1I9GA

Crystal structure of an adomet dependent methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
264
Chain Sequence
TGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN RV2118C
publication title Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1i9gA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i9gA02
1RI2A 2WA1A 3LDGA 5DTQA 2P1DA 3FTDA 4HC4A 5F2KA 3TKAA 1Q0TA 3I58A 4OX9Y 4DMGA 1BHJA 4PWYA 4PCLA 3ERCA 2PX4A 1VE3A 3A7EA 4ER6A 2G1PA 3LDUA 3LKDA 2KW5A 2P3QA 3G2OA 4IKPA 3G5TA 3AXTA 3T7SA 2IH5A 3DXZA 3LPMA 2PVCA 2G72A 3R6TA 2C7PA 1SVUA 4FSXA 1BC5A 2BR5A 3HCBA 1XDZA 5LQJA 2G8NA 5CM2Z 5K0LA 3REOA 1L3BA 3VC1A 3OZTA 2N47A 5DTRA 4FR0A 5EZSA 2Y1XA 2CKDA 3TM4A 5CVVA 1UWVA 4CKBA 3OFKA 4OQEA 4LWOA 3KPJA 3BWCA 3EEYA 3I9FA 3T7TA 3T7RA 4K6MA 3EVGA 3UWPA 5E8RA 4HGYA 4PIMA 3KU1A 3M70A 4H0NA 3SVZA 3PVCA 3TFWA 4PGGA 5DT2A 4YV1A 5K01A 5D1HA 1SQGA 3JWIA 5D1NA 4A6EA 2JH9A 4GF5A 4R8SA 3QOXA 4KIGA 2XVMA 3GRVA 1VLMA 4KWCA 4ATNA 4RX1A 5ICEA 5EQJB 2HMYB 3HVIA 5HEKA 1YF3A 2G71A 2DULA 2I6GA 5LQUA 3HVHA 3KQOA 2ZWAA 1G55A 3Q7EA 4HTFB 5DM2A 2UZ4A 1JQ3A 1KYWA 2I7CA 3ANXA 1AF7A 4P7GA 9MHTA 5CVDA 3PLAE 2OPBA 4CTJA 5CCXA 4QDKA 5DM4A 3OPNA 2OZVA 3ER9A 3CC8A 3EMBA 2B3TA 4QDJA 3GRZA 4RTNA 3LHDA 3P9KA 4O29A 5HILA 4PNEA 3SGLA 4WVLA 1D2GA 1M6EX 5EEGA 3M6WA 1XJ5A 2P35A 1EJ6A 1ZG3A 1XDUA 3OZSA 3GRYA 5LQRA 3EGVA 3GGDA 7MHTA 1VBFA 5K0JA 4FT4A 3CBGA 4Y30A 2AVNA 4PYQA 3TQSA 2YX1A 4FT2A 3SMQA 2XVAA 3OU7A 2XYQA 4GOLD 3E7PA 3PT9A 5E9JA 5H02A 4E70A 2UYHA 1R8YA 4PYOA 4CXMA 2FHPA 3FUWA 5GP1A 3X0DA 5DXJA 4BLUA 2HR1A 2BM9A 4E2YA 4FP9A 3OU6A 3RODA 5K0CA 4P7KA 4RWZA 3G7UA 3HA5A 5BXYA 2FK7A 2O57A 3I5UA 3M6XA 5C1IA 4EK9A 5FHRA 5B1SA 4P7JA 4E30A 1I4WA 1P1BA 4B17A 4M7RA 2JHPA 3B5IA 4X1OA 3VSEA 4E31A 1JTEA 1Y8CA 3FZGA 3SSMA 3MGGA 5DSTA 4RTOA 5EMKA 2AOTA 2PV0A 2Y1WA 2IIPA 2I62A 2QRVA 5GIOE 4HG2A 3OCJA 3M6UA 3LL7A 2V7EA 4UOEA 3NVKI 3MQ2A 2FK8A 3LDFA 3MCTA 1N7IA 5KQSA 2PJDA 5GWXA 3DMHA 4E2XA 3G89A 1RJGA 3KQVA 2R6ZA 4L7VA 5E1BA 5LQNA 5EPEA 5FUBA 2C7RA 3HEMA 2ONYA 4BY9E 3HCFA 2YXDA 4XCXA 1X1CA 1X1BA 2FPOA 5EIWA 5DX0A 5ICFA 4X60A 4BLWA 2VS1A 4MHTA 4RTKA 2AOWA 1AV6A 3BGIA 1SUSA 3P97A 1JG4A 3P2IA 4M38A 3NJRA 1G8AA 3LBFA 4PYIA 2OYRA 1NW7A 1U2ZA 1NV9A 3L8DA 3EEOA 2HWKA 8MHTA 1QAMA 2PWPA 2FRXA 3B3JA 2ZBRA 3A7DA 3UJ8A 1NBHA 5EG5A 4ER0A 5K0GA 2ONZA 4RTJA 3O4FA 2Z6QA 2AOUA 2ZIEA 1O54A 1EAMA 3DP7A 3FPEA 5E9WA 1FPQA 5FTWA 3TOSA 1ORHA 3TR6A 3H2BA 4F85A 4RTLA 2EX4A 5K0BA 1NW8A 5E9QA 4M37A 2P41A 4IWNA 4CKCA 2F8LA 3GXOA 2B2CA 4ER3A 3CKKA 3EVDA 5GIPE 1V39A 1F3LA 1QAOA 3K6RA 4PONA 4PYMA 3BT7A 1YZ3A 1VIDA 3AWIA 2ZW9A 5LR6A 4AZTA 3NMUF 3WSTA 3O7WA 3ELWA 3GO4A 1EJ0A 3DMFA 4MQ4A 1EQAA 5CUQA 5EEHA 3IEIA 4QTTB 3F4KA 3KQYA 4PYJA 2PX8A 3PB3A 2PBFA 4QVGA 1ZHFA 3JWHA 1AQIA 5GOZA 5E1DA 2ZCJA 5T67A 3ELDA 3ORHA 3EVFA 5FA8A 3G8BA 2O06A 3HVJA 2IDKA 3S68A 5HIKA 2VP3A 2ZWVA 2DPMA 2FCAA 1MHTA 2YVLA 1KPGA 3M33A 4G56A 4E32A 1FJXA 4QPPA 5EHIA 5EKXA 5FQNA 5IKMA 1KXZA 5T64A 3ER8A 4C08A 2IBTA 2ZIGA 2HTEA 1VPTA 5EMJA 4CKEA 5GM2A 1IM8A 5K05A 1N7JA 4YMHA 2ZZMA 1TPYA 5F2OA 1NKVA 4QVKA 4RTRA 3JWGA 1WXXA 1P39A 5DPMA 3CJTA 1SUIA 1G60A 3DLCA 3KQMA 1XXLA 3MTEA 4QQKA 2BR3A 3FTEA 3GNLA 2PXAA 1SG9A 2AN4A 2OB2A 4ISCA 5DSXA 5LQKA 2CWWA 1KPHA 5CCBA 4OA5A 4U7PB 5HOQA 4OQDA 2G70A 3P9NA 4RSRA 3UA3A 1YFLA 4QQNA 4GEKA 4AUKA 1VP9A 2AN5A 3OFJA 5U4XA 3KR1A 3HA7A 2OB1A 1X1DA 5EC8A 3A27A 5E8JA 3EMDA 3P9IA 5FWAA 1Z3CA 2ZLBA 3HNRA 3MAGA 1L9KA 1BKYA 4ZTBA 2GH1A 5FWDA 2OXTA 3HCAA 4ER5A 1SKMA 4EQZA 3DXXA 2NXEA 5CD1A 5HIMA 4A6DA 4EKGA 1PRYA 3FUTA 3VYWA 1D2CA 1WY7A 1KHHA 4GOND 1JSZA 1IXKA 2B78A 4E33A 1NBIA 5C0OE 2GLUA 4HH4A 3SR4A 3UZUA 3LBYA 3UJCA 3HCDA 3KQTA 3TRKA 1P91A 4MIKA 2GB4A 5C9ZA 3UJDA 2Z6AA 3G2QA 4BP1A 2GAFA 2OO3A 4PYKA 3LCVB 3G88A 3DULA 5LQCA 3HA3A 3UA4A 1L3CA 3DR5A 1JG3A 3KQWA 4FS8A 3TMAA 4YUXA 2Q41A 3EVBA 3MCZA 1ZGJA 3OZRA 3RW9A 3GU3A 1WXWA 1RJEA 1WZNA 2QM3A 3C6KA 3OE5A 4RTPA 4C03A 5E2BA 4KDCA 2CMHA 3NVMB 1RJFA 3TPZA 2ZULA 3GWZA 3I64A 2OKCA 4RTQA 3KR2A 4MWZA 1QAQA 4PYLA 2PGXA 5K03A 4Y2HA 5EVJA 2WK1A 3I53A 5JUWA 1XTPA 1WG8A 2O07A 3E23A 3ELUA 3IYLW 2NXJA 4RVDA 4POOA 2NNWB 1RI4A 1QZZA 4XUCA 1KP9A 3FPHA 4FSDA 