KHHA 2XEXA 1OXVA 2CNWD 2DC1A 2J41A 3LT4A 1DAFA 1X0XA 2II6A 4JP1A 5AO9A 5AOCA 4JLDA 1Z36A 3BZBA 1P2VA 5EVJA 1PIWA 2VRBA 2ONJA 3TW8B 2PBRA 4FN5A 4HRYA 1OW3B 1OLUA 3F8SA 1K8ZB 2D1YA 1WXIA 3D6AA 1JBEA 1Z5VA 5HXAA 1CIPA 1D04A 4C22A 4ERNA 2I6TA 3N0XA 2HA4A 1AK1A 3L4EA 1XVIA 1CUFA 1TK3A 3KPWA 3RS2A 4QPZA 1H3NA 4MQBA 1VHDA 1UEXC 4TL8A 2UUPA 5DM4A 2OMKA 2YH2A 3TNJA 4GX1A 4OI2A 1KAMA 1AHHA 5DISB 3EIFA 5HSGA 3IXMA 3ICQB 2ZRLA 2FN7A 4HZUA 4PAGA 4E5MA 1ZIDA 1VPTA 1L8AA 3CNEA 3CTMA 3MWFA 4Q3KA 3KHKA 4WKNA 1JEEA 5EP1A 4TYYA 3VR2A 3KLBA 3F97A 1NZDA 4P7KA 1NZJA 1SU8A 4GT1A 1Y7IA 1XZAA 4UUBA 5T4HA 5DGXA 1ACJA 2IYTA 4I08A 3UYKA 1I5OA 3I6YA 3USZA 4RWZA 3QE4A 4L8GA 3KJHA 4TL6A 4INAA 4RF5A 2QTFA 3I1FA 1B8OA 3NALA 3DCNA 2F1OA 3M6LA 4PSCA 5CCEA 4CM4B 5LZ9A 3Q72A 1X42A 4RKWA 1NJGA 1TC2A 4Y2XA 4BMNA 4XPIA 4BZPA 3ER9A 4XIYA 4W8OA 4POAA 4BLWA 1QGAA 3A06A 4UHFA 2BGIA 1XRNA 5BPHA 4OMCA 1AQUA 1V16B 4E07A 3DAFA 3PDWA 4GOMD 3A3KA 2A1IA 4I55F 4KXUA 4PFQA 1GKYA 1SVNA 1W94A 2WM9B 4IEIA 4CM6A 3VSBA 4ZEVA 1WSAA 4B4DA 4UQPA 3K6SA 1U28C 4QU9A 1HE3A 4KO8A 1K6XA 2OGUA 1ZY2A 2P40A 4Y6LA 1AD2A 3PC2A 4FLFA 4IIJF 2EWWA 1TO1E 2D2VA 1ST2A 1YVEI 2OCIA 2YXNA 4AJKA 1OXMA 3TKAA 3TR5A 3W3AD 3H2GA 3UFBA 2VNAA 4DIEA 5GMOA 3IL2A 3EC1A 4G1BA 4TKVB 1REQB 3E6AA 4KQ6A 5CDTA 5L7TA 1X1SA 2G0NA 3RGWS 4F3TA 1GDDA 2WVGA 4G01B 4RVOA 3RIXA 3RK4A 5FWNA 1TGVA 3EFHA 1ESZA 3IHWA 4I1YA 4CMBA 5FP0A 5TMBA 1FSGA 4AJLA 4BB6A 1X1EA 5JH7F 4M1WA 1R5OA 2WTUA 4HUTA 1P61B 4L8VA 5DMHA 3TN7A 5LD2B 2IH2A 1D1PA 4BEBA 4W5RA 1SU7A 1OA1A 3KK0A 1X1AA 4I7EA 1XEFA 4XIIA 1KIFA 1DNPA 3WL3A 1BE6A 4W6ZA 1A7AA 3FNEA 4CM8B 3S99A 2O48X 3H75A 2OV2A 3HFRA 4NAHA 4QUBA 1A2QA 4CU2A 4DCCA 1QVAA 3FFXA 3E3MA 3DL4A 4ALIA 3N2KA 4P6VF 4F7DA 2RI1A 2PUHA 3OE1A 1HYQA 4DY4A 3Q7QA 4EA9A 1NX6A 