1I9GA

Crystal structure of an adomet dependent methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
264
Chain Sequence
TGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN RV2118C
total genus 74
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1i9gA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i9gA02
4WXHA 2EG5A 2FHPA 4PYMA 3HCEA 3TFWA 2PXCA 3HA7A 2B2CA 2PXXA 2R3SA 1JG1A 4CTJA 4ER0A 3ELYA 2NP6A 4R8SA 5HIKA 3A7EA 3R6TA 4U7PB 2ZWVA 4MIKA 1Y8CA 2G71A 4QTTB 2YX1A 1R8YA 1FJXA 4M36A 3BUSA 3KPJA 2AVDA 1VL5A 5ICCA 2P41A 3MGGA 2OO3A 5DRYA 1SVUA 3KU1A 4OBWA 3HCFA 4QQNA 4QVKA 2C7PA 1L3BA 4PYOA 1ZG3A 3OFJA 5U4XA 7MHTA 1X1CA 5F2OA 2OB1A 4MWZA 3A25A 3BWYA 1SQFA 4CXMA 3BWCA 3FTCA 3KPWA 4FGZA 3NDJA 3KKZA 1RJGA 4PINA 4EKGA 1VQ1A 3PFGA 4FSDA 3I64A 1L9KA 3K6RA 4P7JA 5T6BA 3R9XB 3KQOA 3P9KA 4P7FA 3P97A 3T7SA 1AQJA 1P91A 3O7WA 1ZQ9A 3GGDA 1Z3CA 3KQQA 3KQPA 3NTVA 3MAGA 4ISCA 4PYKA 1NW8A 5HFJA 3RIEA 5BXYA 3EMBA 5K09A 1G38A 2QM3A 4YUXA 3LPMA 5K0CA 5K05A 2WK1A 3UJ8A 3K0BA 4GC5A 3LSTA 4LWPA 3GRZA 2AOUA 1JQEA 1O54A 1KPIA 3DMHA 3T0IA 1XVAA 5EGSA 4RTPA 5K01A 2PXAA 3C6MA 4UOEA 1SUSA 1ZKDA 2N47A 3R0QA 4R05A 5HIJA 5T67A 3UJBA 3VC1A 2K4MA 5F2NA 5BW4A 1JTFA 1SG9A 1TPYA 4C03A 2JH9A 3DH0A 1FP1D 4H0NA 4LECA 3NMUF 3HNRA 4DKJA 1JQ3A 3LKZA 2ZBPA 5DX8A 5E2AA 3UJ9A 1EJ6A 2BH2A 3BGVA 5EHIA 1F38A 3RW9A 3D2LA 2VS1A 2ADMA 5KS2A 3LCCA 3TM5A 2FYTA 2Q41A 1KPHA 4XCXA 4GC9A 1NE2A 5GIPE 3DOUA 1FBNA 2I6GA 4AZWA 5LQNA 3JWIA 2ZSUA 4RTJA 2HNKA 2ZFUA 3T7TA 4EKIA 2ONZA 3ELUA 4FT4A 1X1DA 2AOUB 1VIDA 2BM9A 3GDHA 4E30A 5ICGA 2P8JA 3LECA 4DA4A 4MQ4A 3LL7A 1PRYA 2PT6A 3PFHA 1XTPA 5EMMA 2ZULA 2XYRA 1EG2A 2YXLA 4RTRA 4KVZA 3LBYA 5BP7A 3KQMA 4KDRA 1YF3A 1NV8A 1MHTA 4F86A 4O29A 3HA3A 3AXSA 1XCLA 4YUVA 3BGIA 4HGZA 4K6MA 5ICEA 4OA8A 2VDWA 1XXLA 1Q0SA 4GEKA 1D2GA 3IYLW 2F8LA 5LQCA 1ZHFA 3FUVA 4YMHA 3M33A 4OBXA 2PWYA 1X1BA 2AOWA 2FPOA 3OE5A 4IV8A 4OQEA 3UJ7A 5GINE 4JXJA 3A7DA 4E2XA 4P7KA 4F85A 3ME5A 2GH1A 5GM1A 3DXZA 2ZCJA 4FP9A 3EPPA 5EOVA 4PWYA 5CCXA 3Q7EA 4OA5A 4QDJA 1N7IA 3GIWA 1NW7A 3AXTA 3EVGA 5DPMA 3UFBA 3GRVA 1VP9A 2BR3A 2V7EA 2VZ9A 1DL5A 1QAOA 4F84A 5C9ZA 3EGEA 5FUBA 5DLYA 5K0BA 4XUCA 3I9FA 2O57A 5GP1A 5EZQA 4IV0A 4WVLA 1YZHA 3A27A 1BOOA 2NNWB 3LKDA 1JG3A 4EK9A 1XCJA 2AN4A 2A14A 1NBIA 4GOLD 4PYNA 1VBFA 3MB5A 1EJ0A 4AUKA 2JH8A 4A6DA 2UYOA 4GOND 3VC2A 4YUWA 2UYCA 3TRKA 1M0EA 3EVEA 5DT2A 2IDKA 2ZBRA 4BLVA 2PBFA 3IEIA 2NXEA 3QOWA 1H1DA 3G7UA 4HC4A 5P8WA 3ER9A 5MHTA 4FZVA 1WY7A 4QPPA 4RVFA 5EKXA 3EEOA 5EPEA 4E31A 1IY9A 5CM2Z 2B25A 5HIMA 3T7RA 1L3IA 3ORHA 4CWAA 3UJ6A 4YV2A 2G8NA 4RTNA 3OCJA 3QV2A 2VP3A 4HRAA 5ICFA 3SVZA 5E9JA 4RTKA 3P71T 2C7OA 3O4FA 1QANA 1FP2A 3DMGA 1V39A 2FCAA 2EJUA 2O06A 1N7JA 3E23A 3FUXA 1DUSA 2V74B 3KHKA 3P2IA 3CCFA 2I62A 3CGGA 3OFKA 2IP2A 4DCMA 3DUWA 5BW5A 2GA9A 3B3GA 2ZIFA 3OU2A 4KWCA 4KDCA 4RX1A 2PT9A 4X63A 5FA5A 3M6UA 2QE6A 1L3CA 2IGTA 2UYQA 4Y30A 1YFLA 3FUTA 3UJDA 3EEYA 1TW2A 3I5UA 2ZVJA 2CMGA 4RV9A 3FTFA 3EVZA 3P8ZA 4PYIA 3FUUA 5K0EA 1EAMA 3FRHA 3GNLA 1SQGA 3HEMA 1EQAA 1M6EX 1RI2A 3Q87B 5DTQA 3E7PA 5CVUA 1JTEA 3VYWA 3HVJA 4E2YA 2CL5A 2B78A 5JUWA 1D2CA 4E70A 4CTKA 3S68A 4RTSA 4M38A 4PYJA 3PVCA 1G55A 4HTFA 1HMYA 2IH2A 1F3LA 3FPEA 3MHTA 4ER3A 4C06A 1DCTA 1QAMA 3ELWA 4BP3A 1MJFA 4ATNA 2IFTA 3JWJA 2HWKA 5DRTA 5DX0A 3A26A 5EKUA 3LX6A 3OZRA 2DPMA 2JJQA 2R6ZA 1SKMA 4OX9Y 2BR4A 4L7VA 4XUEA 3BGDA 5EEHA 2GAFA 3U81A 1I4WA 2IBTA 3CC8A 2ZZMA 3B7PA 2I7CA 5CVVA 1NBHA 2YQZA 4GQBA 1NW6A 2FRXA 4FS8A 1R74A 1RI5A 3OU6A 4C04A 5K0JA 2ZWAA 3V97A 2GS9A 2EJTA 2JG3A 2HV9A 3ERCA 3L8DA 1WS6A 3QOXA 4GOOD 1QZZA 3NVMB 3TKYA 2ERCA 4U7TB 4YV1A 4YUYA 2AZTA 4DM3A 1RJEA 4FSXA 3UA3A 3DLCA 3MQ2A 2ZTHA 3BKXA 3KR9A 4X61A 3KQWA 4EQZA 4X60A 3UWPA 3TMAA 1I9GA 4HGYA 2GPYA 2JHCA 5EHGA 3MTEA 3C6KA 2JHPA 3OU7A 3KPYA 2VDUE 3KQVA 3PB3A 2Y1XA 3G5LA 3TLJA 4HH4A 5ERGB 2P7HA 2JHAA 5FHQA 1O9HA 1B42A 3TOSA 2H11A 2H00A 2OKCA 3DXXA 4X41A 2OB2A 1NV9A 3GXOA 3HM2A 2G1PA 1JSZA 1NW3A 5K0GA 2BM8A 1SUIA 3M70A 3O31A 3JWHA 2IH4A 2AOVA 4NECA 1YB2A 4MTLA 1HNNA 2PGXA 3HA5A 1RJFA 5DM1A 4C07A 2AOTA 2G72A 2XYQA 4PGGA 4RVHA 4PIPA 3G88A 4M37A 5HOQA 1N2XA 2ZLBA 1UIRA 2O07A 2OXTA 8MHTA 3CKKA 3DLIA 2AN5A 4ER7A 4E2ZA 5GOZA 3IV6A 5EMJA 3SXJA 2PWPA 3G5TA 5M5BA 2P1DA 3KR0A 4PCAA 4XUDA 1VP3A 1XJ5A 3HVIA 5FWAA 1I1NA 3GCZA 5C0OE 3LHDA 3PX2A 4BLWA 2UYHA 1YFJA 2ZW9A 3ID6C 5KQSA 5CVDA 2IBSA 1R18A 1JG2A 3FPGA 3KR1A 3SSOA 3PS9A 4G56A 3MTIA 2AN3A 2C7RA 3A4TA 5H02A 5C1IA 4AZVA 2ORED 4PNEA 1KYZA 1VPTA 1AF7A 3EMDA 5EG5A 5HEKA 2G70A 4C4AA 2PX8A 3TR6A 1RJDA 2H1RA 3KQTA 4GF5A 1KR5A 3FPJA 4KIGA 4PGHA 3TM4A 3FZGA 4Z2YA 1O9GA 3MCTA 2PKWA 4R6XA 4X1OA 2AOXA 5E2BA 5E9WA 3FYCA 5GWXA 4E32A 4YMGA 1JSXA 1OR8A 3PLAE 3PTAA 3BWMA 3P9NA 5EMLA 4RTQA 3LGAA 2YUIA 3LCVB 3OPNA 3B89A 1INLA 4RVGA 1KYWA 5EC8A 2P3LA 5DX1A 5DWQA 3AJDA 3FTDA 3GRRA 4KRGA 3B5IA 3GRUA 3M6VA 3SSMA 3DR5A 2KW5A 4BY9E 1KIAA 1WXWA 3M6WA 3EGIA 1UWVA 1G8SA 3DTNA 2FK7A 3E8SA 4QPNA 4AX8A 1U2ZA 2B3TA 2PX4A 2NXCA 2I9KA 3GU3A 3SM3A 4YUZA 1M6YA 5DSXA 2CKDA 1VLMA 1JQDA 