4LWPA 1DCTA 3MERA 1JTFA 2H11A 2AS0A 5E2AA 2XYVA 4RVFA 1JQEA 3BKXA 2JJQA 3KPYA 4LECA 4C05A 5BW4A 3DXYA 3SSNA 3BGVA 2H00A 2BZGA 2PX5A 2QRVB 1KYZA 2PXXA 2VDUE 3DOUA 4C4AA 4EVIA 3E05A 4X41A 3B3GA 4Z2YA 3THSA 1UFKA 2ERCA 3THRA 1YB2A 2ZBPA 1B42A 10MHA 4AX8A 2GS9A 2PSSA 2XYRA 3HCCA 3R0QA 3CJRA 4DQ0A 5K0NA 1P1CA 3BKWA 4GQBA 3SSOA 4E2WA 4C07A 2HNKA 1M6YA 2OBFA 3V97A 1N2XA 5F2NA 3KHKA 3R9XB 4YMGA 3UJBA 5GM1A 1XDSA 2AOXA 4QPNA 4YUYA 5CVJA 1D2HA 3GJYA 2JH8A 3C3YA 3KPWA 2IPXA 3DLIA 1WS6A 3KKZA 5GINE 4YV0A 1RI5A 2ADMA 2FYTA 2UYOA 3NWEA 5G02A 1TW2A 1VQ1A 4CWAA 3GIWA 3KR9A 3LGAA 3FYCA 2AOUB 3PFGA 2YR0A 1YUBA 3U81A 2H1RA 3AXSA 1VP3A 1KR5A 5DXAA 5E1MA 4NECA 4GOOD 4PIPA 3P2EA 3T0IA 2PKWA 5EHGA 3FTCA 1L1EA 5EGSA 5IH3A 2ZTHA 3UJ6A 2XBMA 4AZSA 2GPYA 2AOVA 3MB5A 2EJTA 1RJDA 4OBXA 5HFJA 4DF3A 1MJFA 2PT9A 1YZHA 2CL5A 3EVZA 3P71T 3P8ZA 1G38A 1M0EA 4IV8A 5DX8A 4V0RA 1I9GA 1SQFA 1T43A 4RV9A 5KYGA 4P58A 2B25A 1NT2A 1G6Q1 4HGZA 4YUVA 1R74A 3DMGA 1FP2A 3PX2A 2JHAA 3KR0A 2AR0A 3QOWA 3ELYA 3SM3A 1R00A 2YUIA 4HRAA 2K4MA 2ZZNA 2ZVJA 3A26A 3K0BA 4LG1A 3HVKA 2P3LA 2IH2A 3AJDA 1R6AA 4WXHA 5DM1A 3SXJA 1L3IA 2C7OA 2NXNA 5EZQA 5BW5A 1TW3A 5K0EA 3B7PA 1HNNA 1NW6A 2ZBQA 5K09A 5HIIA 1DL5A 2PX2A 1NE2A 1AQJA 4F86A 4GOMD 3EVEA 2LD4A 3FPJA 5DWQA 4AZWA 4DZRA 3A25A 4KW7A 2UYCA 4R8RA 2NP6A 2YTZA 4PCAA 5CVUA 3DUWA 3PX3A 1BOOA 4BLVA 3LECA 3FPFA 1EG2A 3OU2A 2VDVE 4OA8A 3FRIA 3PTAA 4FGZA 3NDIA 2V74B 3FUUA 3Q87B 5EMMA 1KPIA 2AVDA 3LSTA 4QTUB 4HTFA 2CMGA 4YUZA 5ICCA 4RTSA 3LX6A 3BWYA 2IH4A 5DRYA 4GBED 2ORED 2P7IA 3SX0A 3KQPA 2Z6UA 4X63A 4AZVA 3OE4A 3C3PA 5HIJA 2JG3A 4IV0A 5DTMA 2IDJA 5EKUA 5LSAA 1R8XA 3IV6A 2QE6A 3KPUA 3CVOA 4OBWA 3NW9A 3RIEA 3DH0A 1HMYA 4C06A 3UBTA 3MHTA 3TKYA 1O9HA 2PT6A 4RYLA 4C04A 1ORIA 3HTXA 2A14A 2B9EA 2IFTA 3EGEA 4GC5A 3BWMA 3E8SA 3G2PA 4DCMA 1DUSA 2O0LA 2YXEA 1NW3A 4DCGA 5DLYA 1QYRA 4DKJA 1QANA 3C0KA 2NXCA 3G2MA 3TM5A 1NV8A 4GC9A 1KIAA 3A4TA 4DM3A 4F84A 4R6WA 5MHTA 1ZKDA 2QYOA 4U7TB 3HM2A 2P40A 5ERGB 2ZFUA 2P7HA 4XUEA 1ZGAA 3NTVA 4KVZA 1IY9A 1ZQ9A 3UJAA 1F38A 3GCZA 3FPGA 3PFHA 5ICGA 1FP1D 3B3FA 3CCFA 3HCEA 2NP7A 4YUWA 2PY6A 1G8SA 1OR8A 1X1AA 1XCLA 2AN3A 2EJUA 2P3OA 1I1NA 2JHCA 1JG2A 2PWYA 2I9KA 3EVAA 1YFJA 3VC2A 3O31A 3FUXA 5FULA 3LCUA 4EKIA 2HV9A 4YV2A 2BM8A 4GUAA 4KDRA 1RI3A 4MTLA 4JXJA 5FADA 4PYNA 3JWJA 3EVCA 5CVEA 2ZIFA 3FTFA 4DA4A 5DRTA 3G5LA 1VL5A 4RVGA 3CJQA 4P7FA 1UIRA 1H1DA 4HSGA 4ER7A 5KS2A 2AOTB 3ME5A 2VDWA 3QV2A 5EOVA 4E2ZA 5K0FA 3M6VA 1RI1A 3IHTA 3C6MA 3M4XA 3HP7A 3BWBA 3LCCA 5FHQA 5DM0A 3UJ9A 5M5BA 3B89A 4PINA 5FA5A 1XCJA 3P9CA 3EPPA 3GDHA 2BH2A 5JR3A 4FZVA 5EMLA 5CIYA 3D2LA 4KRGA 1R18A 4X61A 2GA9A 3UFBA 5BP7A 2R3SA 3KPVA 1JQDA 3R24A 4M36A 2YQZA 2UYQA 5LQAA 1JR4A 3EGIA 2PXCA 1O9GA 2OY0A 2YXLA 3KQQA 5HZMA 1JG1A 4RTMA 3FYDA 1X19A 2ESRA 3NDJA 5K8VA 2O05A 1Q0SA 1FBNA 2IGTA 5EIFA 3BXOA 2P8JA 3GRUA 2VZ9A 3TLJA 4R05A 1EIZA 3NWBA 3R3HA 2IP2A 3LKZA 1INLA 4BP3A 3UJ7A 1JSXA 3BUSA 3BGDA 5P8WA 2ZZKA 3KQSA 5KQRA 3GRRA 2PLWA 3P2KA 2C7QA 3PS9A 3DTNA 4XUDA 4CTKA 3G8AA 4V0QA 1NW5A 2WA2A 3MTIA 2NYUA 4PGHA 2IBSA 2BR4A 5KVAA 3FRHA 5E1OA 4EMSA 2EFJA 1PJZA 5T6BA 3CGGA 2AZTA 2E5WA 3V8VA 3ID6C 3BZBA 1XVAA 2ZSUA 3AY0A 4KIFA 4RVHA 2QY6A 3FUVA 5FCDA 5FQOA 5DX1A 4R6XA 2EG5A
chains in the Genus database with same CATH superfamily
2YZ7A 3A9TA 4JGGA 3FVQA 4HDNB 3ZDBA 3GEEA 4C0QC 2Z2KA 5JO9A 4BC0A 1E9DA 1GO2A 2EQAA 3GJQA 2PX4A 4M8SA 4PCLA 2CDCA 4DRYA 2C4KA 1N1EA 4H4CA 3QF4A 4PSAA 1Z4QA 5EUBA 5IH7A 1DX4A 4UOZA 2ZAOA 4AQDA 2YDYA 4FSXA 1C2YA 1EBBA 2FUEA 3I2KA 3ZBTA 4C29A 4YWHA 1OC2A 2E9SA 1J39A 2C0CA 2HDHA 2PEZA 4R54A 4E1AA 3DZBA 2M32A 2HU7A 4B75A 2PZLA 4LJLA 3AEKA 2SNIE 4WHMA 4H3KB 2Z2JA 3RK0A 3S2FA 1C9KA 2HSGA 4MRAA 4OB6A 5J4YA 3GN1A 4WV3A 4PW0A 5C7OO 1C0IA 5JXIA 4FLEA 2WSBA 5DNVA 2QN8A 2QP3A 1X1QA 3AHIA 1TD1A 1DEOA 3PSAA 2RBEA 5FBWB 1ID8A 2W2TA 1PR3A 1TZCA 3R3ZA 2YY7A 1UBLS 4H77A 4OGGA 4RACA 1LZLA 3OMXA 3K9CA 3N6VA 4DABA 3W6UA 4Q48A 4F4FA 2VUSA 3GP3A 2G9RA 4D6XA 2O6LA 3CG4A 3LPCA 1EXVA 1K6MA 2PQ0A 1KERA 5CEEA 3P52A 5KU1A 4MDHA 3KQOA 4CMIB 5KTOA 1G66A 5JTUA 5DM2A 2PHZA 3OLZA 2R65A 3RJMA 1WDWB 1TQ2A 2VZEA 4GSKA 3V2GA 3WQQA 2DX7A 4CM4B 5JEDA 3O1LA 1NNI1 3IAM6 