4EDHA 1UBFA 2P6OA 4LYYA 1SHJA 3NBYC 3WFZA 3QYFA 4I6EA 5TQ2A 2UUOA 1KVRA 3MQ4A 4L4YA 1BX1A 4UAVA 1ZAKA 3ZGVA 4RJTA 3NVDA 1JT2A 2OUKA 1WZNA 3QE3A 1B0UA 3HSYA 4HLNA 2J8ZA 1TEXA 2R1TB 3P94A 3NTQA 5JAIA 3EW7A 1CB7A 1BVUA 1V11A 1SY7A 4D26A 2AFIA 3D8BA 1QHFA 1C9DB 2GUWA 4TLLB 4A0QA 2PUDA 3EBPA 3S40A 3ZWBA 2Q1YA 1DAPA 1II8B 3K9NA 3ELBA 3FWHA 1PJ4A 1OX4B 4JVSB 2O7VA 3LK7A 2GDZA 3ZOZA 4CODB 3E82A 6AT1A 4B82A 1E9CA 2UZAA 1YRBA 4IQ0A 2F6RA 5FA6A 7MDHA 1XTTA 5AOAA 1N3IA 2HQOA 2WABA 3NTOA 3P9XA 2UYQA 2DWPA 4E03A 2O2SA 2ABWA 2VIIA 3DMDA 4HLUA 3IDOA 2FU5C 1P7VA 3BREA 3RBXA 3UMVA 2W7TA 2CZQA 1IOLA 5T8KC 2OYRA 2J0UB 2GILA 4X20A 2TMYA 2ZRAA 4FNGA 5AVQA 3Q11A 1FK8A 4HDRA 2L18A 2R47A 4MPPA 4M46A 4QQRA 2G72A 3ABRB 2GA8A 2YZ2A 3FFAA 3RAFC 4N7JA 1M2JA 3DYIA 3P0FA 1PEKE 1GQRA 4RLFA 2C59A 2OQVA 3RB8A 3LO5A 3NS7A 3ZWOA 3HNOA 3PDIA 2HWXA 4DQUA 1YVRA 1D2HA 4LHWA 1UZNA 1XZQA 4O1HA 5ADVA 4BKOA 3TZEA 2XNJA 3OU2A 1V5IA 2F1KA 2IEAA 3UBTA 5KOIA 1DTEA 1MB0A 2IZ7A 3A4TA 4JWKA 4MLCA 4Q1AA 5LQAA 1YB7A 1P17A 5FF9A 3NGLA 4UHCA 1FNDA 3SE7A 5LVAA 3Q5DA 4A23A 4KAAA 1U0GA 2XVAA 1T36B 2RGRA 1Q11A 1TQHA 1O03A 2ZIVB 1PTJC 3BHJA 3EOAI 4NOLA 5LYYA 4DPLA 4ENWA 4W5TA 4WV3A 2XPCA 4U7FA 2I54A 3WLNA 3QFRA 3PKJA 4Q7JB 4B5LA 4Z7JA 4DJTA 4F38A 3MS4A 3KQUA 2BR3A 4PSAA 2W2QA 1C9YA 3MJVA 1QTIA 1KK1A 2C84A 4JV5B 1CVRA 3EUFA 3G59A 1JU4A 2WSMA 1VXOA 1QXSA 1EWTA 1ODSA 1WQ4A 1Z0IA 2OBLA 1DO0A 2XWPA 3CNNA 3DG9A 3IIEA 4JLVA 4ME6A 5CXXA 3HU3A 1WHTB 1ZOLA 1E9BA 3RW9A 1PUJA 3L1UA 3JWEA 1P1HA 3BKWA 3QYPA 4OHOA 3QC8A 4PQFA 4HR7A 4ZCQA 4F3YA 4LF9B 2HNKA 1ADCA 3AX6A 4A36A 1SK9A 1JBQA 3IT2A 2ZP1A 3H5TA 2A5LA 3I12A 4BOYA 1ZCAA 5J4KA 4Y2RA 3ZWNA 3MWDB 2XTMA 1DV2A 5HE9A 3HZZA 1JHYA 4ND7A 3IB6A 1H4TA 2LCIA 4DOMA 1EK5A 1C0KA 1LRLA 4W1RA 5L3RA 2JH3A 2ZK7A 1KY4A 2VQ6A 