3E05A 1P1BA 2PX5A 3I53A 3V8VA 4DCGA 2C7QA 5D1NA 5CIYA 2XBMA 5DXAA 4RVDA 3UZUA 4PYQA 5GIOE 3HTXA 1VE3A 4ER6A 5EEGA 5EVJA 1P1CA 2DULA 2YXEA 2O05A 3P2KA 2ZBQA 5E1DA 5FA8A 4ER5A 1RI3A 3CVOA 3ANXA 3GO4A 3DULA 3RODA 3HCAA 1ORIA 2FK8A 1T43A 1R00A 1AQIA 3TPZA 3HCCA 5HILA 1R6AA 4A6EA 1KP9A 1QAQA 2B9EA 5CCBA 3DMFA 3G8AA 2OY0A 5EZSA 3JWGA 5FCDA 2YTZA 2ZZKA 3C3YA 5DTMA 2AR0A 3THRA 2ONYA 2QRVA 1IXKA 5EIWA 2GLUA 3FYDA 3SGLA 4BP1A 4R6WA 3G2OA 2XVAA 4YV0A 1UFKA 1G8AA 5D1HA 3EVDA 3H2BA 2GB4A 2P40A 4HTFB 2PX2A 4KW7A 5G02A 2HTEA 3FUWA 2P3QA 1XDSA 4DQ0A 4EMSA 3HCDA 1G60A 2BZGA 1TW3A 2IDJA 2ESRA 4OQDA 4P58A 4PIMA 3EVFA 4GBED 5KYGA 3F4KA 2Z6AA 1X19A 5DM2A 9MHTA 3CJRA 2PV0A 5K0LA 4P7GA 5E1OA 1RI1A 4POOA 5T64A 2P3OA 3OZSA 3SR4A 5FULA 1XDZA 1KXZA 4PONA 2P7IA 2PJDA 3ELDA 2O0LA 4HG2A 3ER8A 1XDUA 4LG1A 2QRVB 2YR0A 4LWOA 5E8JA 2PVCA 3P9CA 5K8VA 4QVGA 2NYUA 3C3PA 3KQYA 4HSGA 4AZSA 3G2MA 1WG8A 3B3JA 5KVAA 3MERA 3FRIA 5FWDA 5E1BA 5DSTA 2NP7A 4C08A 2VDVE 5EIFA 1ORHA 5EQJB 1ZGAA 5DTRA 3SSNA 2EFJA 2OZVA 3UA4A 2HMYB 1JG4A 3IHTA 3G89A 3GWZA 3FPHA 4E2WA 1X1AA 4DMGA 1BKYA 1IM8A 3BWBA 2WA1A 3NWBA 5DM4A 1YZ3A 2ZIGA 3DXYA 5CVEA 1NT2A 5DXJA 1JR4A 1WXXA 4IKPA 4CKCA 5KQRA 1ZGJA 3C0KA 3NWEA 2AOTB 3LCUA 3R24A 4KIFA 3HCBA 4FT2A 3WSTA 1KPGA 1D2HA 5K0FA 3KPUA 4IWNA 4DZRA 3THSA 3NJRA 3CJQA 5LQJA 2IH5A 5CVJA 3NW9A 3SMQA 1NKVA 3M6XA 1Q0TA 10MHA 2ZIEA 5CUQA 3KQSA 1KHHA 4RWZA 5E1MA 2EX4A 2IPXA 3BKWA 3PT9A 5HIIA 4C05A 4DF3A 4E33A 2BR5A 4EVIA 4RYLA 3AWIA 2AS0A 3BXOA 3HP7A 4PYLA 2CWWA 2HR1A 2AVNA 2PY6A 2OYRA 1L1EA 2Z6QA 1FPQA 4QQKA 2XVMA 2QYOA 4ZTBA 1RI4A 3UBTA 3OZTA 3GRYA 2QY6A 1G6Q1 3M4XA 5FQOA 1AV6A 3CBGA 5E8RA 1PJZA 3EVAA 5LQKA 3CJTA 3EVBA 4QTUB 3TKAA 5FHRA 5CD1A 3OE4A 1NW5A 4MHTA 2PLWA 3REOA 5LSAA 2NXJA 5LQUA 1EIZA 3BZBA 2E5WA 5K0NA 2P35A 4QDKA 2WA2A 2XYVA 3EVCA 3HVKA 5FQNA 1BHJA 3P9IA 2OBFA 5F2KA 1R8XA 3HVHA 4M7RA 1WZNA 5GM2A 4RTLA 4RSRA 1P39A 5HZMA 1YUBA 5IH3A 5B1SA 3X0DA 3EGVA 4R8RA 3AY0A 2YXDA 3UJAA 5K03A 1BC5A 4AZTA 3G2QA 3R3HA 5E9QA 5FADA 3UJCA 2LD4A 3LBFA 3PX3A 3VSEA 3B3FA 3KPVA 2IIPA 3G2PA 4B17A 5LR6A 3SX0A 3GJYA 4V0QA 1QYRA 4CKBA 5LQAA 5JR3A 5FTWA 4BLUA 2PSSA 5IKMA 2Z6UA 3I58A 4GUAA 3FTEA 4Y2HA 2YVLA 5EMKA 4CKEA 5DM0A 3NDIA 3DP7A 2CMHA 3MCZA 5LQRA 2Y1WA 4V0RA 3LDFA 3P2EA 4RTOA 3TQSA 3BT7A 4GOMD 2UZ4A 4FR0A 3G8BA 4RTMA 2ZZNA 3NVKI 2OPBA 3KR2A 2NXNA 3FPFA 4PCLA 3LDGA 3LDUA
chains in the Genus database with same CATH superfamily
1KZ4A 4H35A 3ZWKA 4X66B 3W6OA 1KJZA 2HCTA 4EW6A 2HC9A 3DONA 4HWGA 2NVWA 3C3EA 3B1FA 2ZXEA 3PFWO 4LI3X 1HV8A 5T5QA 2H6EA 4KE8A 1Y42X 4M36A 3ZW7A 3M5DA 3PWKA 2QYTA 4TXHA 3T6KA 2PUBA 3OZ7A 3KPJA 3MJ4A 2O23A 2JHFA 2M6RA 2J0UA 4O4LF 3Q8XB 2ZDQA 4QLOA 3ESBA 1QK5A 3ITKA 4OL0A 2EBHX 4INOA 4WZAB 2XTMA 1P6XA 4B4DA 3AC0A 3OF5A 3QBTA 3IAS6 3DD5A 1XKLA 4KL8S 3MMPA 5E6RB 3NHZA 1ODTC 2OD9A 3NG1A 4INZA 1XF9A 2K87A 5FF9A 5HF8A 3R7NA 3K6RA 3PJRA 3U7QA 2XRYA 2QJWA 4H0FA 4ZT7A 3O2JA 4HDNA 3UYKA 1P91A 4WY8A 3NONA 4O4JB 3VTZA 4ZK6A 4A5OA 2WT4A 5LQKA 3PHIA 3JQ9A 2ZSIA 3NXSA 1PYOA 1E1CB 1VRWA 5LBIA 4UQLA 1UBTS 1J5XA 4KHPB 1QDNA 1IRIA 3NDBB 3G2NA 3PPWA 1G2PA 3QF4A 3K0BA 4LWPA 2O59A 5D00A 4S24A 1KYVA 3C5HA 2I4MA 2PU7A 5H5JA 1KPIA 1IMJA 4IL5A 5EGSA 2ECQA 2WAAA 3HNOA 4JIGA 3SG0A 2XMBA 4ND6A 2I6QA 2ZS8A 5KYUA 2IOQA 3DT9A 3VI4B 5D84A 3VC1A 3RSQA 1AXGA 2CFSA 5F2NA 5IZCA 5AVWA 4DKJA 3HB0A 1KEZA 3D8BA 3T99A 4DXDA 2P9HA 3DEZA 1CS4C 1CZNA 1ZHHA 1T2UA 2Q1XA 1F38A 3EOBI 2MOKA 3R1IA 2FDCA 3AVTA 1ZK3A 4NZOA 3TM5A 1KTIA 2BMFA 2ZIVB 2OCPA 2JFHA 2ZYSA 3OM9A 4RKYA 4KPYA 5CW1A 2XUFA 4ZODA 3DZ8A 2R6AA 4HHEA 1KZGB 5HA5A 5B3KA 1UWKA 1Z5PA 2QLTA 3KDPA 3LH5A 4CLDA 5C52B 3NT4A 3E5RA 2PT6A 3OWHA 1RXSA 3H11B 3IJRA 4FBLA 4QSMA 1WF6A 2ZWOA 4IDGA 1E96A 2G9RA 3F6EX 5KYUB 4GR9A 4Z5XA 1F12A 4KVZA 4AJKA 5HKKD 1KETA 1OI2A 1W5TA 3DV0A 2V4MA 2YV3A 4KDRA 1VCNA 2RHLA 3ZQ6A 5B64A 5JZMA 5ITVA 4S35A 4EGCB 8LDHA 1TZMA 3OY2A 4OX9B 2FV8A 3L1HA 4GSLA 1VPWA 3QQ5A 4CF4A 4R51A 4ARBA 4AP5A 4DNOA 2RI6A 1LLDA 2RHOA 1CR5A 1UFQA 2QTHA 2X58A 2ZI6A 3PF9A 4JC8A 4RQTA 2H2FA 2IUEA 3DE1X 3A7DA 4BV8A 4J90A 1U63A 1NG1A 2GF2A 4V0SA 3VFDA 2L42A 3RIHA 5BSVA 2NZ8A 3F74A 4UBMA 4F91B 5JSZA 1CYEA 4I3FA 4I9UA 2W0SA 5BO5A 3EPHA 5JEEA 2H57A 4MITA 4LF8B 3SMVA 2VAWA 3N86A 2F64A 1J2RA 5ALXA 4RMIA 1OLUA 1Q7CA 4XUCA 3K0EA 1WKVA 5BXQC 3AR5A 2DWCA 1YL6A 5J4VA 1LPNA 2X5JO 3MLBA 3M7IA 1P44A 2XHZA 2PRYA 4CUZA 1P73A 3JQEA 4DQLA 2QSYA 1QRTA 2VJAA 4C6TB 4P98A 3PA6A 1AUXA 2QQRA 1FRQA 4XM1A 2RJOA 1GGEA 1VLZA 4KGXA 4M9UA 4X1IA 2W22A 3TZBA 3J81A 2WSLA 4PRZA 2CUTA 4YMSA 5A0FA 3TR5A 3V1NA 2JD1A 2ZTMA 4N8SA 5TS2A 2HJGA 3IL2A 4MQEB 5CH3A 3ROTA 5HJEA 3TIWA 2WIDA 2PBFA 3OHMA 4OFBA 4PLWA 1GCAA 2B4QA 3VOSA 3WGMA 4F2WA 3LCJA 1YDHA 1AXEA 2JD2A 4N0DA 4WNAA 5EPEA 5G0SA 2NZUG 3ENZA 5C35A 1AB6A 3NX4A 3TZLA 3YASA 5KCZA 4UEJA 4GMFA 3OCJA 2DG2A 3AJEA 3I1JA 3JQ6A 1WF3A 4GEGA 4N8DA 4K8RB 4S0ZA 4BZQA 2QUBA 2C7QA 4XM2A 2E18A 2B8NA 3B2NA 3DMGA 1IEVA 1Z68A 2FPXA 2FCAA 3T1QA 3ZE9A 1JFSA 1XZAA 1N9GB 1YH3A 4GI7A 5T4EA 3GNSA 4U2DA 4C7XA 3OFKA 3EOZA 1NYRA 