3QU5A 1Z0ZA 1KY5A 3IIEA 4JVOA 3H4TA 3CC8A 3DVLA 1JU3A 2B3TA 4I55B 2ZG6A 3PNYA 1HYQA 1QF9A 3B7WA 5GZ6A 3WKDA 3EMKA 1F51E 3O21A 3P19A 4XSHA 5SYAA 1L6IA 3EF1A 1DRWA 1CLUA 1JU9A 2GD6A 2PO5A 2ZYVX 3KDSE 2NU9B 4KGZA 4BX3A 1XJ5A 2ANBA 4GMDA 3KU4A 3DA8A 1XDUA 4L15A 4P5DA 5A9RA 1RVV1 4NARA 2JIZA 5ALTA 4YPFA 2JFGA 5EP2A 3IL2A 1K6EA 4OHUA 4PYQA 2XCLA 1Q3HA 4ZD6A 2CN1A 2EW2A 4OF4A 3WRVA 2IHKA 5J5AA 3UICA 4OJTA 5AW0A 3ZDQA 1WW3A 2CUNA 3N0WA 3ZVNA 1YUMA 3JYNA 1Z7EA 1IWOA 3BAFA 5TXGA 5K0CA 1JYSA 1ANKA 3NNSA 2X1HA 4I50F 4MV4A 1QIGA 2J09A 4YP1A 5DW3A 4D4KA 1XZMA 2AMJA 2RB4A 3JAWA 1ISGA 1M2JA 5JQGA 4FMDF 1E1MA 3ICCA 1YV9A 2JHPA 3FKJA 5JBIA 2Q7XA 2VYVD 4FILA 2BFMA 2HT6A 2PH3A 2BGRA 2QD2A 1MH9A 3R7WB 4HFNA 3SSMA 1LV7A 5B57C 1HLFA 1JILA 3MUNA 5EMKA 2NTEA 2DP4E 1N6KA 2WKSA 4M1TA 3NM4A 3WRWA 5K3BA 3NR2A 4D3YA 1BMFA 2P77A 2PAFA 1QO9A 1DU4A 4H3HB 3NVKI 4BAGA 1L7EA 1FNBA 3MCTA 3VSAA 3G2NA 1HT2E 4JUBA 1SZJG 3DMHA 4V39A 5GWXA 3RK4A 1GGVA 4X7PA 1QIMA 3EDMA 1OSNA 5DYGA 1Z0SA 3CHYA 4N5HX 3CNLA 4CV1A 1Z18A 1KMNA 1VLHA 2WIDA 4N54A 3QEOA 4ND7A 2B8JA 2OYSA 1U1GA 1VIYA 3BD8A 4IDAA 4JLWA 5AO9A 5J2TF 4B9EA 2HY7A 3SN6A 4OLAA 4IVNA 1TQHA 2VNIA 1QLHA 1AV6A 1JG4A 1E9VA 2A6PA 2ZRNA 3GGSA 1U2ZA 3LXRA 3L8DA 4LHXA 2YIDA 3UJ8A 3I4LA 3A7DA 4JU9A 4YS6A 2R5NA 1DKLA 5ALDA 4UHKA 5KINB 4GZ3A 4BNDB 4RNCA 2HA2A 3JX9A 4DYDA 4XRRA 3KYBA 3O3MB 4G8BA 1YK1A 6REQB 4IWNA 4QNMA 2BI4A 5EPUA 4XW2A 1Q1NA 3K0SA 2HRBA 2ZT5A 4FJ2A 4X7RA 5EZ6B 1AKYA 3BCSA 2IYLD 4X1YA 3WBKA 3MIZA 4R5MA 5FRDA 1WB4A 2F9LA 3PC8C 4MVJA 1BCSA 1FUEA 3HJCA 4FHFA 1Z73A 4B31A 3UK0A 4RH1A 2IDMA 3D6NB 3IUSA 3D7NA 5D3MB 4BS9A 2OM2A 2YL2A 1AQIA 1V8DA 2AFIA 1FK8A 1QPBA 2O7VA 2YYYA 1EZ4A 2W6ID 3EWAA 5ALRA 3LUHA 2O06A 1GGJA 2XIJA 4FMPA 4DDTA 2J5RA 3DQQA 3N07A 3O73A 1MHTA 3C87A 2HRRA 2RKWA 3MN1A 4IRUB 4AP6A 1FJXA 1VYUA 221PA 4C0BA 1QVVA 4ARCA 2XVYA 2YV2A 1RT9A 2NQ8A 1NMSA 1Z5GA 3BYZA 5AQ1A 4DV7B 2BWJA 1U8AA 5AOAA 1HFJA 5EMJA 2BYTA 4BE4A 2X13A 3OESA 3RUIA 2QDXA 2BGUA 2XEDA 5A3QA 4GR9A 4Y9TA 3PQ2A 4KV9A 2FMIA 3N8NA 3QF4B 2Q3HA 2K5UA 4OAPA 4LRTB 1SUIA 2GZRA 2QDKA 2QMYA 2NYAA 1G21A 4NVRA 3QY9A 2PXHA 3AOEC 3AHHA 4K9NA 4DR3B 3H9QA 3SICE 5AM3A 1Z6AA 3WGZA 3HR8A 3DKVA 4ZPJA 1SVOA 5DSXA 4IVQA 1AKTA 2C8JA 1Y8AA 3VTFA 3HU1A 3CT6A 2A0UA 2HMUA 1P4RA 2FF7A 1BOFA 3K0EA 1UPUA 3VV3A 1OXKB 1GPKA 1PR9A 3GFTA 1VP9A 4D3ZA 1L4UA 1KI7A 1N9GA 3S99A 2EKDA 1L4FA 1Q1AA 1UPBA 1OWNA 2PIAA 3A31A 4IINA 4JY7A 4CV3A 3ZGXA 3E7WA 2P4SA 2OV2A 2PRJA 3IA2A 3OX1A 1HGXA 4JDPA 3F71A 4MVJM 3MRVA 3ZI4A 1F9AA 4ZCMA 5BQXA 2VDRB 3RWOA 2GHRA 3CIOA 3KVOA 1SR8A 1GD1O 3A3NA 2J6BA 2BELA 4MROA 4WN9B 2P4QA 1AQYA 3QNUA 3NFYA 3GJ7A 1NHGA 5EYPA 3D5TA 2ALJA 2YFYA 4DMUB 3IESA 2VUTA 3SAJA 1XZ8A 2I6QA 4UATA 3QVVA 3TDMA 4KJZA 1NWHA 4OIFA 1J2TA 4HQOA 5EHZA 4U7DA 1M1XB 1VCHA 3KJFA 4HQLA 5G1PA 3RAFC 2OCXA 3K0CA 5IF9A 1Z08A 2FCRA 1JI0A 1KJ8A 2GFQA 2UZIR 3P9RA 4IEIA 1PBNA 4GKBA 1AQLA 3MB8A 1PJ3A 2BUCA 5FPKA 3DR5A 3SLKA 4YUXA 3AM1A 1I7LA 2Q41A 3EVBA 2FB9A 4IF6A 1YJBA 1ZQ1A 1WXWA 3MF4A 5G4KA 2VHCA 1ZMOA 5E2IA 1Z2DA 2POQX 1UDBA 2H7YA 3DZKA 4QOEA 5GY7A 3UVEA 2B1IA 1T2NA 3WMFA 2PWZA 2JCXA 2VHQA 2OGZA 2PQMA 4URFA 4GR4A 4NBTA 3S1AA 3L3BA 3BD6A 4MWZA 1QAQA 3AONB 4JB2A 1KI9A 2IEYA 4QXAA 4Y2HA 3PLRA 3M1IA 1IRIA 1IMJA 4S3MA 4YROA 2HMTA 3ANMA 4LSZA 1HDXA 4EELA 5JI3E 5JUWA 1YDWA 1KK0A 2PMWB 3B82A 4EBBA 1AQ6A 2Y9PB 1KK2A 1OIWA 1QZZA 1Y7LA 3QVLA 2WQ7A 3OZXA 3EAGA 1S2IA 2R4QA 3H0CA 3JAWB 1YDFA 3OHMA 2O7NA 4FSDA 4XUCA 2NAPA 1JTFA 4ZEVA 3RC3A 2EL9A 2ZKLA 2CE7A 2JANA 1VKRA 2RGBA 3KZMA 1Z5PA 2QT9A 1WSAA 2XCSB 2PFGA 3DXYA 3TX2A 2WHPA 1FYEA 2M1ZA 1NVXQ 4GW3A 3PNBA 2K87A 2DUWA 3OUTA 4G0OA 4UTRA 4MKXA 5I51A 1G3UA 4ZOEA 4R1NA 4IXMA 3ESAA 1LC0A 2W9XA 4DC9A 1YRBA 4QX6A 4D4IA 1FTQA 2R11A 3QEAZ 4EUKA 4FINA 2WWWA 3NXSA 1BTOA 2QJOA 3PYLA 4QUDA 1N2XA 3N5KA 3HGQA 3PHHA 4ON9A 4ZVMA 4G4JA 5JCOC 5DWDA 4H16A 1UOQA 1DWUA 3GJYA 3OFVA 2I6TA 3ZDZB 1WCXA 1YKFA 4V1CI 5DNWA 4MRMA 5CT4A 4MQEA 4I3FA 1WS6A 1DO8A 2VCEA 4HNAB 1W2WB 4UAJA 5EP4A 1ODKA 1NPTO 3MJSA 4NICA 4XLZA 3NWEA 3P1JA 3H1PA 4M0LA 4PSUA 5TPZD 2ASVA 3CX4A 3NHSA 4OQNA 3T3PB 4CWAA 2H8KA 3QEKA 4UM9D 3LU1A 3ND9A 4H6WA 3PFGA 3K0FA 1WQ1R 1YUBA 4OSOA 3ADCA 