3LHFA 4KQKA 4GMGA 3U81A 5ELXA 5K0BA 3FNGA 3KFXA 1MABA 2XUPA 2IOYA 4UUOA 5C8YB 1FC0A 4C2BA 4MV6A 2ZI7A 1EZZA 5CLGA 2WG1A 1KO8A 2XUAA 1PHRA 3AR6A 4GPAA 2X9NA 1ZESA 4HH4A 4TWRA 4DDVA 2FPUA 2OZLA 2PNFA 2RGYA 1TYAE 3M70A 5C1DA 3BD6A 3TXAA 2V96A 5CB4A 1A77A 1MFPA 4ZZ1A 1S96A 1WTAA 2BGRA 4MYUA 3BH6A 4WXYB 3DDWA 3LH5A 4H3VA 1RYEA 4OATA 3UANA 1MDBA 2O3RA 3B36A 2XD4A 1L5LA 2XVZA 1L4FA 3K2QA 3C6MA 5I8ZA 1ESDA 3TTTA 5DX0A 3VKWA 3TRKA 3O75A 4F04A 2A94A 2CLHB 5KSWB 1WCIA 4P4NA 2MSEB 1FE8A 2WKSA 2YRWA 3BWBA 3GVHA 3GFSA 3J7TA 1RLJA 4Y30A 3EY9A 3G0BA 4J9UE 1ZUHA 4CFZA 5GTDA 1H1DA 2VP3A 2HYIC 3K32A 4EGSA 1JYEA 2C1EA 2IZ1A 1G0OA 2ACEA 2BAGA 4MV8A 5FUYA 2GK7A 4D97A 1SA0A 3F4LA 3TEMA 4TTIA 4OIFA 3COWA 3D3EA 1Q3HA 3H5RA 4NHEA 2A9JA 1LVGA 4P93A 4FYVA 4RFSA 3TMAA 4NFYA 4AS2A 1Q3TA 1NJ6A 3EWIA 3CRVA 5JMTA 16PKA 3IMFA 3PV0A 5BNFA 3O8DA 4DCSA 1SHUX 4CKCA 5LZ5A 4DNFA 4ZKEA 3OECA 4AXBA 3IDZA 4NCHA 3TQTA 3WK9A 4MNTA 3OJOA 2ZI3A 3HDQA 3V8MA 4UOEA 5I7HA 4MW0A 2A9RA 2I7XA 3FA2A 1IJBA 3GD5A 4Q1EA 2BGUA 5AKXA 5JXGA 3E35A 1UDAA 1U7XA 1V4NA 2H4ZA 2ZI9A 4K05A 3F78A 1NRXA 3I73A 4BX2A 4C4XA 3ISVA 4H3HB 4COKA 1TKBA 2DR3A 2HCFA 3DNMA 2WJ4A 2MJLA 4N3BA 5HGJA 1RPAA 1M5RA 2ZUVA 3PFHA 4IBOA 3ILVA 4IIVA 2DEUA 4WLVA 3JQRA 1XRPA 1BX0A 3I2YX 2J9ZB 4DT1B 1IULA 1HT3A 3LS2A 3F7MA 5DM70 1RZUA 2GETA 1J0CA 2RARA 2NGRA 4X1KB 4B73A 3QXJA 1PW5A 2AHRA 1CY2A 2ILVA 5C8VA 1F2TB 4M22A 4R2IA 3DBHB 1EAYA 4KKVA 2JJQA 5A5VA 2VP9A 2IY7A 1W19A 3E05A 3E84A 2LTAA 4C6TA 2Q1TA 2AYYA 1OUMA 1GG9A 4Q0MA 5CAEB 3S2YA 2OHIA 3AIOA 4PZDA 5BMVA 3HR4A 2P11A 3KU1A 4HVCA 1WDTA 3FVWA 4Q21A 3MPOA 1RAAA 1XL0A 4IQGA 4RFVA 1CD5A 3ZTYA 2KB0A 1TFRA 4N39A 1U3GA 1N2OA 5DNUA 4RD0A 2UZIR 2JLSA 1SBIA 1SEPA 2GPSA 3OZSA 5B37A 4MYTA 1KFKB 5JNVA 5HWSA 1MBZA 1B1AA 4BCDA 4PLWA 1FP1D 