3DZDA 2GA9A 3KB8A 4KDCA 3C98A 3HMKA 1ESCA 1C5KA 1EVJA 2J85A 3L7LA 3K1AA 4IYJA 4OOEA 4C0AC 3NTUA 5E2IA 1WBDA 2D1FA 3BFPA 3N7TA 4OHBA 1PNRA 1F6WA 1OGJA 3EEBA 4EY4A 1EZZA 4MRNA 1Z2NX 3V9AA 8ADHA 2FSPA 1F1JA 2QA5A 3C6BA 3EEYA 3BFVA 4WNAB 4ZCTA 3T41A 4R2IA 2VJKA 1RPTA 1SCJA 4AQ7A 3P8ZA 4PYIA 5HE9A 2PQMA 3WLAA 2PZLA 2ZTLA 2HU8A 1U80A 2C2OA 2VJYA 4GNRA 4FOTA 1OXVA 3I9V6 3CW8X 1TF2A 4KEAA 2VR1A 2RKBA 2HHCA 3IURA 4M1EA 3H1EA 4RIFA 3H1FA 3QSGA 5EWMA 3VDRA 1D2CA 1F8XA 4JT8A 1MXFA 4R3NA 1MAWA 2CY0A 4KYTA 5KAPA 5JJCA 4NYJR 1EINA 2CCKA 2OCXA 1LK5A 2XWJI 3NTXA 2ZRFA 3W1WA 5KQLA 1LWNA 3QU9A 4BP3A 1MJFA 1JF8A 1T9BA 2I8LA 4MRMB 4C4RA 3W5AA 5CLJA 5K51A 4ENTA 1LNSA 2QTVA 1L4UA 2CZCA 2QW8A 2XCLA 2YJNA 1GTL1 1OF1A 3LX6A 5EIOA 2XKAA 4X90A 2O2YA 4GZ3A 3VH1A 3AFIA 3HN7A 4JJKA 5IK2A 1GY8A 5L9AA 3HXMA 4M1MA 5JO0A 2FHSA 5CVVA 1Y9DA 4FS8A 4EHIA 4Q4LA 4XB6B 3OU6A 3AOGA 3GEMA 1RFGE 1M74A 1QGUA 2OD7A 1NRIA 2BEWA 2RHHA 4YIKA 2ICAA 3W8DA 3INTA 3DPSA 2W6MA 3B6ZA 3UA3A 3Q8MA 2CXRA 4TUYA 3F71A 2VNSA 2F1JA 2HMAA 4ZDKA 2HIMA 4IRUB 1TA0A 1N8TA 3K0AB 2YIMA 3Q3CA 1XEFA 1YNOA 1VG0B 1EA5A 2BAGA 1U2DA 1YQGA 3C6KA 4QASA 2JHPA 3G0IA 4QUEA 5KTKA 5DCLA 1FFGA 2QRZA 1PW7A 3H99A 2C9OA 4N5IX 5FB3A 4DA6A 3V4RA 3RVBA 3CRVA 4RETA 2WF8A 2P7HA 2X8JA 3AHGA 1UZMA 4YRFA 1KAOA 2VA9A 3WB0A 4DT1A 5ALIA 4ESEA 3IAHA 3G8YA 1Z8HA 4FNOA 2P4UA 3SQLA 1YIOA 5BSMA 1U0GA 3ZOZA 2UZ1B 4C07A 5C81A 2NU7A 3QA9A 3EGWA 3U7GA 1WDKA 2CLMB 5I4BA 4KTTE 5ALQA 4BJHB 4MGHA 1K5HA 1R6XA 1Z0IA 3RAPR 5G3ZA 1KO1A 1MAAA 3OE1A 4GYJA 1YQQA 5MN5A 4MVJP 1QWOA 3R76A 3ISVA 2XHEA 3C5WP 1DKQA 5JISA 2CDRA 1MIOA 3A3OA 3ITDA 2ZIAA 5BMOA 3ID6C 1VPEA 2NOAA 3ROXA 4B47A 1RYHA 4LNHA 4DAEA 2EHDA 2F4NA 3A4TA 3EC1A 1URPA 4IQ4A 2ZGVA 1O5OA 1W34A 3G68A 3L4EA 3QXJA 2CLOB 3MWDA 2FW9A 1XMXA 1TK3A 1CC1S 2J7KA 3PUYA 4C3ZA 4TV9F 4GKKB 1YK1A 2FSIA 2ODPA 4D8WA 5GWXA 2NYRA 4RVSA 3QU2A 4RZ3A 3WL6A 5JXHA 1PI3A 1RZVA 3M8KA 2YIVX 3P9NA 2NQ8A 1Z37A 3AIOA 3LCVB 1NQVA 6ABPA 2B1JA 3Q5DA 3G0CA 5GV7A 1AN0A 4QFCA 1KMCA 4U7GA 3H9GA 2QRJA 4U6QA 2P3LA 4EUSA 2PTGA 2PWZA 3PC3A 2RGGA 4MS1A 2GCIA 4IDEA 5ER9A 4ZCSA 3SSMA 3U3ZA 5IANA 1DDOA 1E2DA 1M1YA 1IONA 3AIKA 1E6KA 4HEHA 4IGEA 4D4IA 1UWVA 4DMUB 5CBPA 4NYMQ 1M5TA 2QRQA 2HN9A 1U2ZA 2LNDA 3A1VA 1HLDA 5TRTA 2A92A 2NSHA 2ZM6B 1KS9A 3ADKA 4ZGWA 1XQ9A 2P1RA 1OI3A 2WT9A 3KUCA 5DSXA 3T5AA 3DE5X 3V8VA 1L8AA 1T4CA 1Q20A 1ZMOA 2P30A 1NRWA 2P9CA 3IMFA 4HQ0A 4J1QA 3UV6A 4KWTA 5AKEA 4BB9A 1OA0A 4XVRA 5EVJA 2GN6A 3KSRA 4KNWA 4ZAGA 1YULA 2A8YA 1NW4A 3F9RA 3JYNA 4OLJA 1QX3A 5E1DA 5AM0A 3ZI0A 3CVOA 1KJYA 4GRIA 2I91A 3ESRA 4OLHA 1DS6A 1I7NA 2ZRQA 1N3IA 2ODEA 3LC2O 5G53C 3VOTA 3WLJA 3D6VA 5KMGA 4NMMA 1NJ8A 3HCCA 3G9ZA 2Q2QA 3STTA 1R6AA 3BE6A 3UMSA 5BV1A 2Q3MA 3A1TA 4V2IA 1B8OA 3WHKA 4ALLA 2OY0A 4EB6B 3JWGA 1EUQA 2O0MA 2CV0A 1J2EA 1WE2A 4JL6A 4PSCA 3CEMA 2HT1A 2ZVQX 3I34X 5LXTA 1P4HA 3EXHB 3JAWA 4UE3S 1TAQA 2X4IA 3PDIB 4GOKA 3WOHA 1VL1A 5BN4B 3SGLA 3E9QA 4WZAE 3LIIA 3KZXA 2XVAA 4HN9A 1QSGA 2FSGA 3G85A 1CUAA 4XB2A 1GRQA 3HWSA 4C4ZA 4J0IA 1OYOA 1JFLA 2VPZA 1O57A 2HBZA 3R5JA 1IHOA 2AF4C 5KYGA 1Q7BA 2ON6A 2OFFA 3QYAA 5AM1A 1H5UA 5FLXA 1EHIA 2H4HA 4BKRA 4UJ3A 1JHVA 2PMDA 1DQNA 4N0QA 1NJ1A 5CH5A 3D0RA 2R2GA 3JYOA 3ER8A 3EFOB 4CN8A 4R1QA 3CT4A 4RD4A 1T4GA 2V7WA 3EXHA 3JAWB 1Y3IA 3KTAA 4HDRB 2PA3A 1W88A 1XEWY 3L9WA 4AZ0A 1IHDA 3SFTA 5B5SA 5B7GA 3QWIA 3J81k 1ZAKA 4MUJA 4HSGA 2ES4A 1FSZA 1O7JA 2A4MA 5YASA 3FYSA 1L7BA 4ARIA 1GLGA 2QQFA 4KQ2A 2IEZA 2H07A 3PCXA 3VTAA 5KVQA 4C3UA 2NP7A 4C08A 1E4VA 1CE8A 3WGJA 3H3JA 1TT5A 2I5PO 1ML4A 5E95A 4F2GA 3TVTA 1FS5A 1PWZA 5HIKA 2IVZA 1KR2A 3PHGA 1JG4A 1VKRA 3GNQA 1ISHA 4HEA6 3ZZMA 1JGTA 1NONA 3MN1A 4G4SO 1SKYE 1XYYA 2GASA 2JB9A 2YV1A 3NC4A 3TD9A 5GONA 3OZXA 4HQNA 3O94A 4HB2A 3VU1A 2YNMD 3T1VA 1ZJWA 3I23A 5E0KB 3NUZA 4WKNA 4YQZA 4EYQA 4FX2A 3T9EA 2ADFA 5I9BA 1Y37A 1XI2A 4RD2A 1ZRSA 5JSYA 2RONA 4ZOAA 1VDMA 3TJRA 1H2YA 1AD2A 5ITWA 4M8IA 5HQ3A 5CCEA 1JHRA 3FGNA 5LQJA 1XTIA 3N0XA 3M6LA 3ISTA 2O5CA 5DGDA 4RZ2A 1NKVA 3KT0A 3TUJC 5CUQA 2XQGA 1NAHA 8GPBA 1ZI6A 4BNVA 4KX3A 1NOIA 1Q44A 5C2JB 3AO0B 4CI0B 2COUA 3TW6A 2FLKA 1FQWA 1WPRA 1MIHA 2OFWA 4IF4A 2FZVA 3IHLA 3NV7A 4HJXA 4Y0NA 1UT6A 2X0NA 3DSRA 1D2EA 2QY6A 4CMEA 1JHYA 1G6Q1 3HO8A 3P52A 3CBGA 4M98A 4Y6QA 1P18A 4URXR 1J33A 3DPUA 4Q4DA 3CJTA 4S1PA 1U7OA 4RFSB 2R00A 1OTXA 4PYRA 4ZJUA 5HZHA 3MTJA 3C3DA 4MHTA 2ZQZA 3BHJA 4Y9TA 1I6KA 1U8ZA 5AFSA 1JAYA 1E2NA 2GTPA 2XTAA 2P35A 4QDKA 2HK6A 3JYLA 4OO3A 1QONA 1NFRA 2H0AA 3IEKA 1M0SA 1W48A 4K28A 5IBPA 3VV3A 5FLKA 4I5IA 4DBVO 1WB9A 2W6CX 4K9MA 4L1KA 1KOLA 1XG5A 1G3UA 4BKMA 1LH0A 3ROEA 2WABA 3TXXA 1M83A 1APBA 3KAJA 1E7MA 4E22A 4WDQA 1QR6A 3C1OA 4N82A 1PWXA 3SHTA 2VH5R 3L7IA 2NVBA 3LY5A 2LD4A 3SDSA 1PFYA 4ZQHA 2HSJA 1S1CA 3H04A 1GOTA 1IK6A 4QT4A 1EJBA 2WD7A 3EXIB 3OQ1A 5IKMA 4NEQA 1JEEA 3I2KA 4MWTA 4ESVA 1KC3A 2A9VA 3F3MA 4EQ6B 3RRBA 1Z63A 1P75A 1S8AA 1ZA1A 2O2JA 2ZYDA 3NYWA 1HM5A 4N9QA 3RYCB 1RXVA 3HH8A 5GADl 1TOAA 2J4DA 5ULLA 1FLDA 3WLKX 4II7A 4HGRA 4MQ5A 4EO4A 3LT5A 1BRTA 4OHXA 3WTBA 1K86A 1U1IA 1LTQA 