2IYFA 3PA8A 3AUYA 4PU0A 2B7CA 1CJKC 1YE5A 2PKWA 3ADKA 1TL7C 1XELA 4E6EA 1E1RA 2Q6TA 2VT2A 3MINB 3A9RA 4A5SA 4AKIA 2FSVC 2HA5A 2QT0A 4DBLE 1YUNA 1EYZA 3UMFA 2CL5A 3EVZA 2XEXA 3ENWA 4X1YB 1JR3E 1V8BA 3EUWA 3NEYA 2BP7B 4OHXA 4LN1A 3DAHA 3OEWA 4NBUA 4RV9A 2H2WA 4BJ1A 4GR5A 5IJ0A 1OBOA 3EWNA 5C34B 1BXKA 1ZCFA 4L85A 5IX8A 3R7FA 1E2GA 1SQ6A 1WNFA 4BWFB 5JAUA 1U6KA 2B34A 2D3WA 1BCSB 3UHJA 4WAUA 1ELOA 4OV6B 4PHTA 4CT4B 3S1LA 1X87A 1GGKA 1WZ2A 2ZB7A 3C14C 3IEUA 1VPWA 1O0CA 3HVKA 5HWSA 1DMSA 5LP1A 1KZ6A 3FYSA 5J4VA 1DG1G 4K46A 4JA0A 3ZU2A 4E7OA 5LZ2A 4U1RA 1E4EA 1Z2PX 3V8BA 2WYWA 3I5MA 2O7QA 1KQPA 4BHTA 3L4JA 1DL5A 1AQJA 3LRTA 4BCBA 1T5IA 1F2TA 3WMGA 1XMJA 1CDZA 1QO7A 1KZ9A 2QQEA 3HDGA 1Y7PA 4H1TA 1JSCA 4TXMA 2UUAB 1A8QA 1HG0A 1U1DA 2WZCA 3PX3A 5DB4A 2Q1XA 3M5CA 1LRJA 3G68A 1RVDA 5FPSA 4B35A 5BW8A 4MCHA 2O0MA 1TZKA 5AOVA 1TK3A 2DG2A 2Y2VA 4IDNA 1H6AA 3NUZA 4LXHA 2KE5A 3PTAA 5EXEA 1KVUA 1RKVA 4DV2B 4G5XA 4R8LA 4MEAA 4JMPA 3S7TA 1G21B 3CM0A 3PDHA 1QX4A 1E2BA 1UADA 1Y4AE 2D74A 3DEJA 3MS2A 1CY2A 3PQCA 4R9VA 1G8PA 3LX6A 2JIOA 5LU8A 1A4XA 4YMUA 1X8JA 3TXYA 2RAPA 1S8FA 4QTXA 4RETA 3TXXA 3LX5A 1EP9A 1TJNA 3KEFA 1DJOA 4NATA 4WVFA 3GP5A 1UQUA 1WXIA 3DZ8A 1YJQA 3KYCB 1B00A 2FPXA 3CQ9A 3D3EA 5ARDA 1KSGA 3DDHA 1JKMA 1XRLA 2AYYA 1DBSA 4A23A 1XT6A 4RZUA 1ETHA 1QJCA 1G8JA 3C5EA 3EGEA 1MQSA 3E8SA 4KKVA 4K28A 5CIQA 1W88B 1XNHA 1NW3A 4DCGA 2P2ZA 5DLYA 1QLWA 4AY6A 1N3BA 3QTTA 1T3LA 2GPAA 2VAXA 2V1XA 2JLYA 4LOIA 3OCYA 3PFBA 2FPKA 5IJWA 2QYOA 3HM2A 1CB7A 5EYPB 3TN7A 4QT4A 3H4IA 3U3KA 1FCJA 3A36A 2YBEA 2QAJA 1HH4A 1NI4B 1F38A 4BASA 2JJMA 2P1ZA 3LNTA 4IIVA 3AL2A 4ZA2A 5JAZA 4KX5A 5ENVA 2G04A 4ABYA 1H4VB 2BLNA 4IDHA 3EZYA 1RZRD 2HU2A 4V3CA 3QHAA 5L4SA 1PK8A 3QHQA 4MNTA 4DM4A 1ZD3A 1H93A 3UWOA 3H75A 4NYIR 5DHFA 3N2EA 4M8KA 3ZPXA 3PFCA 4PG5A 3AVQA 4A26A 2IWRA 1KNQA 3HZOA 4NHOA 3LKVA 4AO8A 5JYDA 3F5DA 1XN4A 1XZKA 3IPRA 2CHGA 4X00A 2HHHB 1CX9B 1XZLA 1E79D 1X70A 3QPVA 4G0QA 4TM7A 3DLTA 1MO5A 5CH3A 4MWOA 4FMBB 4HVLA 5K0FA 5K3EA 1D6SA 2J5XA 4TZTA 1UMDA 2WJJA 4HX5A 4D44A 4X7BA 4JKIA 1F1BA 2KB0A 5HW0A 5KNDD 3D8UA 3CO0S 2QU7A 5BRAA 2X8WA 3LCJA 1ZCAA 4NSNA 2VK2A 13PKA 4A4DA 5IM4A 3ZQUA 2BH2A 2GVNA 2GAIA 3TO5A 4KR7A 1D5CA 4AS1A 1IUPA 4QYXA 1KO5A 1MA3A 3G23A 4IJ5A 4V0MA 2HFKA 2WHPB 1QK5A 2CNNA 2PUVA 3VM6A 5DSZA 5LQAA 3JQRA 4N8DA 3L79A 2OY0A 2NVOA 3LDAA 3SNKA 5F5LA 1N6RA 3FLBA 5AR1A 4RELA 3D6UA 4BV8A 1FBNA 2QY9A 2VSOA 1ZD5A 3ASYA 4ITUA 4D46A 2VZ9A 1I4EB 2R62A 4F91B 1EIZA 5CURA 1O0SA 1QYIA 4M53A 4B3FX 1JEQA 1TF2A 2Y4NA 4DM7A 5IHXA 1QOPB 1T9CA 2HNAA 3O2JA 4XWGA 3BULA 3VZDA 5FFFA 1ICEA 4MRMB 4FGWA 3HP4A 1K7FB 4I0WB 5AM1A 2DWPA 3H1BA 4BEWA 3VR6D 4EDHA 3N8IA 1RS0A 1JAXA 3NHWA 3R5JA 1XA4A 4PGHA 4RY8A 4XASA 5FWXA 5ADWA 1OE0A 3NAGA 4EJ0A 4E08A 3AIKA 1RAIA 3GAZA 3QMVA 1T8RA 1IN6A 2HRCA 3AF0A 1R0BA 3TTVA 3DE1X 4O8ZA 1AXEA 2A9KA 3OO1A 2BGIA 4R6XA 4FFNA 2BI7A 1NSTA 4ASUA 4YJFA 2JAQA 5T41A 1TQDA 3FTDA 1I1OA 3AV0B 1KYTA 5F2KA 3TNFA 4JFAA 5C1OA 2R79A 4PWYA 2XYPA 2DQYA 2AX3A 3AR8A 4FFWA 1QIDA 2AN1A 2RI6A 5DWVA 3QVOA 3LKDA 5AI5A 3S6JA 5IJ0B 4DV4B 4RO0A 4NYJR 3CSDA 4JJKA 2C7PA 3E5HA 3EPKA 4DV0B 1B6RA 3MSXA 4JV5B 2E6KA 4EYOA 3URKA 2C2ZA 4GL4A 3H04A 4QREA 3WGKA 5JD4A 3AHFA 5AUQA 4ZI7A 2ZBDA 3D7LA 3TRDA 1Z5VA 3C3CA 3RS4A 4ZCPA 2XQGA 4YXWA 1PBTA 3EZ2A 1ZGHA 2EATA 2J6IA 1RE1A 1KI1A 2VP6A 3MWGA 4K9MA 4L02A 1FYWA 3H2KA 4Z0TA 5BRNA 3SVZA 1F8FA 3LOQA 4FFRA 1MB2A 2ZSBA 3H2GA 3A06A 4LHVA 1USGA 5CITA 1NDUA 3S2ZA 5HZKA 1QCYA 2HA6A 2P90A 2Y71A 1R8QA 4NEHB 3WZ2A 2HAEA 2A94A 3DNPA 5GV7A 2VEOA 2RGAA 4BP8A 1WE2A 2DFLA 3KYIB 4I6JA 1MH1A 2W2LA 3JYHA 3SBDA 1AUPA 3VC1A 3FZQA 3ETLA 1J70A 1G55A 2KPOA 3H9BA 4S2UA 4UHHA 4Y2PA 4BO6A 4BVFA 3K8ZA 3ZZTA 3UBMA 2V6JA 3NBMA 2GCGA 2H1VA 4ALKA 4QKQA 4WFQA 3V6MA 2DJIA 4RCVA 3HYLA 2NV0A 2QTLA 2YHSA 1NUQA 3QG1A 5CP8A 2J46A 4O4HA 4B46A 4CDRA 3KQKA 3FCYA 1D5WA 2P1RA 2FWNA 3OZBA 2H06A 4N49A 1GA6A 1CUVA 4KLNA 4WVLA 2E5FA 2IPLA 3FMPB 4KPUB 1N0VC 1W0KA 4O2AF 4YONB 3VAYA 4QUHA 4TLDA 2D0PB 4N9QA 1VBFA 1S8NA 2Q3FA 3DQZA 5BQ5A 4CTNA 1M2OB 2YX1A 3KXKA 3KOWA 4FT2A 3AU8A 3L43A 3OU7A 3HN2A 3QKSA 3NM6B 3NYRA 2F2TA 4JR0A 1JHXA 1R0CA 3L1KA 5F52A 3C6QA 4DG9A 2WFAA 3FYUC 4FKMA 