2HF9A 5E7JA 4CEHA 3HN2A 2XV1A 3M3DA 1BD4A 2QUHA 3I58A 3OLWA 1C9NA 1H6BA 4TTPA 3A10A 2OO5A 4BE7B 4KV7A 4GSLA 1IBSA 2RH4A 4PZEA 1CEEA 4WESB 4C21A 3DD5A 4ZVQA 4ZAWA 4GPBA 4CMIB 4HWSA 3MTAA 2D62A 1V43A 2OP1A 5DT2A 4OHZA 3RUCA 3D4PA 1CUXA 4FKBA 4C6RA 3K1AB 5TRTA 2D54A 3DFKA 1BGVA 4TX1A 4EX6A 3CN9A 4YAIA 3KL4A 4DL9A 2JJMA 1WEKA 1E6WA 4E21A 1ENZA 3E3NA 2ZWAA 4TL7A 3CKLA 4YCCA 1PL7A 1NG9A 2JGJA 1EESA 1L5FA 1Z08A 4OYLA 5TQ0A 2VJNA 2Q27A 4KFCA 2IWRA 1CULC 5FWDA 3PX3A 4BO8A 4AN0A 4WSOA 3LGAA 1OIVA 5CYGA 1C30B 3LC1O 3VH2A 4LNHA 4B3HA 2V55B 1BD3A 3GCGA 4WACA 1KSFX 4WA8A 3WWPA 2XCLA 1CY6A 1G8AA 1UOEA 3PQ2A 2OM6A 1ZR2A 3W34A 4RSMA 3TLJA 2SCUA 2C82A 2VF4X 3IE0A 4DMCA 4G0VA 3GJ5A 2EGHA 1FQJA 1CUJA 1GL6A 2I2CA 4P3KA 3UG6A 4ZAGA 4NCJA 3WHKA 4BQRA 3HK2A 1Y3AA 2NO1A 1QQ5A 3ZHVA 4D9HA 2JARA 3M8KA 5BVGB 4Y0NA 1D1QA 4EITA 1D2RA 4CKEB 1MIOA 2CDNA 2HY7A 2PD6A 5CT5A 1K3UB 4O3MA 2ZROA 2O2XA 3PA8A 3EA5A 3JQPA 1RQXA 3TOXA 5LWQA 4Y6GB 1XNRB 3ASUA 1XQ9A 5F7ZA 4RO0A 2W6CX 3USCS 4D0GA 4ZTBA 3WIUA 1ESCA 2XVXA 3LOPA 3LPDA 3AIKA 2XRZA 3PSAA 4CEJB 1HFJA 1W4CA 4XWYA 3PRKE 4TKVA 5ECGC 3MFYA 4US2R 3DMTC 4AJHA 3D7NA 1FFBA 3H84A 3NWEA 3H0KA 5CA1B 3MJDA 2PWAA 2OO7A 4O63O 1L7EA 1VE9A 3AGPA 4N9WA 1O5IA 4YAGA 3UJNA 4OX9Y 2PT6A 1HH4A 3O2NA 4IYRA 2JI9A 1UPXA 4QGHA 4YP0A 4LQCA 4KUGA 3K70D 1LNQA 1ODJA 3RSQA 4E1AA 1LF5A 1LLUA 3VC3A 4Y7CA 2IY8A 4HJXA 4PBTA 3PRYA 4YY3B 3KX2A 4FI3F 2ASEA 5K5EA 5D3KA 2E21A 4UHDA 1QS0B 2DR0A 4H1HA 5ALYA 3VH4A 4DDWA 3PC8C 221PA 1DCTA 1J8MF 1YJQA 5CD1A 3AI7A 2ZE6A 3G13A 1WXHA 1Y7TA 3K0AA 4QUEA 5ICFA 3ROPA 3UK2A 4RA9A 2XE7A 3CKMA 4PYNA 1QYXA 3W4IA 4LJAA 4W1PA 1E0SA 3FJYA 3NWJA 1Y33E 3PNPA 1CUDA 2Z9CA 3DDSA 4UHKA 4EL0A 1YGYA 3RC3A 5CAEA 1I3OA 2QYSA 3BHNA 4CBVA 1QHEA 4A0HA 1YCDA 4JYPA 2XLCA 1MOSA 2QJFA 2YHBA 