1W35A 1XTZA 2PAAA 1DAOA 2W71A 3UAXA 4E51A 2A9JA 5KINB 4LC0A 1JWBB 2CXPA 3T1TA 2ZUWA 4TRRA 4A16A 4BN5A 3HA7A 5AVRA 3B9PA 4BO2A 5JCOC 3D8UA 1J42A 4JFAA 4RGVA 5A1JA 2QD1A 5EE5B 1JN0A 3L7CA 4HNRA 3RS9A 3WLSA 5IG2A 4TZ0A 1JV2B 3URKA 2KY9A 5K9ZA 1GYQA 5ICCA 2ODQA 1RWQA 1V96A 4CG0A 1C50A 1OPRA 2XMCA 3EOAI 5M34A 3CCCA 1UFRA 5JC1A 2PBZA 4YBRA 4NOJA 2OHXA 1FXUA 2EG9A 3BWCA 3K2QA 3F7NA 3MJRA 3NDJA 3EFOA 2R79A 3FVTA 1WA5A 2R96A 2G06A 3IRUA 1I4LD 3ETHA 5IAAA 3LT2A 3C1UA 3T7SA 4MS4A 4DYHA 5T41A 3ZNNA 1R4AA 3IT2A 1ZXBA 2YYSA 3L0SA 4DJJA 1PL7A 1Z3CA 2QWXA 1N6HA 3NTVA 3RIEA 4KNVA 1LBEA 3ICWA 4WT7A 5BXYA 1X74A 4IIUA 1Y4DE 4DVJA 5INTA 4GC5A 2CXHA 2Y0DA 3A05A 5JRZA 3EZ9A 1Y7TA 1CDDA 2I6XA 2Y1KA 1E9AA 4TRJA 1R8SA 1K7SN 2YHUA 5J5VA 2IYVA 4G2NA 2C61A 5FDFA 2BYTA 3C6MA 3I1IA 4UOEA 4IMJB 3A3YA 4MW7A 3IIJA 3LW8A 3PDHA 4G41A 1R0WA 4LIPD 3KT3A 3TZCA 4DBLC 4JMPA 4XLTA 3G2KA 4D3FA 1GEEA 1EFRD 3DH0A 1OW3B 3LDAA 1PKXA 3HCNA 4OAOA 5HS6A 4EUEA 4A8JC 5JYBA 1L5WA 5EHIA 2BRUA 4OXNA 2VYQA 2Q1AX 5DYGA 5ALOA 1NN0A 3K1YA 2KWIA 4NCHA 3TRDA 5KS2A 5LJLA 4OU4A 4UCWA 3OLYA 1UPXA 2IWHA 1NUHA 2KX7A 3I62A 2GCGA 1IHXA 3KD3A 2ZFUA 4EKIA 3UHOA 1C0LA 3DWEX 3ELUA 4H7HA 4E30A 4UAVA 1MN6A 1EFTA 4X3CA 1GNPA 1G21E 2AK2A 3C5CA 4FMCB 3NQ41 4RLSA 3GJXC 1XC7A 2NT3A 3KQMA 1NN5A 2Q3LA 1NV8A 2AYZA 1Z2PX 3QLTA 2RHMA 4R0MA 5IJWA 3CLSD 1PJLA 3LPDA 3KSMA 2WLSA 3VSCA 1LPAB 1YRAA 2D7CA 1ZL2A 2WHQA 1KEEB 1D2GA 1R88A 3IRVA 4LOIA 4Y7DA 5SY6A 3TLKA 4B6PA 2BFFA 4B32A 5LQCA 1D9XA 1CDZA 4Q5IA 4LKRA 2GCEA 1VMDA 4P84A 4TX1A 5J23A 3B9BA 1EE1A 1MOQA 1SCUB 4N7BA 7ABPA 4AK9A 4YRIA 3QE9Y 2O9JA 4QDJA 2IDZA 1OFUA 1PW5A 1SU6A 2C9MA 2I1WA 2P75A 5H3LA 4OK6A 3ZDYB 1UPAA 4UUNA 2HMUA 3IC5A 7GPBA 2W7TA 3OEWA 1T4DA 3R0VA 3A3KA 3FOWA 4OXRA 3LUPA 2VK1A 4RMNA 4Z2AA 3AVUA 2BHLA 4M89A 1L7PA 1W6UA 3UK2A 5DLYA 5JQGF 3AIIA 1T3TA 3W2TA 3EJWA 2P11A 1AU9A 4HDMB 2DCUA 3GMIA 3LLUA 2CBZA 1XJ0A 4L8YA 1BOOA 5BQ3A 4PZYA 2BGRA 1V7CA 1OJLA 2G4CA 1SZCA 1N9GA 2FAXA 1KYTA 4P2BA 4WADA 1JPUA 3AV3A 4AG6A 4MV3A 5E7IA 1G64A 3OCUA 2YUJA 1KFBB 1V3UA 3I72A 2JIZA 4PZLA 2WYHA 2JIBA 3ZLUA 1M0EA 3E3OA 1DKMA 1XZCA 2FX3A 3U61B 2FUKA 5PGMA 1VB3A 1Y6RA 2ALJA 2YRXA 3ZVLA 1ODCA 4RHTA 4AIRA 3AP1A 1CQIB 2IP4A 3S70A 5TIIA 5MHTA 1UXGA 4QM6A 4LXYA 3FKSD 3JR3A 4ZCMA 5JO9A 1X7WB 3MB8A 3FPUA 1W76A 1C3JA 3BXHA 1XPUA 4YV2A 1ZJ4A 4XVCA 3E8XA 3O5AA 3O4JA 4L6AA 2NG1A 3QUTA 4QBIA 2FXIA 3UXEA 3USZA 3ZZTA 2C7OA 5DHRA 1FYWA 2CD7A 2O1XA 4E15A 2XNHA 3QQ7A 2IEDA 2UV8A 3SZRA 1DUSA 2W90A 2VWQA 1E62A 4L57A 2GF7A 3NHJA 3SU8A 1RMYA 1MXHA 1MC8A 4O33A 4RK5A 3HZZA 5H59A 2XE7A 2PT9A 4AWXA 2GRUA 2WB2A 1RWKA 1GN8A 4H4EA 4AQYB 1MJGM 4G4JA 5CB6A 3GMSA 2PWAA 1A82A 3JQ7A 3WY9A 3ZV5A 2NTJA 4CKWB 3OJEA 4PZ0A 3DVAA 4NQZA 1GR0A 2FG7C 1GAWA 1ODLA 5HNKA 1XEXB 3D5EA 1XCBA 1FYFA 4R2LA 5TR9A 4AS1A 3AX6A 1EQAA 2I2XB 2EFDB 3SIWA 3PUVA 2Y6UA 3B3AA 4G0OA 4WDRA 1WZIA 2QPAA 3U7QB 4XYLA 3IP3A 5EMNA 3VU9A 3ROMA 2WJWA 1HXHA 3E70C 3FG9A 4F72A 1COWD 3B6MA 3FJYA 5F1OA 5BRAA 1HMYA 1F3LA 1MG0A 3GN1A 1XR3A 2ZQYA 5ELXA 1SIUA 2IWRA 4C2AA 3P20A 2OWDA 3COYA 1XVLA 1QIMA 2REOA 4HAUA 2RB5A 5FBKA 4N9WA 2BLLA 2XF2A 2NZ2A 4WV3A 3VO9A 5K8IA 4Z49A 3L5KA 4UTOA 5LP6F 4QG3A 2ZPAA 4OH7A 5EINA 1FJGB 5KX5F 4CE6A 1MF7A 4H0CA 1EWTA 2OXCA 1I4WA 4W1QA 5EP4A 3TSYA 1POXA 3JZIA 1MPXA 2FRXA 3ZTTA 3ZY5A 2FX5A 3FJOA 1AQNA 3NHWA 4NE2A 2EJTA 4LNUB 1GPUA 4XD2A 3RSSA 3TZ6A 3V97A 5F7XA 1C2YA 1YBAA 1RYEA 2C7VA 4H3KB 5IH7A 4D92A 1YTUA 1EVYA 2C4UA 1A7KA 1FZTA 1Y3FE 2NUAB 3IOYA 4K9OA 1Q11A 3I45A 2ZTHA 3FFXA 2XXBA 3KYDA 4X61A 2UXBB 4FWBA 3ZK7A 3WKDA 4E4RA 3AHDA 3EIFA 1TO2E 2PBRA 3NI2A 1PQUA 4I5EA 1X6VA 2R87A 2VHWA 3DMDA 4OP3A 4YDSA 2X3FA 1TQ8A 2PS1A 5HJ2A 4BV9A 4F0JA 1NMSA 2EF0A 2F3QA 4RIIA 2H65A 2AHRA 5MGNA 1ZXLA 3DTYA 5ERGB 4TGLA 5EZ6B 2XGJA 1ZN2A 2UZ0A 5EIAA 1ZNXA 2BMEA 1NVMB 5F9FA 4NNJA 2OB2A 2YN0A 3Q11A 4HMOA 5KDLA 5BUSA 4YJKA 3DMTC 3TLCA 2PGJA 3NOQA 4GPZA 3COWA 3QJGA 3AONB 4RGBA 5G4KB 5TC4A 3D4BA 3JZAA 5J1TB 4BCCA 4GGPA 2UUPA 1G3MA 1PT6A 3JQAA 3KUUA 2IU3A 1DJNA 3GMTA 3GOQA 2ODAA 1MRZA 5DYWA 5IN4A 1WXGA 1UM8A 1YWGO 3QIAA 5D3KA 3ICCA 2WVGA 1FDUA 2GAAA 4QPZA 5ER6A 2DOKA 2H4JA 4FKMA 1J25A 2IXEA 3N2KB 5DLEA 3F7TA 3CN9A 4MVJE 3C3BA 1Q74A 1RLIA 1XJ5A 3L1JA 3QWAA 4QT0A 5TSDA 2IBMA 3GFBA 5H16A 3FMFA 3GZNB 3HM9A 2ZW9A 3RHSA 4N76A 2H4WA 4LN1A 1STOA 2QJRA 4HI0E 3NDRA 5FAXA 3VR5A 1BHO1 1R5JA 4HDMA 1NC1A 5L4SA 1NLUA 2ZI3A 3F47A 4PNEA 5G0WA 2MINB 2QDKA 1KQPA 2ZAIA 4IO0A 3LYHA 4G5OA 5DGIA 1GM5A 3WJ2A 3FX2A 1KQFA 1JBEA 4GF5A 1PWYE 2PQ2A 2QQGA 3AG6A 4MI6A 3QTTA 4TL7A 4X20B 1BX0A 2JVIA 2NU7B 3RNOA 2XNJA 3ZDXB 1RC1A 4D3SA 4AI6A 4EKNB 1P1JA 4YMGA 4OI4A 3DBLA 4FSHA 3ZGYA 1JSCA 3BORA 4E32A 1OR8A 3BFKA 4A2WA 4Z7JA 1PZNA 5BURA 1RHUA 1WKCA 2EV9A 2YUIA 3ZGNA 4CYMA 1LBHA 1KI4A 1PR4A 3H13A 3CIOA 1E2HA 4D9BA 4L5BA 3ZNPA 3DLHA 1FYXA 1JNXX 1GL3A 3EY9A 1L5OA 3H5OA 3WLOA 4WD3A 1GGVA 1U7XA 3R3ZA 1U3GA 2A9KA 2VUSA 1SHLA 2AFHA 4AX8A 4EZEA 3KVOA 1BXRB 5JECA 3H83A 3T7JA 1IVYA 2I9KA 2EGHA 4NAUA 2P4QA 2QI9C 4GI5A 1BWRA 3GAMA 4UOQA 4ZOLA 3IOMA 3RVQA 4PNHA 2WF5A 