2QR5A 5CXUA 1TM2A 3KXIA 4B73A 3HA5A 4EUFA 2O57A 1Z5OA 1DEXA 5EN4A 2IUTA 3O1IC 1DC3A 2JLCA 3OC6A 1A9YA 1OFHA 3MEQA 1PZHA 3VU9A 2IXEA 4EAQA 4X66B 3DG9A 4LNAA 4TMWA 5CB4A 2FMKA 3HXQA 1IULA 4QASA 4QNRA 1C1XB 1WKVA 2J9ZB 1TRHA 1JXAA 2FZ5A 1XC7A 3I2JA 1U8FO 1GZDA 4TUYB 1U9CA 2Z57A 1PYGA 1M1UA 2BFEB 3WOVA 4LV5B 3ZTTA 5I8WA 1ZN9A 3GYGA 5TQVA 2OZEA 4DV5B 2V0CA 4GGPA 3KQVA 3K09A 2R6ZA 1F6BA 5EPEA 3L40A 1MDFA 5FUBA 4P84A 1PUJA 1UMDB 2PTGA 2QL7A 3IMCA 3H8SA 4JOQA 1LLFA 1QHSA 2IX3A 4MDYA 2ZAMA 4FLFA 3VC7A 4B7CA 3K5PA 4M9ZA 4AK9A 3RC2A 1FW6A 4KXVA 5A03A 1XYVA 4PAMA 1RHRA 4PYIA 4RXMA 2RHRA 4WXEA 3R75A 1HDGO 1L4MA 4IDGA 3RASA 3ZBQA 3WB1A 1F8GA 3B3JA 3QG5A 4TT3D 2XH8A 4HO1X 1MAVA 2XXBA 3H3XA 3PVZA 3AVOA 3ZGNA 1T1SA 4ZV9A 4Z5XA 3GDGA 3REQA 1V11B 4EJ6A 3H2BA 4RU1A 3GGCA 4JL5A 2JRLA 1NW8A 1SCJA 1PZNA 3W7BA 1QQBA 4LV6A 4YAOA 3BH0A 4HOYA 5F1YA 3ZQ4A 1BEUB 1EVYA 1EXMA 1UOPA 1ZK3A 2WM8A 2OQVA 2MJLA 1N6HA 2O23A 1XHFA 2WYIA 2H07A 3HB7A 4EFDA 1JEQB 3DT8A 1HYHA 4JJFA 4R9RA 5BPHA 1YZ3A 4K0RA 1DXHA 4B7XA 1RYZA 2RFLA 1G18A 5EKSA 3UCXA 3GO4A 3CRQA 1GXSA 2V4ZA 3FMIA 2G28A 1Z6TA 4MQ4A 1FU4A 4H1WA 2OO5A 1JE0A 1T2UA 3GT4A 1S96A 1IEWA 3ECSA 4JJ4A 2P6UA 2JA1A 1DBRA 2OT3B 3C1TA 1RAHA 4QBIA 3J80A 1IY8A 3VR4A 3DKIA 3EVFA 4WWHA 1ZGZA 3EOZA 3HCWA 1NJ8A 1KEZA 4TV9B 4UNQA 2Y6VA 4LMRA 3S68A 4BMVA 3EZ6A 3RRJA 1Z2OX 2PFSA 5HDBB 5CMLA 3UNXA 4J0EA 2DAPA 4YJFB 4ZOBA 1KMQA 1IQ0A 2F8MA 1GUZA 3JASA 2ILTA 4DQVA 4GS5A 2ZJYA 4MKFA 1FRVA 2YN0A 5DN6D 1EVLA 1BE6A 4W4TA 2UXCB 3EF0A 4IX9A 4TTAA 4GGOA 2VJMA 3CIFA 3LE8A 4J0FA 4BU1A 2RC6A 3YASA 4ZOLF 3CJTA 1L8QA 3WK7A 4L28A 1GFZA 1JL3A 4WJLA 2BV3A 4LXGA 4YRCA 2CSXA 4PV7A 4Q4JB 4KYTA 2AR7A 4ESVA 3GNLA 2QTWB 3VO8A 2AN4A 4J1QA 5AJZA 3F6BX 4L7QA 4LOHA 1NY6A 5K99A 2QX6A 3OQ6A 1OXMA 3AHEA 2PZFA 1RWXA 2ZITA 1KZ4A 2WAOA 1P1JA 2BSXA 3G1WA 4H17A 1D7AA 3CZ4A 3PPWA 5TX7A 4AULA 2GDJA 1BJRE 1QU2A 4F06A 4LOJA 1Y9JA 1G1AA 4JMLA 4O33A 2GN1A 2II6A 2WJYA 4LRXA 1MN6A 2JGJA 5T8KC 1MVNA 3C7CB 5CH5A 2J3KA 1JAIA 1LBIA 4RZ3A 1KDTA 1V8PA 1YJAA 2XE7A 3PCTA 1J22A 1V8FA 3DOOA 2EKQA 5C46F 3Q8LA 2OHVA 5IDVA 3HXKA 1VKHA 2E2WA 2H85A 2QLFA 3E3NA 1DFHA 2H3EA 5C1PA 2Z8XA 1E0SA 1IB6A 2PU5A 4OFBA 4GOND 4G2NA 1YI8A 4IZOA 3V1MA 2IEAA 3OE7D 4CIYA 5KCZA 4DLYA 3OO0A 3N6RA 2O0HA 4UMFA 1YHZA 1I2BA 3OM9A 4YQZA 1X7HA 2BHNA 4JS0A 4GRAA 3UJ3X 1DARA 2WFLB 1J20A 3GG2A 3LAWA 2GB4A 1U0JA 4NAHA 5B2EA 2Q6IA 4UVDA 4JI4B 5AHWA 3AHGA 4OU5A 1P44A 5EIAA 4B81A 3U4HA 3ETGA 3ZI0A 3LZ6A 3G88A 5LQCA 3K31A 3NOQA 3TLMA 3ONEA 5HFNA 4ZAGA 3R4CA 1SEVA 3OJOA 1G20B 2QM3A 4XD2A 2B0JA 3IQEA 5IBQA 1XROA 2HJVA 1KY4A 4ZK2A 1HFWA 4IIFA 5CFQA 2HPVA 5JE8A 1IEQA 3LW8A 4Z0HO 3ZWDA 2ZTLA 5ALXA 3QLVA 3DDWA 3OCWA 3VH2A 4KQEA 1DOHA 5HTKA 4EZIA 5FOSA 2WG2A 3LPAA 1O8CA 1YRHA 3E7DA 3ELUA 2IS6A 3ESYA 5ALNA 1D1QA 4IGFA 3MBOA 2DTEA 3DW3X 2QNBA 2ZJ3A 3G2LA 3ZNNA 4MCIA 5PNTA 4A82A 1JS1X 4DR6B 3QPDA 3VU9B 3U09A 3CPHA 4P34A 3WE7A 3ZJYA 2AS0A 1NW9B 1SG0A 3DUFA 3RVMA 2NUBA 1MGPA 2EFEB 1PT7A 1U8TA 2OMKA 5CB4B 2W93A 4FGKA 4G85A 4X6LA 4DTCA 5AVUA 3QPUA 5HF6A 1WQ3A 1BFDA 3TLZA 2LWIA 2ZBPA 4D5EA 3ADDA 3F5MA 4AX8A 1VLVA 2JJ1D 4QD3A 4C0WA 2CXTA 1EMDA 2GJSA 4R51A 2HSEA 1JA9A 1P1CA 3KK0A 3LWDA 4FI3F 3GDFA 3T4PA 2WMOB 3DTVB 1UXKA 3V8EA 2QK4A 2ZAYA 5HUQA 1GRRA 3KHKA 3T1NA 1Z4IA 1OXTA 4BJ6A 4RY0A 1GAXA 1SHJA 3BHMA 4BCCA 3WYNA 4I3GA 1XZDA 3L0CA 2WDPA 1F7VA 4DIEA 1HMPA 1SWWA 3HS3A 3C6ZA 3AP1A 3ZTWA 1TW2A 1J42A 5BO5A 3QPCA 2GBPA 3RC1A 1EXNA 1Q20A 2FWMX 3REQB 3TZKA 1JLMA 2H1RA 2Z2YA 4PX3A 5E1MA 5B3AA 2O8BA 4LRQA 2GZ2A 5IUJC 1CQZA 3OEYA 5EKTA 3M1LA 1WOMA 4HAYA 5CFPA 3I9V6 2AOVA 5JJ5A 1IN1A 5IUNC 4WY8A 5L4LA 4BNNA 4BFYA 1VSQA 3HMQA 3E7FA 3A6DA 5JAHA 5TC4A 1N75A 5DEIA 1UMCB 1USWA 1ZL0A 3TQOA 3WK8A 4A36A 4EG0A 4H08A 3U4CA 2VJAA 1SGWA 4IZ6A 2DE0X 2QX7A 3DMGA 3NT2A 4KZKA 3SEAA 4ZQGA 2EU8A 4J7AA 4DLSA 1EUYA 1XMPA 4MJ7A 1BU5A 1NMEA 3KUCA 2IYTA 4OK3A 2CJPA 3PICA 1QXSA 3K0BA 1XTZA 2CXOA 5IVDA 4GPD1 3WHIA 5I4BA 3SXJA 2D2VA 3A2LA 3PQFA 1TZMA 3AVUA 3FFTA 4EQ6A 2XB8A 1ZS9A 1O96A 4DZRA 4YJHA 2HXSA 2QROA 3H87A 4J2HA 1NM5A 2WMYA 1V1RB 5IC5A 3ZBPA 4I55F 4LBYA 4J1NA 2VJMB 4YNBA 3EASA 4Z51A 1PJ2A 2GK3A 3C3MA 2C2WA 2DPGA 3H5VA 3PDJA 2WSSA 4AWBA 