3AEQB 5EE1A 3CQ9A 2EC5A 1NC1A 1WXQA 3JWGA 4CF7A 1XQVA 4BB9A 3MUFA 4BFVA 2P6RA 1EFDN 3IGFA 3NNNA 2X14A 4GOND 3ND9A 3RT1A 4HOYA 4JA2A 4YMIA 5JJIA 4G4SO 4IDDA 1OZFA 2OENG 5GY7A 4KPYA 1M6NA 4QHSA 1JFVA 4RTLA 1I2AA 4ZD6A 2QTWB 2CYAA 1YRHA 2PVCA 4FBMA 5JFOA 3TAHA 3CX8A 1A9YA 4WXPA 4M9XA 4LXUA 1MNAA 1SOMA 2D7JA 1SKAA 4NZ9A 1FNSA 2X9LA 3MPUA 4CGYA 1SIWA 2REQB 3WB9A 1M6YA 1Z6TA 2X8AA 3AU8A 1DVRA 3V1MA 4QGBA 1ADJA 5KPDA 1FP6A 3PXGA 1ZK1A 4IJWA 1T9GR 3MTGA 3NB0A 2QT1A 3HB4X 2HSEA 4JDUA 4JVMA 2EW8A 4M3NA 5AVJA 5AESA 4R1PA 1X7WA 3I01M 1T5OA 1JFLA 5FBHA 1DZ3A 3AKCA 2WAMA 3TQHA 2JD1A 3KR2A 4G0XA 4F97A 1Q7CA 5GVSA 4QXMA 3QNWA 1D5CA 4E32A 4HGRA 1D5WA 5FYQA 2X1VA 2BGJA 2A1TS 1FJXA 4QECA 3EE6A 3AGQA 2GN1A 4LYDA 3RUAA 2PH3A 4I8XA 3EAQA 5CVEA 4QKQA 4G0NA 4BWGA 3RAPR 5BOSB 1T26A 4CM4A 5KU7A 4LIPD 2B25A 1U7DA 4M0LA 4UPVA 3BWXA 2H11A 3V4ZA 5LCXA 4CKBA 1VL8A 4UREA 4BJ6A 4LBVA 3E9QA 3WC4A 4J90A 2XQKA 5BWCA 1CWUA 1H8EA 4BJ5A 2V7WA 4GBGA 1UMBB 3C4VA 4YBRA 3GCDA 4GZ5A 2HV8A 3GUHA 4EG5A 4H7IA 2IHJA 4MVJG 4OXXA 1FFWA 1MKYA 2YVKA 3EVTA 3R77A 3ANNA 3FNBA 4P4UA 4ENQA 4HUJA 1XLWA 2QVYX 1JDTA 3ZD9A 1EQ2A 1QO0A 5IAGA 3ICPA 5DULA 3Q8LA 3L07A 1Y8RA 4NCNA 3R8FA 3G2JA 2FWIA 4ZZIA 1QU3A 2J09A 5JOQA 5EUCA 5K3DA 3X1DA 4OJKA 2YWBA 3C15C 2A67A 3PFIA 5AJYA 3DVLA 1U7UA 1CZOA 1N8TA 1SXGA 4ZT5A 3UJ6A 5JJCA 2Q2NA 1O8CA 3ICWA 4MJ7A 2G1PA 3M1LA 4EYQA 1E1KA 1EUCB 1BXZA 4UNNA 2N0SA 2CJWA 3K9LA 1I3CA 1KE2A 2JJ2A 1N8KA 4EEZA 2MHCA 3ORQA 2WF7A 4TQ9A 2O0KA 1SCDA 2WHEA 1JVBA 1NGSA 4JGGA 4BLOA 1W8IA 3JVVA 4A27A 1JQ5A 3KQLA 3VV2A 2OR3A 3LQRA 3FD8A 2C2HA 3QJYA 2PDAA 1Z0ZA 5CLIA 2C5BA 4C29A 2EP8A 2ZANA 1KC3A 4IH1A 1GGVA 3A1SA 3KQTA 2EERA 2QN1A 4GDMA 3T5BA 3P4UA 4O8ZA 2XODA 3QFTA 5COBA 1ZD1A 4D3SA 2YYZA 3ZKWB 3FLAA 5AHXA 5LL6P 1A9XB 4QPJC 5K3EA 3HACA