3AR8A 4LV5B 3PRKE 4HXFB 4C7OB 2W6QA 4IGIA 1MAVA 2B6NA 2PV7A 3ZV7A 2WKRA 2OFOA 1EUYA 2B9VA 3P2KA 4DDKA 1TGVA 1OD6A 4G1BA 3MUEA 1YT5A 2O3JA 3OP1A 4J75A 3UXYA 3C8HA 3DL2A 2XLCA 2Q0SA 3SF8B 3UK1A 3PL5A 3SZLA 5JNLA 1E9RA 4B7AA 3QWBA 1P2UA 5CPBA 4OQYA 4NX2A 3N53A 4M0UA 4P3XA 3U4AA 1CP2A 3VNAA 2AR0A 2FGJA 1OJ7A 2A0FA 2D5IA 2IYWA 2QRVA 2H2HA 2Y77A 2PSEA 3DM9B 4KDIA 4RYDA 3RK1A 2AD5A 2J9XB 2M1ZA 2RDMA 1BD4A 1MOPA 2W83A 3HEAA 3L4SO 1FBTA 3QKSA 4YV0A 3PC8C 4EFLA 1MO4A 5EIEA 2PK3A 2W2KA 2ZI4A 3ANYB 4MGKR 2CHGA 2DR2A 5B7QA 2IDJA 4ZQIA 3UB3A 3G13A 3VKWA 3ZCTA 1PN3A 1KIFA 1FFEA 3RLIA 1CW2B 4G67A 3F5FA 3RF7A 1XD9A 3SF8A 2GWHA 4PLFA 2P3OA 2AI3A 4BNIA 3TFOA 3BE5A 3IAXA 4JEHA 2JA1A 2WJ3A 1U9CA 2PIDA 4B09A 2Z5FA 1G1AA 1I3NA 1SVWA 3V7FA 5BNIA 4DB2A 2OPHA 4IVPA 2C03A 3ZJVA 1PK8A 1H8ED 3C24A 2TS1A 2WM9B 1NR5A 5K3OA 2VUIB 3MLAA 1C1YA 1O0BA 1P60A 1BW9B 5G40A 4D1YA 1SUFA 3V1UA 1GRCA 3C3PA 2EOAA 4KMRA 1UXHA 1ORDA 3UN1A 4AZSA 4DDMA 1A8UA 3N5KA 3PUHA 1MEEA 3IBSA 3IKTA 3PQ7A 5DSTA 5FOTA 2JV2A 2WAOA 3ZHUA 2P9ZA 2VRBA 4RY2A 2YBEA 1UC8A 4DE5A 2BUCA 1SEVA 4MARA 3BZUA 1KJWA 4A92A 3EF1A 2Y4OA 4CEIA 2QP3A 1T5BA 2RGWA 4D6YA 3CNOA 1L4BA 4OSPA 4RGYA 4JGGA 4I8DA 4WXMA 4PLPA 5C5EA 2HEIA 2OBNA 3FYUB 5CT5A 3COJA 1P7CA 3STWA 2IX9A 1MVNA 4OMCA 3FPTA 4DT1B 4BLPA 1YRWA 3ZS9A 1IM2A 4IJVA 2VO1A 2X2OA 5FOWA 2AMLA 1H65A 3LY8A 4LC9A 5CJ2A 1E4YA 4MUYA 3HJBA 3WXMA 3UV3A 5E4FA 5CLGA 3GJ5A 3LRXA 2Q49A 4MJ3A 1M67A 3VNBA 5F98A 2ZRBA 3EASA 5B36A 4JYAB 2I6SA 2JAHA 4KMSA 2TMKA 1XMJA 4EBBA 2NADA 2WTNA 4PCUA 5H9WA 3CLUD 1U99A 1EQUA 4RWZA 4EO9A 4EG8A 5H81A 3RTDA 3K9WA 1E9BA 4PYLA 3RM3A 3R0IA 2MR5A 2QJTA 2OYRA 4CGYA 5CXQA 4MKGA 2W6OA 3U62A 2XVMA 2QRLA 4KG7A 3K5HA 3LO5A 3X3HA 3Q40A 4JBYA 2WZCA 1A27A 3PEFA 4MDEA 1JQLB 1XQ6A 4TMTA 4D43A 2FDRA 3GUCA 2VWHA 4JVNA 4CKYA 1ECJA 2XIQA 3OHPA 4DR4B 1RKXA 5K4GA 1QXSA 1CZ4A 3V80A 1O5IA 1Y1PA 4OXQA 1V4NA 3K9CA 1AS2A 1LRLA 3EZ7A 4JUDX 5SYMA 1TYAE 3CRMA 2CB9A 1VRCA 4CIXA 3IELA 2BGWA 4BNJA 1IN5A 1H0KA 1KSGA 3IDOA 4HXGA 2P91A 1SCDA 5ISMA 2M32A 2Y4NA 2H31A 2LZ0A 5GM2A 4Q9LA 1ZSVA 3E81A 4BB5A 2A58A 1I80A 3R75A 2W2XA 1E59A 3KALA 3M3HA 4EJ0A 5ETJA 2QTGA 3JQ9C 4UE6A 3BJIC 4DIMA 1FQJA 1KGSA 3FLAA 4KGVA 5FADA 3AQIA 2VT6A 5BNWA 3K32A 2H85A 5ENDA 1E61A 1X86B 1W4RA 3E48A 4NOLA 4X85A 1JR2A 4MXDA 3T7AA 1NRJB 5EWLB 1HT3A 1CHDA 4M6WA 3ZIDA 4CF3A 2JRLA 1I6LA 4MA5A 2XUHA 1HEUA 2DFKB 5KVCA 4Y2HA 2ONCA 1BQ3A 2NZWA 2XSZA 2IPOA 1ZVQA 2WSYB 3DP7A 4OUDB 4KO8A 2OENG 3PQ5A 1GR1A 2B4YA 1DARA 1UZNA 5HM6A 3TB4A 4US2R 2QN3A 1EX7A 4WZZA 1CUJA 1MNQA 2N0SA 3NOXA 1C7ZA 1FB5A 3I01A 3TO5A 4X62B 2E21A 4KN5A 2OPBA 3FPAA 4LHVA 2I2BA 3LDGA 3MD9A 4MPDA 3LPLA 2GZ1A 4P4SA 3U5TA 1B1CA 2FHPA 1DX9A 3E9YA 4ZQBA 3TFWA 2G76A 4BS9A 1JG1A 3LNTA 4E3ZA 1J6UA 2HREA 3N07A 5H3HA 3REGA 2YW9A 2D62A 2QHXA 3AP2A 4U7PB 3S7TA 3ZIUA 4DSAA 3TE7A 2G5TA 3WRWA 2ASVA 4TSRA 1GGFA 1YHNA 5BOVA 4DJDC 3C6ZA 1P31A 1OWLA 5U9CA 1KU0A 1MB3A 1XPOA 2P41A 4NWIA 3DLAA 1YBHA 1SCBA 1FVFA 1HK7A 4ITVA 5K3CA 5B37A 3O3NB 3RS4A 1ZG3A 3K0KA 1J9ZA 1Q3KA 3BWYA 2Q9CA 3BSFA 5A3SA 3QG5A 3UMJA 1DAGA 4DPMA 4PINA 4D4LA 3AVOA 4N03A 1WHSB 1P4SA 1YFZA 3PFGA 3BS4A 3RTCA 1PZMA 2GXQA 3D7SA 4GP9A 4K2AA 3OOSA 2DWQA 1GYPA 1S2OA 2P6UA 5KNCH 1AQJA 2K2WA 4MVXA 3F6CA 1RAHA 4DUPA 1ZQ9A 3TBFA 3SC3A 4ISCA 3ZNQA 3RHZA 4QATA 1TM5E 4JSTA 3KKNA 3O92A 5H0IA 3NAZA 5CT8A 3CE9A 5J4HA 1PEAA 2AT1A 3VHXA 1ATIA 4RV5A 1E7SA 1FNBA 2HIHA 3L6OO 4AF6A 1ZA2A 4DAOA 4DLPA 3SY8A 5K01A 1P1HA 2BE7A 1I0IA 1UK7A 4DA9A 4R05A 1ZKDA 4ETWA 3OZVA 1Q14A 4MLPA 2Q2OA 2K4MA 4GWGA 1AT1A 4Z51A 1JTFA 2JH9A 2Q6TA 3GRCA 9ATCA 1XN1A 4Q7MB 3UPUA 2VDWB 2VDLB 1U9IA 1W25A 2P6MA 4IAOA 2VHYA 1YQWA 3BTSA 2X7XA 2OKGA 4YT4A 1ID1A 3DW3X 3LCCA 4A8PA 5MF6A 2E4WA 1OTHA 2DUUA 1XTJA 2I71A 3GFOA 1RTTA 3DOUA 5EFOA 5KYWB 4JAVC 1RC8A 1YQUA 1E60A 1BMFA 1CERA 3FWNA 1P1IA 2W2LA 3R41A 2AQ8A 3SOPA 4KWEA 3IH5A 5IC6A 5A5FA 3SEAA 1Z2CA 4EFNA 1PRYA 1HTWA 1Q16A 5L3RA 4N0PA 2WY2D 3SKYA 1REQA 2FEOA 3RAJA 1XP5A 5JS6A 4MUHA 4Y2TA 2IHZA 3ENVA 5L95A 5LIPA 3LBYA 5LZ8A 4FILA 4JQOA 3V8MA 1DX4A 2Y99A 1A4UA 4JB8A 4MRPA 5JCXA 2CNDA 1U8XX 4L5IA 1R9MA 2HTFA 3DE3X 5CFOA 1NIJA 1CNFA 2VF4X 1UDCA 2F8LA 4O1MA 2QT9A 1W0JD 1KZHA 4JVSB 3L4JA 1IUPA 3ONNA 1NURA 3CUKA 4UE2A 1L7MA 3DVQX 3LXRA 1HH4A 2QU7A 2SBTA 2BDTA 1R16A 2WU8A 1AURA 3BWVA 3HCRA 1X77A 3S5JA 1P29A 1QHYA 2MSKA 2KLHA 3HUEA 4CQJA 1DJOA 2BMDA 2J3HA 2V6MA 2P5YA 3ZKAA 2I78A 1M8GA 3L8MA 3IT1A 4N4AA 2VK4A 1GL6A 2E6KA 4NIMA 2IZ7A 1OFIA 2BR3A 2CNNA 2HCBA 2XH8A 1G5TA 4M88A 4ND8B 5GJVC 4D26A 1GKLA 1WSBA 3F4LA 1DZ3A 1QOZA 3CVYA 3GLUA 3LLSA 5LKAA 2O57A 2Q6IA 4PN7A 1SXQA 3HU3A 2RAUA 2PBLA 4IV0A 1GFSA 3VBEA 4AY3A 3C5VA 3LKDA 3KG2A 3TLYA 4JWKA 3PJFA 3TQTA 5LYJF 1IZ8A 1DOAA 3UMVA 2YXBA 4NJEA 4DQXA 4NZYA 3X1ZA 5ESWA 5JV5A 5IKXA 3CF2A 1Y3BE 4L50A 3ZW9A 1SC1A 4FYWA 3DOCA 3WRVA 3AUFA 3CNEA 3K9NA 1Y6FA 1QHXA 2F8SA 5DT2A 1N0HA 1XCPA 1MBZA 1R15A 5DGXA 1IOWA 2YJ4A 3OEHD 3QOWA 1OILA 4M0MA 4BNUA 2WWTA 4IICA 4UM9B 4CIAA 4RVFA 4HAOA 1XALA 3S2FA 1MOSA 4ZKEA 5LZ9A 2FWBA 2KPOA 2XBUA 2ZCVA 4BQFA 3D6MA 