4B76A 5L4NA 1Z4MA 1MZPA 2GBFA 3DFFA 5FBLB 4OHPA 4WZAE 3RKRA 1QP7A 1YR7A 4ZARA 5A71A 3T34A 3FFWA 3JVIA 1YO6A 1E1NA 3LT4A 1HQCA 1TEVA 4C7XA 2X0IA 4X63A 3H18A 3H2SA 4BV3A 4C88A 3MCVA 2BFBA 2O8EB 2FMXA 2LBPA 1I4TD 1NGSA 2QRZA 2P6PA 3BQNB 4HPWA 4L4SA 4OK5A 2Y68A 3K2IA 1M2VA 4Q24A 3GUYA 5BOVA 5A3VA 3RIEA 3NJ4A 1PJQA 3S2UA 2QUBA 3H83A 4PEVA 4BKQA 3M6MD 2Q5QA 1I10A 1TVKA 3R3UA 2QW8A 4UC0A 1OIVA 5EJEA 1DSSG 3GWGA 4KN8A 5KKAA 1XV5A 2FEXA 1T9GS 2CV1A 3VDQA 1DAIA 4O4IF 3UK7A 1JHZA 1KP2A 5KYTA 1JYFA 3I5AA 5FEMA 4WK2B 1U94A 1S2GA 4BU0A 4QYIB 3OD5A 3JZAA 1P8JA 3B3AA 1E9CA 3G1UA 3CEMA 1E64A 1E4OA 3EW9A 3OP1A 4NU0A 1LJUA 3IVMA 4K8OA 4NL4H 4YUWA 1B2LA 4IWXA 4JKOA 4Q1VA 5D7BA 2CB0A 4DBVO 4QHTA 1XB2A 1S3SA 4ZOCA 3ZWNA 3NHRA 2O20A 5KTPA 1N2SA 2P6RA 2O8DA 2WUFA 1XMXA 4DCCA 2HUNA 1Q1QA 4GHWA 2ZWMA 5U4QA 5JW6A 4B83A 2H63A 1XHLA 5LXTF 5AVRA 1BO6A 3AYZB 3BRWA 2WC1A 3G02A 2CL0X 4IIHA 1U1CA 1H2EA 1TA4A 3E03A 4K88A 5EP3A 1RLJA 1BGWA 3SYMA 3TCNA 1CR6A 1M1ZA 3JQGB 4GM1A 5CX4A 3NPAA 4GZ6A 2HBZA 4FFPA 3ZUPA 1QUFA 1DBIA 3I8SA 4I4NA 3VR5H 3VKUA 3IHTA 1R27A 5C4IA 3I62A 3DKPA 2E21A 5DHTA 2RHDA 2NZYA 3OOJA 2J08A 1NJ5A 1CR2A 4RJIA 3F3KA 1PNRA 4DLLA 4E11A 4GLJA 3WGVA 3GARA 3V7FA 5JR3A 2XQKA 3E2IA 3DUFB 3ER6A 3NRCA 2CEKA 4FZVA 4G2TA 4N39A 2JK0A 3IVRA 2VBFA 2I99A 3QVJA 1U2EA 2OQRA 4QRDA 5DBOA 5GONB 4CG0A 4INZA 2O9JA 1CZNA 1X1TA 4K6FA 3B78A 1RXIA 4DZZA 3HYRA 2EYUA 1X7ZA 3DOEA 4UFOA 4U9IS 2WUWE 3STTA 4MAFA 5FFMA 4FCTA 2IP4A 4TRMA 4BBZA 2VAVA 3NJ8A 1RSZA 1J9EA 1QO0A 4ZPXA 5EWMA 1Y7IA 1YJCA 2P2SA 3ASZA 2CLFB 3AI3A 3EQ7A 1YR9A 1G0OA 3GRUA 3K8YA 2XSZD 4GI1A 5H3LA 1OA0A 3ZVRA 1VC2A 2ZI5A 3KWLA 1ECPA 5FBRB 4QJ4A 4DDHA 2ZZKA 1H2HA 3PIIA 3TTUA 1Y82A 1P4SA 3GRRA 1N1MA 3KRTA 4KXUA 4BLPA 2YFQA 4IV5A 5KB3A 4ETWA 3MJDA 5DBHX 5LQSA 1LBSA 3N75A 1T9HA 4C7OA 3AL3A 4ZDWA 3E53A 1J4AA 4TKVA 4L6AA 5TNXA 2B30A 1PEYA 5CYPA 2QIPA 4IZHA 8ADHA 2XWSA 3GJ4A 5BYBA 1ZRMA 1PX2A 4O8CA 1S02A 5L7WA 2RK3A 2F00A 1HE2A 1Z2AA 3B2QA 2GYYA 2JK1A 2DWOA 2OV3A 4IJQA 4UHJA 5I9BA 3STUA 2VN8A 2GCEA 2BSQA 3TPFA 4PNPA 4HC4A 3ERCA 2ZUTA 5HJ2A 1HLGA 3NBUA 3F8TA 1WEHA 3O8BA 3A7EA 3OZIA 4W1QA 1XZQA 4ND8A 3G2OA 2QSJA 3AXTA 1N8KA 1UIMA 3N8GA 1J97A 1U7WA 1VG8A 2PVCA 3BMQA 2JIDA 5E0OA 4DY4A 4G37A 4EFNA 4RV0A 3BAZA 4N6GA 4Y2RA 1AURA 1XZHA 4BO8A 3I09A 2A78A 1YOVA 1L3BA 4D9IA 3NT4A 3ZK7A 2FFHA 1Y8ZA 3BE4A 1YQ9A 2ZJ7A 1OH5A 3R7BA 1UQTA 3ZK9A 1P62B 1Z9BA 2JVJA 3WGJA 3RC8A 8ATCA 2CNOA 3BZWA 4NZYA 5G3YA 1OFIA 2PZ8A 1Q7BA 3P94A 1Y6JA 2RH5A 4HL6A 4PVDA 4R2HA 1IHDA 3O8LA 1CUYA 4D80A 1CS4C 1GG5A 2DSTA 2GUWA 1G3QA 1ZGBA 3SD7A 1SCKA 1APBA 1E2JA 2VZLA 2V9PA 3GBVA 4HATA 4OATA 4GZLA 2B4KA 4ITRC 4DDUA 1A82A 2R00A 1XEWY 1R9JA 1R0SA 5HMMA 2O3QA 1RW4A 2UZ4A 3S55A 1B1CA 2I7CA 3MOSA 9MHTA 4X24A 3KUXA 2AEJA 1PP4A 3G85A 4Y67A 4CTJA 2H08A 4P98A 2BFBB 1GZHB 2R9VA 4YRGA 5H0IA 3GRZA 3ESRA 4QG3A 1P2DA 1DDIA 4H18A 4LI0A 1KA9H 4PAWA 1J0EA 3H17A 2XJ9A 5A9SA 2LIPA 2VOJA 2XBLA 3U9SA 1D2GA 4R2KA 5GQSA 1TKAA 2XOXA 1EZZA 1H1TA 4WXRA 1TVKB 4ZVSA 2TYSB 3OPYA 3IDOA 3EGVA 3GGDA 1K7CA 3AVPA 4Z0PA 3TQSA 2B5OA 4OQLA 3SMQA 2GN0A 2MTBA 3O26A 3D3NA 4YUAA 1EFRA 3LLCA 4L6IA 3FLAA 3N5CA 1Z6GA 4CXMA 3A70A 5LC1A 3CW8X 3HY4A 5KYWA 3LO8A 4OHKA 3ZY2A 3ZWBA 3RODA 2AZXA 4EO7A 3SHFA 1N5LA 4G0NA 4YAGA 4KR2A 5ADVA 2PVSA 4J94A 4M0KA 1I4WA 1NZJA 5EIHA 5DMHA 3T3EA 2YHIA 2HJSA 3UB3A 5K7SA 5A62A 3NGLA 1ZD2P 2NVBA 1QQ7A 3A2NA 3GPCA 5BPFA 5BSVA 4AKGA 4ABTA 1R4AA 1B8NA 4TTIA 4G1BA 5BXQC 5DSTA 2ZIXB 3EHEA 2VF8A 3OF2A 1WNTA 4GQAA 4W1PA 4DWJA 2OHHA 3ZQJA 2F59A 4FS3A 4ACAA 5GIOE 4IIDA 4UXIA 4UOEA 3LQQA 4H7FA 1TLFA 3LDFA 4B6GA 4ZVOA 3RYHA 1F48A 3K32A 3LM8A 2C04A 4OLJA 2ZRCA 2PUJA 5LQNA 3GGGA 2VZ8A 4PXYA 4YJKA 2C5BA 2IU3A 2QBYB 5T7BA 2PNFA 4PC3A 4KP7A 4KMOA 3LUAA 4TYQA 4TLBA 3RVKA 2GEUA 3NS7A 1NL3A 3A1VA 4BLWA 4PC6A 1RPAA 2PH7A 1SD2A 3F9CA 4Y98A 3W5VA 3IJRA 2C7BA 4OVKA 1ZA1A 1MQ9A 2L42A 3RH0A 2X2FA 4YJGB 5L53A 3OA2A 3EG9A 1WLFA 1CR1A 2OORA 2GESA 2ZBRA 4WX2B 1T0UA 2VSYA 5EG5A 4HBZA 1EAMA 2ISSD 3KAQA 1X7ZB 3VR5A 1I0LA 4HQ0A 1Y33E 3LPDA 2XDWA 3HXOA 1LPOA 2EX4A 2V5VA 3WLRA 2PTHA 2AJCA 4PHCA 4KQKA 2JD2A 4YO8A 4WXMA 2CVPA 1Y7HA 3LT2A 4RENA 1Y81A 4BVLA 2XWJI 1E5VA 2X8LA 2CNDA 2IJGX 