4DANA 2O8NA 1IL0A 5DYNA 4DCNA 5BVGB 4V2UA 3GDOA 4YAGA 2Y0EA 2QR2A 5JDCA 4HK4A 4S3MA 1BU5A 2O06A 5BQXA 3CVJA 5IBQA 3RT9A 2XZPA 4DDWA 2QTCA 1XFAA 1YCDA 1DOZA 3X43A 4K6FA 1I7QB 1P5JA 4P86A 3W5IA 3AOEC 1N8NA 3OOJA 4MRSA 2QYSA 1V6CA 4ZJZA 5BPHA 3MA0A 3DG9A 5KNDA 4FMPA 3DYBA 4MWGA 1JVSA 4DV2B 1JIQA 1TW2A 2VJQA 4LXXA 1HG0A 2B20A 4CCYA 2OSVA 5FIUA 3LW7A 4O1HA 2EFYA 5DNDA 3B2QA 4IS3A 2E4AA 5LDHA 4Y1EA 2C5EA 4ZZ0A 1T34A 4BNDA 4C4OA 4JX9A 3PVCA 3EZXA 1SAYA 2AUMA 1KI1A 1PT5A 1ZGBA 1I9CA 3LF1A 1TDJA 1J9EA 3E9MA 3OCZA 3SLGA 1Z0FA 4ONEA 2I66A 1MHPA 5CTAA 2E4XA 2IUYA 1U0BB 4B6JA 1L7DA 4BNFA 4M7OA 3JWJA 1UJMA 4HQOA 4D7AA 3KDSE 3K9LA 1DTEA 2QVZX 1G5FA 3HP1A 2ERXA 5DWDA 2CFOA 1I4EB 1SXHA 1XZNA 1YBVA 1NLFA 2CYAA 2WJGA 4BNYA 1QU2A 4JOBA 4N6NA 3CV3A 1RE0A 1CR1A 1XVUA 3F2IA 1GAQA 1KNQA 3EIXA 5H82A 3TS1A 2QQ0A 1OE0A 5K2OA 5AD1A 2UZ1A 4YAOA 4YV1A 4M0KA 2XTZA 2ZRAA 3SXPA 3GEGA 3M0EA 4J9UE 1IPHA 1GTSA 5BSKA 3LX4A 1C30A 3ZG6A 3H2JA 5KYWA 3IT0A 1H0SA 2F4VB 3E27A 4XFKA 4F8JA 2GPYA 1QCSA 4Y1RB 2MDTA 3OU7A 4IY1A 1JG6A 2GYVA 2O5RA 2LUOA 2YMPA 1JLSA 3G5LA 3NWPA 1GNRA 4PZUA 4KN8A 5CR9A 5JCPA 5A9TA 1SXIA 2W8BB 3I6ZA 4TVSA 2C88A 5JFTA 5JCJA 2BJHA 2V7QA 3EFBA 1JB1A 3NTQA 1IY0A 2J5XA 2RI1A 3NTLA 3QPWA 4V0KA 1V25A 2JFWA 5AHOA 4ARZA 1YCGA 2REBA 3L92A 5AK5A 4YAUA 1JIVA 3GDWA 3O31A 4L28A 3SZMA 4BFVA 2CLCX 2RMKA 3ZHYA 5HXAA 2G40A 2IYTA 2RK6A 9LDBA 2A1TS 1YACA 4YJ3F 4UAGA 1NVDA 3QRWA 2QR5A 4IDNA 1J00A 3UF0A 3DBLB 2O2IA 5JC8A 1LQTA 2VF8A 3FMIA 4M49A 4ZO4A 2HHAA 5EMJA 2DLNA 4PXSA 4U3JA 2QZZA 3HYCA 4CCSA 2SICE 2FWAA 2ID7A 1WNTA 2CK3D 4MK4A 5C0OE 1UZUA 1YA4A 3NFYA 4LJ5A 3KB1A 3PX2A 3EC7A 1DQSA 2ECFA 4A73A 4B6SA 3VNVA 1U81A 1U2GA 1KMMA 3FPGA 3KR1A 1QQTA 1XTKA 5JASA 4DMKA 1YAJA 3QJYA 4NCBA 1P2SA 4AIIA 2P2ZA 3BXPA 1VPTA 2VHXA 4OYYA 1Z35A 4GPTA 4R4JA 1OYVA 1QDLB 1BA2A 1UMDB 2G70A 2L69A 3JQRA 5LYJB 3HPRA 2Q3EA 1EDDA 4QPJC 2J3JA 4UW9A 3H9QA 4LFCB 2GI4A 4Z0NA 2PSHA 4L8GA 4TVBA 4R9UC 5I51A 1RYMA 2WSMA 3RIMA 3U31A 2KI5A 5B12A 4MCJA 5CB4F 3UJNA 4DLBA 2WHPB 1L7EA 1P0PA 1QMPA 2B2XA 3QA3E 3HDYA 5AJWA 1KYWA 2I9PA 4LDAA 3CRQA 1QTIA 3M4NA 3NBQA 3NM4A 2J48A 4K9DA 3FUCA 2CNBA 4W5QA 1TIBA 3C74A 4V3CA 1JSLA 1W1UA 3JQQA 3GCGA 3A28A 2PX4A 1QPGA 2KJQA 1OBOA 4PSDA 5BRNA 4URUR 3N0VA 4BUJA 1I2DA 1Z5NA 3GH3A 3BMCB 2C5BA 3RROA 1NI4B 1AHHA 3RUHA 2YYZA 1U8AA 3I53A 4FGSA 4KMOA 4POAA 1W46A 5ALGA 1E2BA 3R6LA 1D6JA 1YD7A 1ZW1A 2W6PA 1MDFA 1U2TA 2REQB 2YN2A 4EA9A 1J49A 1YB6A 5DEOA 3L9XA 4UXHA 1XMSA 4JYMA 5LZ7A 4C87A 3H42B 3VHRA 2GBLC 5AW0A 1T8SA 3U37A 3H2ZA 3Q1KA 4ZIRA 2IPNA 3DA8A 3DVAB 4ZEOA 1R00A 2L18A 1A8SA 2YOGA 1MPTA 2H3HA 1UJ6A 3U26A 2C2YA 4CCYB 1Z0AA 5IZ4A 1W44A 3E2IA 1P5FA 1AO3A 4E11A 2X0DA 3JATA 3T7EA 2P2NA 2PUWA 1CUSA 1IZZA 4RAOA 4JASB 3WRXC 3DDNA 4R6WA 4XRRA 4CUJA 4ZYYA 1TM2A 4WNIA 4QQRA 1CF4A 1UFKA 3HHEA 1GARA 2W2PA 4EBFA 5EJ6A 4KX5A 1PR2A 3NFRA 4RK4A 4EJSC 1ZESA 4CLRB 4BX0A 1DIBA 5JFOA 1JUDA 1O8BA 1RAGA 2BTQB 2OFPA 4ZVNA 2CVQA 1VCMA 1K3UB 2EHJA 2ZB3A 3D3EA 3F4BA 4ND3A 3H4MA 4B82A 1QBKC 1NDUA 4JSYA 2ZWIA 4WACA 1QHHB 1QUFA 3VR5H 2NV0A 1OBVA 3T4UA 4ARSA 3LLMA 3KUKA 4DCSA 4PONA 2GFAA 4EG5A 2J87A 4XX0A 2JFPA 5F12A 3DGEC 5HQTA 3O84A 4LG1A 1NI5A 1Z4LA 5AJYA 5BY2A 2NTEA 2PVCA 3EWAA 1P61B 3GFRA 4FCVA 4GE3A 3X1WA 4XR4A 2O8EB 1U0HC 2X14A 3ILXA 1YJ8A 3CUVA 1PJ3A 2DGDA 2BUAA 1D4AA 2C77A 4FHCA 3QF4B 4R3UC 4LYHA 1G2QA 1WJGA 4KVAA 1NQXA 2P2CA 3X44A 2I7XA 4PLZA 2YFHA 4ZHQF 1V16B 4BN4A 5BW8A 4LJ9A 1X42A 2OZVA 3AEYA 2JJ2D 1IUOA 3RVOA 4KU4A 1HNWB 2CB0A 2PKEA 2Z3VA 1Q84A 4MTCA 3CW9A 4ECEA 1DXHA 2D4HA 2QPLA 3A6ZA 1TTQB 3BWBA 2XCIA 3NWBA 3AR4A 2XUIA 4P22A 2PJZA 1SK8A 1WXIA 3DV2A 3BH7A 3DE0X 3EWNA 3DXYA 4RIGA 4R71A 3HBMA 3ICVA 3OESA 1JE0A 3WGOA 2ECPA 1ZIDA 2X8BA 2XCUA 4A0QA 1SVLA 1S8FA 2AKAB 1A7AA 4BQOA 1ZXXA 2OE2A 1GNQA 3NWEA 2IOFK 3ESQA 4LRQA 2Z2IA 4DL9A 4K9KA 4Q7KA 5TDHA 3VR3A 1PKEA 3BMOA 3IEUA 1KY3A 1R1DA 1BZYA 3H2YA 2IXBA 3KC2A 3PUJA 1SHUX 4HXEB 4KI0A 1CRWG 1JQ5A 1YR3A 3U3KA 2FWRA 1P2TA 2H54A 1SVIA 4W5WA 1V5GA 3SJCA 3ZQJA 2UUCB 2O0KA 5KJCA 5B6CA 4RPCA 1W5AA 2J33A 3ZGOA 2WWXA 4EVIA 3A0UA 1QV7A 4E1AA 2OR3A 2C9ZA 3EBOA 1UFOA 2AVNA 5BN3B 3U40A 5E6SA 4KRXA 4FLFA 5CB0A 1UPBA 2CJPA 3LGSA 2GEJA 1H2AS 1X92A 3T35A 2CVOA 1DWOA 3FPBA 4XUGB 3TFQA 4BO9A 3L0ZA 3DZHA 4RJIA 1PDWA 2WOOA 5CD1A 3DW1X 1L7NA 3ANSA 5BRJA 2VYCA 4MIEA 3L7DA 2PMWB 4Z4FA 3PQ4A 4AXXA 4FKBA 1E3SA 2PL5A 3OM1A 4HLQB 1S89A 3OPYA 5AOAA 3RS7A 1C7FA 4PS0A 5IJ0A 4L6IA 1QDUA 2XECA 1GQFA 1PF7E 1JU9A 2XA1A 3LD9A 4M7WA 1DAHA 1RWBA 1VPLA 1PQYA 1C4OA 1KERA 1GDHA 2V7BA 5A6SB 3PG5A 1TCBA 3PQFA 4H1HA 2JEZA 3FRJA 1KU6A 5MDHA 3H86A 1SVMA 4FYVA 4LE0A 1ZKMA 1PJAA 1PFVA 1HFJA 2YYAA 3O26A 4NJMB 3OFNA 5EI5A 4NS1A 4JXKA 2WUFA 2ZJAA 2IIPA 3NEPX 4QUAA 1S96A 2CW5A 1W1IA 1E0JA 1K75A 1D7AA 1Q3HA 2K7ZA 4IDQA 4R7TA 4V0QA 1QNFA 4UNQA 5AKXA 1N3YA 2G83A 5FRDA 4F38A 5KO2A 3AEQA 4I50A 4JQZA 2RBKA 3UWKA 1SNYA 2ZJ7A 3AETA 1PT8A 4G1FA 2GEFA 2PG3A 5KNLA 4C76A 1ENYA 5JD3A 2G9QA 4DR2B 1HLFA 1PBNA 1RDFA 5LQSA 1CUIA 4HZUB 4EP1A 1MTOA 3JAMA 4F6CA 4I08A 1XL1A 4KO4S 2AJCA 