4DIUA 1IBKB 4EPXA 1DQYA 1EINA 3T7AA 3FOZA 1QAOA 4DY6A 2Q4DA 1YB1A 5FOQA 5CX1A 3KFVA 1W93A 3O7WA 4BGIA 3D3KA 1RHKA 1UBRS 3P96A 4UAVA 1FTWA 4RA6B 2RGYA 1XE3A 1EEXB 1DXOA 2PYDA 2J30A 1XMVA 5LNK1 2WP0A 3AEYA 3D4NA 3ZXSA 3EY9A 1ZMXA 4BZQA 3ORHA 2FETA 4Q82A 2Z08A 3I9OA 1OKKA 4WI1A 4J07A 4GP7A 4UU1A 3OIUA 4XPIB 1J2RA 3RVSA 3ZDFA 2ODQA 2PZBA 4AKEA 1LFDB 2E48A 3OTIA 5TT1A 3VU0A 1WDMA 2AC2A 4WH0A 5EHIA 4F8YA 5BVHA 3R20A 5FQNA 3LUFA 3RHSA 3VNQA 2O8CA 5AVZA 2L17A 5AWFC 1YA6A 5I5GA 1P8AA 1WXDA 1C9EA 1ZIYA 1U6JA 5GM2A 3ABQB 4X92A 1GQRA 2VRBA 4DHWA 4BAZA 4U7JA 5LA6A 1JF8A 2HZ7A 3L7MA 4S0ZA 2MDTA 3ICVA 4OI2A 2ISQA 4YDSA 1UF9A 1R8SA 3GRAA 1NIJA 2R5FA 4E07A 2JFPA 3THWA 4JWKA 3ECAA 2F3RA 4W5QA 1V48A 2DKNA 4GMHA 1JTVA 1PVOA 4U7FA 2C7GA 1E9EA 1EVEA 1SUWA 2CDNA 1TQ6A 2JS7A 4GYWA 3U1VA 5B6PA 3GJ0A 1CNMA 5TEWA 6PFKA 5J9FA 1S0UA 3OAAA 4UBLA 1CERA 3S29A 1N6NA 1MD9A 1QHHB 2AN5A 4G25A 2ZCUA 4E12A 4EGJA 3T5GA 4ZP1A 1P6QA 2G1JA 2OB1A 5HS6A 2XGOA 2C9DA 3WBFA 2J4CA 3R5XA 1U7UA 3H9GA 2AUNA 5KYUA 3BIOA 1A1SA 1VMEA 1RXVA 1RU3A 3HJGA 4A8TA 3NAMA 3EOAI 1U3WA 1X3LA 1CQJB 4JEUA 1GG8A 3FIUA 5CD1A 1RMTA 1Z39A 3PVSA 4W5JA 3VYWA 1A7JA 1UFVA 1Z0JA 2GBCA 3TG2A 4FYMA 1EJBA 1NQXA 2A30A 2AXEA 3DWIA 2QLJA 3KCQA 3LUBA 4BNHA 3BJIC 4ZKEA 3GJ3A 4UD6A 1RKBA 1TAHA 2OHGA 3OZEA 2EF0A 1JN0A 5A9SB 2X1MA 1AQNA 5KOYA 2QVBA 4F72A 2JLWA 3ISTA 1WUHS 1W1UA 3K1YA 1PTJC 1L3CA 2JFUA 4HGRA 4P5EA 4EYQA 4U2FA 3ZDAA 3TQTA 5FA6A 3PXAA 4MH0R 2AFHE 2YVUA 4KDCA 4KI7A 1SUFA 1WBBA 1NURA 2ZULA 3GWZA 3RG8A 4BMYA 1VIAA 3Q1LA 3K0CC 4A6PA 1P0FA 1YMUA 2XMPA 1PW7A 1GNLA 3E15A 3G0IA 4QUBA 2CHQA 3Q3JB 5E3IA 3CZ9A 3HL0A 3U26A 4OM7A 1SVWA 3C43A 3LS2A 3PE6A 1U7TA 3KKOA 5CM8B 3USCS 4LQDA 3LT5A 3BMNA 3NC0C 2INGX 2VSFA 1BRMA 4EM6A 1QQAA 4B6QA 4MINA 5EZYA 3M34A 4COKA 4D9EA 3MJEA 4MKHA 4AB1A 4AJ1A 4P0PB 4OMUA 2B82A 4EVRA 5J5VA 1ORDA 3PUIA 4FONA 3U2QA 5FV7A 1D09A 2VK1A 4QXQA 3BEDA 3RSQA 3WXBA 3L8CA 3FDIA 3IQXA 2ERCA 2FXIA 3DBHA 3QGMA 3TNYA 1B42A 3RYHB 2HDNB 2ZE8A 2ZRGA 2GS9A 4JEIA 4QBHA 2IS2A 1OQAA 2Q5CA 3SSOA 4E5DA 3GR6A 3FYTA 4IQFA 1O6FA 3A1WA 3UK6A 3MWDB 2FW9A 4W7IA 4XQEA 5CNKA 4MJXA 2E4UA 3V4LA 2X22A 1WCIB 2HL6A 3KUKA 4ZQIA 4EX6A 2O7RA 2SKDA 1RAFA 3U4QA 3JSXA 1EK0A 3HV0A 1KJWA 3DONA 4Z7JA 4EKEA 5L9AA 3HDYA 3JQ9A 3LXXA 1JLRA 1Q0UA 2D0IA 2OV4A 3HJHA 5JSKA 1PDOA 3ZCQA 5LMNB 2YZ2A 4M86A 5SZHB 4CLDA 1QTQA 2Z3WA 3AZQA 1T8TA 2Q3CA 1KSHA 2B6HA 3EBOA 3FTCA 2QQ0A 1HDZA 5EKDA 4NP6A 5E4TA 3SJAA 1QVRA 3D3JA 4KQIA 3NHUA 2EDAA 4LE2A 1JG6A 4EHJA 3CMMA 1LV8A 3WISA 3PF8A 1WY5A 2D54A 4BQQA 2PE5A 1G6Q1 3HLYA 3W2FA 3U13A 4WLOA 2V96A 4G4GA 4JP1A 2VJOA 3JD1A 4ZVPA 4ZDJA 4MQ5A 1Y1RA 3OTGA 3ORQA 4FOOA 2GCOB 3NX4A 3AUUA 4L07A 3C4VA 5AI8A 3EISA 1E1QA 1IWBB 1U0NA 3DE4X 2DB3A 2I1LA 1XF9A 2GHTA 3V6LA 2I1QA 4MR8A 1L7QA 2BC9A 3SYTA 2XUIA 3E2PA 4N0MA 4BFSA 5BW5A 3HMKA 2WB4A 1MCZA 4PFKA 1I3CA 4MW9A 5BUCA 4GOMD 1T2FA 3WIUA 4F7WA 2QUHA 4HZGA 1GITA 3ROTA 1J2UA 3PGVA 1QFJA 2PT5A 5A3SA 4JI3B 3KVVA 4GWGA 4YRAA 3EYAA 1PGQA 1FDWA 1F60A 1R6BX 3GFPA 4MLZA 2RGWA 3FRIA 1CIVA 1DTWA 1GCUA 4FGZA 4R3UC 3LNCA 1KPIA 1N1DA 3M6IA 4PVCA 1XBTA 4IX1A 5KOJA 2HMSA 5DXFA 3Q7TA 4HXYA 4MVCA 5CLHA 4DUPA 4PZPA 1Z29A 4ALIA 1D2AA 5BMOA 4W8OA 2ORED 2ZAGA 2H0RA 1FPMA 4ZYZA 2V4MA 2JBWA 1D9ZA 3R41A 1M8GA 1K63A 4HYYA 3N0TA 2XUGA 4NZOA 3KPUA 3OD1A 1XYYA 2Z1MA 4LYJA 3ETEA 2K2WA 5FUXA 3TRJA 5C2JB 1CUWA 3RDPA 2J45A 1KY2A 5TS2A 1SIUA 1LPNA 1NAHA 2YXEA 4A2CA 1MGOA 3Q85A 4MWCA 1XTJA 2I9PA 3OA0A 1Y34E 2YWRA 2DHEA 5LKAA 1TO1E 1W4BA 2JAPA 1CIPA 1AS0A 2B1JA 5IXSA 2OCBA 3IMGA 1B8OA 3LYHA 4B4UA 4M49A 5KAPA 4MA0A 4TUYF 4ADSG 3NTVA 1N6IA 5A6VA 4R9SA 3WDKA 4EJSB 1H1LB 5ICGA 3O1HB 3B3FA 4Y6QA 1E6WA 3DDNA 3F6RA 3ZE7A 1I1NA 3KYDA 1NQVA 4LXXA 1T5OA 1Z3IX 4KWEA 3V7WA 3DVSX 3ZHOA 2GXUA 1NRWA 4NLLA 3L6UA 3BXHA 3KZXA 2IYSA 1U7OA 1WMDA 3DBVO 4NK5A 4NNPA 2E85A 1ZCJA 3E4CA 3B8HA 2PD3A 4BMXA 3P0RA 3R8FA 3W2IA 1SEPA 3T1OA 3LVQE 2QAGA 5K5EA 4DB4A 4IDEA 2ES4A 8GPBA 4G89A 2AJBA 2IYXA 4LS3A 1SD1A 1Z5ZA 3AZOA 3EGDB 3DEKA 2A7XA 2UZAA 4JBLA 2C9CA 3JALA 3RFXA 2O4UX 4MUMA 1N5JA 3EFHA 3OQNA 4P86A 1Q5PA 5FHQA 3VKWA 1GTG1 2VYQA 1PJAA 3CF6R 3A37A 3BMNB 4KLRA 4LW8A 2MYPA 1NF8A 2JGRA 4OQXA 4XM0A 5I8ZA 3KD2A 