1LI7A 4H7EA 2IIBA 3SHWA 3TG2A 1D1QA 3OD5A 2ZUCA 3F5QA 3SVTA 4Z8XA 2EIXA 5K8UA 1SPBS 2H0QA 1SD5A 3OT5A 4Q18A 2GK7A 2BSAA 4ZZ1A 2F9MA 1NJFA 3QM1A 4KIJA 1YZNA 1BVUA 3WGGA 4J9VA 1NWHA 3PRHA 1FJXA 4RJJA 1SEPA 3BCHA 3DFIA 4YCDA 1SJ9A 2Y2VA 3PITA 2P6PA 1CETA 2ID8A 3GRPA 4BQQA 5J4KA 1EXWA 1AA6A 4L16A 2AN1A 1XXHE 1P19A 3H5TA 3QVGB 4UTXA 1ZR4A 1QIIA 4TZKA 1F17A 2VP0A 3LK7A 4W9RA 3DMTA 1K5GA 5A3JA 1TD1A 3I1FA 2VVTA 1SQFA 4OXIA 4JLVA 4ZVOA 3WKBA 3OCCA 2F00A 1UBGA 4QUGA 1L9XA 1AHNA 1NP3A 1FUIA 1PR0A 3OQVA 4LAFA 4P7JA 2NAPA 4TLLB 4HAXA 5IT5A 5LB4A 5AI4A 5DK6A 2O8EA 2R8BA 1ZZEA 2ZU0C 3O1JC 4NVRA 1CD5A 4MA0A 4PYKA 4FFWA 4D8UA 1P0FA 2J9ZB 4OH1A 4QOJA 1W2GA 1K2WA 2X22A 3I73A 3IQZA 3BX1A 4UPVA 5EY5B 1J2TA 3N8KA 1A8HA 2VH2A 3UH1A 1CUGA 3GLSA 4QE3A 4HFRA 2CMKA 3UJ8A 4QYMA 4MGIR 3U3MA 1JQEA 2FZ5A 3BL6A 4BZZA 4D9IA 3C4QA 1O4VA 5JPIA 4WFJA 1ZN9A 4EF5A 4CEIB 5K3DA 3CZAA 4WKPA 1JXQA 1Z47A 3OWOA 1GTZA 3IBCA 2FCRA 1V1JA 2I2FA 3KSUA 1L5QA 4JOCA 2H0RA 4TT3A 5L3SB 4MRAA 4D9HA 1DT3A 3AM4A 3ZKWA 1VB5A 5FWXB 4GLJA 5C3UA 3MGKA 5EPPA 3K2BA 3SIXA 2OZKA 3VZPA 1WXQA 5C7IO 2KBFA 1H6CA 1EJ2A 1KDPA 2J3EA 1BU8A 4GBMA 3SAJA 2AR9A 3B48A 1Q95A 3HCOA 1T0HB 4QHTA 1TIPA 2CFTA 3ZWWA 5GIPE 4CW7A 1K4KA 2ZSUA 4I6GA 3DQPA 5HUQA 4HNVA 2HNKA 4QWWA 4BAGA 2DFLA 2HU5A 1ID8A 2Q0HA 3GJTA 4XTCS 4R1OA 4US1R 4ENVA 5FOQA 2TMGA 4WBNB 2BFEB 2R8ZA 3DFKA 3VPBA 2PUDA 3MINB 1JHOA 2IS1A 2Q50A 1DXYA 3PFHA 2HZ7A 2MYTA 4GKVA 2VI5A 2XYRA 4CF7A 3GGCA 4G4IA 5BP7A 1MLDA 3AEZA 4DEVA 5E6SB 2WQ6A 2PL9A 4L76A 1USGA 2HA5A 1F7UA 3H7IA 3LY7A 3KXKA 4FHFA 1KE1A 1TE2A 1OXSC 1THMA 4X6LA 3RQSA 4U0JA 4H4CA 4JLWA 5ILQA 3GPLA 2AOWA 4NYMR 2IPLA 3UOAB 1MX9A 1Y7PA 4NICA 2BL4A 1VI6A 3RYHB 1VCOA 4EFMA 3WV5A 4BMZA 2GDZA 3FLEA 2EKBA 3OSUA 4OIFA 3OQOA 2ZYVX 1N7IA 1T2VA 3T7KA 3BRSA 1G4UR 1I6MA 3R7WA 3EVGA 3H1BA 4UXIA 1JS1X 1ADGA 1ORRA 3PENA 3SJAA 4OFWA 1NYTA 3L8GA 3H11A 2OXIA 1ADCA 5ABPA 1U3TA 2VZ9A 3THXB 1A88A 1UJ5A 1QS0A 2JFFA 3QNMA 2PYDA 1QOQB 4PZPA 5K0BA 4KXVA 1H8EA 3MZ0A 1XQYA 1VL2A 2XKKA 5UKDA 1OROA 2CJYA 3RIGA 2YHIA 5BVGA 1Q1GA 5SZKB 1QHSA 1DMSA 1Y4AE 1NBIA 4N7MA 4PYNA 2HPHA 1RWWA 3HFRA 4BKPA 4Z4GA 1TYCA 3ZHSA 4HRVA 1DEAA 1VYVA 4R1LA 4ZU3A 4E7OA 3O8LA 2HA7A 4DUGD 3BMNA 5KOHA 2I8CA 5LMCA 3MT0A 3QWFA 4NDNE 3V8EA 4BE4A 3DOEA 3EEOA 4FYXA 3MWKA 1XQ1A 2WU4A 4JUCA 1A9YA 1ZUNB 2Q6LA 4MMYB 4PG5A 4D8TA 2AJ8A 3H7AA 3T7RA 2B1IA 4YRGA 2ZYHA 3Q7IA 1ODFA 4P3NA 4U9HS 4MEBA 3OY7A 2JK1A 1DO0A 4G5HA 2XYHA 3EGDB 3IXLA 3PEEA 4KUGA 4YJFB 4DSNA 2CMFA 3IAFA 1LRKA 4HS9A 2QPTA 1CULC 1O58A 2ZBEA 3E15A 5JAIA 3IBTA 4RD6A 1B4DA 2JA2A 3VTFA 3KHKA 1CUBA 2IP2A 3BQBA 3HSKA 1V95A 4C7OA 4C4TA 2C00A 1K6XA 5HS4A 5IM5A 4KE6A 3UQYS 1L3CA 1PS0A 1JEYA 4PGAA 4PLGA 1FLAA 4XA8A 4EY6A 3FCXA 1TTPB 5JQGA 1QC5A 2B5WA 3AR2A 4X8MA 4P54A 3SHVA 2A1TR 3CF4A 4CKXA 3FUTA 3NIGB 3DWIA 4FS3A 2FWMX 2PM8A 2FI1A 4HFNA 1MGOA 4MUGA 1QG4A 3NWJA 2BGIA 4RV9A 3PPVA 4I3GA 1U94A 5DTQA 4CV1A 1KDRA 1N34B 1NUSA 2FKNA 4G5YA 1DINA 1DJPA 4JJ4A 1XD2A 4JLAA 5CLQA 1IXZA 1LU9A 1HZJA 3S28A 1D1TA 3ZDFA 1QVZA 2J6CA 2X2FA 2YMLA 4FE7A 1GGKA 3OLXA 4Q39A 3V7WA 1P7ZA 3T5PA 2XB2A 1UBJS 4BFSA 1TL7C 3OI7A 3V55A 4AP9A 3F5MA 3K1AB 5D8DA 1J09A 5DU2A 3FR8A 5HK9A 3NIFB 5BV8A 1SR8A 4YRJA 1XKTA 1K6EA 2E1RA 3MS4A 4N0MA 3RUFA 3RVMA 1SKMA 1II8B 1XU7A 4JXZA 3FYTA 3OCXA 2BI4A 4TKUA 4BBAA 1R0LA 2AW3A 4F1WA 1NBHA 3BMQA 4MW6A 2AYYA 4XWGA 4EUFA 1G16A 2J0VA 3INRA 1B3BA 5JBNA 2W48A 5K0JA 1Z2EA 1T26A 2DB3A 2HDOA 3WKEA 1SM4A 1TZ2A 4R1UA 5DNYB 4RFLA 5AJTA 3WA6A 3NVMB 3VU9B 1ELOA 1TVKA 3LLCA 4PPNA 2LKDA 4K5QA 5JXJA 1GUYA 1XROA 2QR3A 4XLLA 4Q7JB 4RMHA 5FBZA 3KLOA 1BH6A 1SXJA 2IT1A 2Q29A 3C5EA 3E53A 4X60A 3TMAA 2O14A 4LTDA 1B16A 3QFHA 2E82A 2I6FA 5FX2A 4XYMA 2EP8A 3A58B 4AJEA 2ZRIA 1C1XA 1OQAA 2P1ZA 2FG6C 3LRTA 4PZAA 3PEWA 4I2NA 4J7UA 3EA0A 4Y6OA 3DC7A 1FOEB 2C2WA 2JHAA 3EUWA 3W5BA 2EP7A 1H23A 1Y3CE 1YI8A 1O9HA 5I5GA 3DOJA 3DV0B 2CNOA 3M6MD 4XSVA 1QCDA 1IEQA 1SK9A 1YSCA 4FCTA 1JEOA 3PDWA 2AC7A 3IE1A 2YZKA 1KEEA 4MHOA 3ZEAA 2WPDA 1FZQA 1LPBB 1YB2A 4NAHA 4Q82A 4RSHA 1RQRA 2JIRA 4X54A 3F90A 3WIBA 3LC7O 4W9NC 5AVUA 3KETA 3FSEA 6REQA 1N8SA 1UIRA 2ZJYA 1GITA 4YN3A 1NU8A 5CA0B 4YCNA 1YS6A 1VZ3A 3VX3A 4YMLA 2AG1A 3CB4A 2WPNA 4NESA 3V8BA 2QN9A 1FFCA 5AVKA 3TTUA 4IIJB 5BPFA 1GRRA 1VP3A 3A1CA 1N5DA 3GVXA 4ILEA 4OQMA 2UYHA 1YFJA 4IINA 4UCQA 1H6BA 4OJNA 1M1YB 4K9RA 4YO8A 2C9BA 1VMKA 2ZAGA 3R4CA 3PWSA 4M4SA 5A9SB 5KNBH 4ARZB 3H17A 2G28A 2F43B 1E4EA 2FN8A 3CR3C 1E5XA 3WJAA 2HK9A 1JJ7A 1R2QA 4MW0A 1Z2OX 3HS3A 1EVIA 3ZWNA 2Q4OA 3W6PA 1KKLA 4G4SP 2H1RA 4X3OA 3TWOA 4LF9B 1TMGE 1SXGA 4J0DA 4X1OA 1Y1TA 3VKUA 4I46A 3ETDA 3CH6A 4FD3A 5FBVB 1M6HA 2VUTA 4Z9XA 1LUAA 2WE8A 4F3CA 4ZT3A 3WK8A 1XRQA 3ZLJA 1FRFS 3DHWC 3ECSA 1HSOA 1THZA 3B89A 4JWTA 3CLRD 1TUGA 2BHTA 3GJ4A 4V39A 3Q5GA 3EPKA 3HU2A 5DWQA 2NVUA 3FTDA 4MLDA 3VPGA 1O95D 4GG1A 2HT6A 3L6CA 3IP1A 2EJVA 1V9SA 3RRJA 1TUIA 3U16A 1KMIY 3E5MA 3CGWA 1SHJA 2YHAA 2EJCA 3OO1A 5EQFA 4O3FA 3TBHA 2O2XA 2XMSA 3D81A 3U9SA 1A76A 4NFYA 4DB4A 2IYQA 2DTXA 2NSJA 1WPXA 1MJ5A 2PX5A 2ZRPA 3A6HA 2A86A 3FDZB 2LPMA 2HA4A 3N05A 4UM9D 2NPOA 4MV7A 5EYPA 4RVDA 2R68A 1G6HA 4E12A 5KC8A 1NY6A 1WMAA 4TYYA 4AN0A 3IQEA 4I1OA 5F21A 2PZMA 1K06A 1PSDA 2HPVA 1US8B 2EFEB 4BEBA 5K7SA 2GK3A 4GBGA 3B70A 4KQ1A 5IYZF 3VM6A 3P2OA 2IJGX 4O08A 2IY8A 1KDVA 1SHKA 2IZOA 2HLPA 1PJ4A 4QEDA 2V7PA 1UBKS 3K4PA 3LZDA 2XRFA 4ODIA 2QAGC 3RREA 2Q0XA 5L3QB 4CM4B 1KS2A 3C3YA 3FNGA 1BFKA 1E98A 4YAKA 2CJWA 3MUFA 2M6LA 1Y5IA 1SD1A 3RHTA 2C31A 4UD2A 4PRYA 1RLJA 3G2OA 2QORA 4XGRA 4ENQA 2EU8A 3ASZA 1HDGO 3CS3A 1NVTA 4MVJG 3IEXA 3PCRB 3L2OB 1QH9A 4U8HA 5IBRA 3H2SA 4J4HA 3Q8WA 1OX5A 2IIVA 2PU5A 4DQ0A 2DCMA 1NNI1 3E2MA 4OM8A 2ESRA 4HDSA 4J0CA 1RS0A 3GLFA 4J1TA 2OO5A 4TV8F 1QGAA 4CKZA 2FLVA 4Y9DA 3EVNA 3B20A 4P7GA 3T3PB 4NHEA 4DLVA 3CUWA 3OMLA 3OZSA 2FQYA 4LJ7A 4X5OA 1A96A 4CL3A 1YQXA 1P7WA 4LRTB 4MP8A 2QW1A 2FPIA 4A26A 1LD3A 5IMSA 4Z7OB 1X7YB 1ZCZA 5GONB 3ELDA 3K2IA 4MDYA 2JFZA 2D2XA 1H5NA 1ADYA 2BTOA 3LUAA 5FOSA 1XL0A 1KO5A 3N5CA 4GPBA 1FQKA 1Q6ZA 4C01A 1PDOA 3DZFA 1HKUA 5E8JA 1TVKB 3HN6A 4WXYB 1TYZA 4ZO8A 2B4RO 2YWJA 2PZAA 3ZBUA 1Q2UA 3JD3A 3PNQA 4PGFA 1PR3A 4RIEA 3D4PA 4OQNA 4XGIA 5KDDA 1XCMA 5T3YA 1POWA 5AIAA 2GJ9A 2V55B 4RHUA 3NTOA 1TYBE 5IC5A 3PHJA 3K8OE 2H1VA 5KOIA 5EIFA 1V11A 1Y48E 3D6UA 3WZLA 3V1MA 4FEGA 5EQJB 2J5QA 1V4VA 3EIOA 3U4IA 5IVDA 5JXIA 3NDPA 3T1YB 3A14A 5BR4A 1K2VN 2X86A 3GHYA 1HFWA 1P3JA 2WA1A 4L5AA 2O0JA 2V5VA 4CBVA 3MWGA 2DX7A 1JR4A 2WFLA 3Q85A 3LVFO 3GGPA 2F3SA 2QX8A 1DOHA 1ONSA 3ANLA 4OXYA 1UBLS 2ATEA 2CUKA 1CR4A 1EPUA 1Q7GA 2GN1A 3QPDA 1I01A 4IH4A 4TS3A 5LBTA 4UUQA 3D3KA 3UM9A 1NBMD 4LXTA 4BFCA 1JKMA 3ZLTA 3WP0A 2NQTA 1Q0PA 1QYDA 2V5AA 4K1XA 2RAPA 4DDUA 3UGKA 4GAEA 4DMFA 2ZJ6A 4BLRA 4B83A 4EL0A 3HYLA 5C46F 1GXSB 1SKQA 2HWXA 4G26A 3S3TA 1PHRA 3W2FA 1KOGA 2Y05A 4C2TA 4I8XA 3ML1A 5A3QA 1I24A 1KSHA 1L7RA 2CKMA 1GTG1 3UHPA 4D0NA 5M2QA 1PO7A 1KF0A 1PWEA 4FR2A 3OZTA 3GRYA 1JXMA 2A3RA 2H06A 3HRHA 4AMVA 3ZHQA 4LK3A 2YIJA 4R81A 1ZONA 1ZQ1A 2J5BA 3I42A 3WWDA 4D0RA 5I45A 2K5UA 2GZMA 5EWLA 4GZMA 4BPRA 1M8PA 3AEQB 5DHFA 5LSAA 2NXJA 1IUNA 2IXTA 4M3NA 3IMEA 3UB4A 4EIWA 5LQUA 4H60A 3C3JA 5IDWA 3EIQA 3NIDB 4IYRA 5B4VA 2DBQA 3L7OA 4AKSA 2OZPA 4PC3A 4C3VA 1BDIA 2JVKA 4IH1A 3S8MA 4OYHA 2R6CA 3EULA 2I54A 4X84A 3I5XA 2BKLA 3VUFA 1QHGA 4Q34A 1BC5A 4ZN6A 4BWVA 1KZYC 1T91A 2NYAA 4J16A 3NTRA 2H2IA 2Z0MA 4RPHA 1GPAA 3P9XA 4ZPJA 5DNUA 5B3LA 4D56A 2ZIXB 1E89A 1MX1A 1E1LA 4MW1A 4GUAA 2BFBB 2SCUB 1DJLA 3FTEA 4HBZA 4NMLA 1FFAA 4KH0A 3H2KA 3LPAA 5E9AA 1TECE 1AN9A 4ZT5A 1KGDA 1CQIA 1NVKA 2N9UA 1XK6A 4DRZA 3FSRA 4TUYF 1ZUNA 3KZCA 3BT7A 4HQKA 3OFSA 2ZZNA 3BXEA 4YV7A 2WD9A 1QV6A 4RK1A 2R5WA 4EI9A 1N0WA 1DHRA 2I67A 4C03A 1K7FB 2FN7A 3DVLA 4G0YA 3GEPA 2PXCA 1WUTA 3AWDA 3DBIA 4IWXA 4WLFA 4TSFA 5CYPA 3ZYZA 3KQUA 1T3GA 2R1UA 1GTVA 3W1VA 2NP6A 4BZWA 3BQNB 2WIFA 3DBHA 1G66A 3BRQA 3PHHA 4X9XA 5DTJA 1G8HA 1DXQA 3D3WB 1R9NA 3A1NA 2X4LA 5I8PA 1Q57A 2I1QA 3EZNA 1JDSA 3OQ6A 4TVOA 4HL6A 4MKXA 2GPNA 3W04A 4B3SB 2CNWA 4L5YA 4UM8B 2DLCX 1QHHA 2VQ6A 4WBNA 4QAQA 5EHZA 2GQ0A 5IN5A 4JQYA 4D41A 1YOVA 4W4TA 4GMDA 4B6GA 4AUMA 3QPCA 4C43A 4R9RA 4MVWA 2QLLA 3MTAA 5FYQA 2WC1A 3CRW1 4AJNA 5CM9C 1RHQA 2GO7A 4X3PA 3KNZA 4JVOA 3K8QA 1KARA 5F9MA 3QENA 2F1OA 3P9KA 3P97A 2WG1A 5AKHA 1RC0A 3FCOA 3O8QB 5CH8A 1QG6A 2GPWA 1U4NA 3I12A 2Q9BA 4NPCA 1ZMXA 4YDQA 3L0DA 1KEPA 2QM3A 4UXJA 4DMCA 5TJ9A 3N8HA 1T36A 4RF5A 4K6HA 2FFHA 3BZWA 4Q00A 4TKLA 3ZE6A 2WWYA 1Z6XA 2HF2A 3GVHA 3KT6A 3H4IA 4PSKA 1KI8A 5A5GA 3RS8A 1MABA 4K6GA 4K81B 4GL2A 5F5XA 4UU7A 1AUOA 4P2GA 4BC0A 1YXMA 3TJMA 2O8FB 4YCMA 4H7JA 1IPFA 1USVA 4H0NA 3WLEA 4B79A 4WOCA 3BIOA 1UT8A 2YZGA 2VAPA 4TMVA 4EMBA 5KSWB 4GPEA 4M55A 2VS1A 2ADMA 1NP6A 4TLBA 3PYXA 2NUPB 2GXSA 4KLCA 4WK2B 5LD2C 1PVOA 2XUQA 5C8ZA 4YYZA 2I3GA 3EK2A 3GUYA 3BMOB 2ASEA 2HPAA 4M21A 1QCCA 4JBLA 1EAYA 4CLHA 3D6JA 3KYCB 5JNTA 2QXYA 2V96A 3QMWA 4ZFNA 4EHHA 3K09C 1U1EA 1P7PA 3AB3A 4I2VA 4B6OA 4DLKA 1OFVA 2DETA 4G0VA 4YCAA 4HNTA 2Z5GA 3CONA 5AM2A 1DI0A 2JFUA 5AQ1A 3ER6A 1Z0SA 1T10A 2GNPA 3DT6A 1U8TA 5IJZA 4LF7B 5M3BA 1BCRB 1XCLA 2QVLA 5IKEA 4MR9B 4ABYA 4RHFA 5DH9A 3WGNA 3PNVA 3UHAA 1TD9A 2BPOA 4IHJB 5AOCA 4HNQA 2ZIZA 1AOXA 2PH3A 2VBIA 3C2QA 3W7BA 3WMGA 3EIEA 5KUTA 2PWYA 1U8YA 1UMBB 1T0UA 4IV8A 4AG3A 1OLSA 3T9DA 4YIHA 1T2CA 1JIIA 3UUEA 4E2XA 1XQVA 1K8QA 2VHUA 4PQEA 4WXRA 2WBLC 5GM1A 2GH1A 1HKHA 1ZOPA 4F85A 1OV4A 1YR8A 2B82A 3QZUA 3GFSA 1Q50A 2PDAA 3NRBA 2MIIA 2ZRJA 3MD0A 5DCUA 2IW1A 2YHBA 1EVQA 3TOXA 4V0ME 4UDXX 1XNQB 2ZSFA 4WCVA 1QHEA 1U98A 1W75A 5J63A 4MUBA 3U39A 1T4BA 4TSFD 5J1SB 1Y8RB 3NBUA 3DZGA 4E09A 5SZJA 4G86A 4GP7A 4KYIB 4G9EA 1IBLB 2WJJA 5GP1A 2ZANA 3DEYX 4L02A 1LTKA 4H1VA 5A4AA 3G17A 3IODA 2AW5A 3GD7A 1VGQA 2VUHB 4OHKA 1H6AA 3Q7PA 4PTZA 1X9GA 3TQCA 1F0NA 2Q2VA 4NZ9A 2B4TO 3SYTA 3S99A 4DTCA 2JNWA 3HKEA 1VHLA 2GYWA 4FCCA 1ZIXA 3TRKA 1OFGA 2WHEA 4CMBA 4K6OA 3IXQA 2X0EA 5JH7B 5JSFA 3SJ7A 3T9CA 2I2AA 5KNBA 1ZHOA 3NPAA 2VHEA 4QPPA 1KJIA 4Y2PA 4QNNA 1L3IA 1JKXA 3R0XA 1ODJA 5LL6P 3C3WA 3QV2A 1YVPA 1D6MA 4IIDA 3FCEA 5G2OA 1R5OA 4DIOA 1E7YA 1GDDA 2BM1A 4AROA 2EJUA 4MA4A 1QTNA 3TNDA