4J1TA 1FXWF 5K6TA 5EZYB 5JALA 1SD5A 3MMPA 1GUDA 4K2HA 5G53C 3UFBA 3FJOA 3TZHA 3CEHA 3DCNA 3R24A 3MPUA 1R7RA 1LCIA 2FQWA 1VHTA 2WIGA 4IIXA 4LISA 1GG2A 1P1RA 1LVHA 4M4SA 3SC2A 4LJRA 4XEUA 3ZBUA 1SOVA 1JG1A 1FSGA 3B7GA 3GPIA 4TN5A 1X19A 2Q9CA 4G8DA 4KGDA 3NG1A 3S5JA 5SYMA 2YINC 3UN1A 2IGTA 3O8QA 5T3YA 3TSYA 1Y5NA 2QTRA 2WU0A 4CKYA 4ZEOA 2OLEA 3QX7A 3USES 5ALOA 3CV3A 3AFOA 4TV9F 4TV8F 4U2GA 3HKBA 2W2PA 3T0FA 5P8WA 1OBFO 1VMIA 3V2UA 1GCOA 2Q1CX 2JIPA 3AU9A 2QE7D 1KVRA 3A3OA 3VHQA 4CJXA 1WVGA 4MGHA 4CPDA 3GLIE 5KOHA 4Y1RA 1LDMA 4XIGS 1THTA 5EJ8A 3IPAA 5T6BA 3WB9A 3TB6A 4Q37A 2F48A 3SXUA 2IZ0A 3WGNA 5HQ3A 5LJLA 4KTTE 1SHKA 2UVDA 3CR3C 3W8EA 3U9LA 1T3GA 5KKCA 3UHPA 3CZQA 4FJ1A 3QM1A 4RS3A 1CRZA 4JSYA 4Q19A 1U0RA 1DKNA 4X45A 4KIWA 4B2PA 4QM7A 1LLQA 3Q1KA 3WLPA 2GJ8A 4ZAXA 1XEAA 1JKFA 1F20A 2YMLA 3F7TA 5DHUA 1VE3A 4PZUA 5EI5A 3VU1A 4H35A 3E22A 5AYVA 4XWYA 1ECLA 4MYUA 4ENQA 4KPFC 2ECKA 4KLZA 3WR5A 4EHLA 1A96A 2G72A 4WZAA 2OCDA 3NKVA 1WVMA 2W48A 2B35A 1MOQA 1ZGCA 2G08A 3OZTA 4YJ3F 1JG7A 2PMKA 3TW6A 1ADCA 1M1NB 3CFYA 3G7SA 4IIJA 4ILKA 3ZR4B 4BNKA 2PUBA 4ZO7A 1HE3A 1QTNA 3PJEA 4JYBA 3MJFA 1GUFA 3EZLA 4MR8B 2XNCA 3R0VA 4LTMA 1FUIA 4TS3A 2HLNA 3EVGA 5ICSA 2R96A 1DJMA 1UP7A 3L1JA 1B23P 2WVJA 3PUKA 2XAAA 2Z56A 4UJ3A 4AG5A 2FV8A 3N2LA 1QPZA 4HEQA 4ROTA 4OJNA 3VR3A 1HSZA 5D1HA 4QDTA 2C3UA 3TJMA 2ORVA 5D1NA 3CNOA 4A6EA 5M2QA 3I12A 3INTA 4UBMA 2YJGA 3PV0A 2J5BA 4R4JA 1VLMA 2I22A 3KLNA 4G0PA 3OHPA 5TV2A 4F4JA 1YF3A 1L5ZA 2C20A 2VJYA 5D7NA 1Z22A 3CMCO 2FPPA 2IA5A 4FWTA 4MYRA 3PE4A 1V71A 3WWDA 2ZUSA 3RROA 3EGWA 2XIQA 4HB4A 1AF7A 3MRSA 1QIKA 3OICA 4GYJA 1Q21A 5IJXA 2OZVA 4FHGA 3EXEA 5EZ5A 2BKAA 3MTQA 1EFLA 2XMGA 3WAKA 4ZCRA 2D2IA 3F46A 1DQNA 4FZ3A 4MTCA 4LF4B 5HG0A 1MC4A 5EEGA 3OZGA 3ROMA 1MXFA 5L3QA 2JFXA 4ZT6A 2N0SA 4QAJA 5ESXA 2GXAA 5BR7A 4LGVA 2AG1A 4WFIA 5BWLA 3AGQA 7MHTA 3TKLA 3GLQA 2FJPA 2BPOA 2ZR7A 3EJWA 3JZFA 2O2JA 1V16A 2XVAA 4KJXA 1Y1KE 3WRXA 3I1IA 3A3PA 4BAUA 2ZB3A 4IQ8A 1TA9A 3AIOA 4CTMA 2PSHA 3ABOB 1EFPA 3AI2A 3RQSA 4P83A 3R9IA 4E2YA 5AVYA 2RGXA 2X9VA 3QQ5A 4YMLA 5A3RA 1XMIA 3QIAA 4P3XA 3HR7A 3R3XA 4UCFA 5EUQB 4WY5A 1FFDA 3WGYA 1ZM4A 1XL0A 3EWSA 4G4SO 5EE1A 1J6UA 3D1LA 4QDZA 2J1LA 1SQ0A 1IXSB 3L7KA 4E31A 3ZDCA 2ZR9A 4EF6A 1AUQA 5CGQB 2PYZA 3SYNA 1RNLA 2ODWA 2VL7A 5MN5A 1P2SA 5F7XA 4G81A 1UC4B 4MHOA 3T4XA 3COWA 2NO1A 5GGYA 3LL7A 5CA0B 1RE0A 3SP1A 1JHVA 2QAGB 4JLPA 3TLCA 3TWOA 1N7IA 4CQMB 4OXQA 1MQAA 2SCUB 2WNHA 5EPPA 3OOEA 1SHTX 3HA2A 4RUKA 1KU6A 1LTQA 1L5MA 3NHLA 3NHBA 3O0DA 2YXDA 3JALB 2ZQYA 3M82A 3RT1A 3Q9NA 2PJUA 3O95A 4DDWA 3DJFA 5DX0A 2C9MA 3CXRA 4K0KB 4DN6A 2EKPA 3X3HA 2FW7A 3EGOA 2GXQA 3BHJA 4Y2VA 3UWKA 1FDUA 3T9DA 5BYKA 4YRJA 5GZ1A 2I87A 3LBFA 3V32A 5CDFE 4M9XA 5K0SA 1XQ6A 2VPWA 4D9JA 8MHTA 1E9AA 5IC6A 2XX3A 1J06A 3K09C 1JNYA 4MIOA 1L4NA 3D1JA 2ONZA 1P74A 1BVYF 1FUKA 3SC2B 3SBXA 4KQWA 1DUVG 2LDBA 3CNQS 5REQA 3QKWA 3AFMA 2N3ZA 5LUBA 1MF7A 2IOQA 2EHDA 2XMZA 1T15A 3HYTA 3NTXA 4UNSA 2WNSA 2HIGA 3OZAA 2QKYA 5DK4A 2F8LA 3S8MA 3ST7A 3WNCA 3CLTD 3ZNPA 3O8QB 5AVVA 1OLUA 1QOQB 2BEWB 2Q07A 1T4GA 2CK3D 3TQIA 4JOSA 2GPWA 2UUPA 2I2FA 3IB3A 5AW8A 2O2IA 5MN6A 3NMUF 1VMAA 2HA3A 3HU5A 2WTXA 3MMNA 4CF4A 4A91A 2FLWA 4J3FA 3AR4A 3EGXB 3X2EA 2V7QA 1OROA 1YCGA 1EQAA 2DJ5A 2VKQA 2VAPA 4G9GA 4JLJA 1YFKA 4QTTB 2WG1A 1KQNA 3QLTA 1SO8A 3T4UA 1DOZA 2QG6A 2PX8A 1UEXC 4IO1A 1ISSA 2CBZA 3RLIA 4E1BA 1OTHA 3VFDA 4S35A 3U80A 2ZB4A 4DS3A 1QZ3A 4N5IX 1W0JD 1ZSVA 1Q74A 1K88A 5HQ3B 3G8BA 1V6AA 3K96A 2NPOA 3L6RA 3TS1A 1KAEA 1WBJB 4O0MA 1NQUA 1OWMA 4HRYA 3F2IA 1H66A 3C3JA 1W76A 4KMSA 2C5SA 2OO5C 1EA7A 2C31A 3CW2A 1R12A 3CRW1 2XGGA 4CYMA 2HA4A 1ZWLA 3L84A 1R4ZA 4F93B 2E4YA 3DC7A 1HT1E 1E7YA 2FMUA 2Z5LA 3AEQA 3AUKA 1II8A 4NMXB 4JI7B 1ISFA 1DLIA 1AO3A 5TMBA 1BCRA 1RQGA 5BR8B 3ZV3A 5KMGA 4B47A 1HEUA 3BN3A 1Y9AA 2ZJAA 3OLYA 1N6LA 5IW8A 4OX9B 1G64A 4IF4A 3GEMA 1ZJZA 2OK8A 3AHCA 4BQIA 2F1OA 4G41A 1DAOA 1IMOA 2X9QA 2XHEA 1BD4A 1RWOA 2CWWA 3H1FA 1KAHA 2NT3A 3CPSA 5LZ8A 1UC9A 4BFXA 1VCNA 1WD7A 1W73A 4CKWA 1FA9A 3NALA 4QQNA 5EIBC 4GX2A 4TXLA 2P4HX 2C00A 1BS9A 4LY6A 1GU1A 4LVNA 1MP0A 3T3IA 4L5CA 2QU8A 3UFXB 2VHXA 1RLMA 4X85A 1P2UA 4FEYA 3B6MA 2YIVX 3AY7A 4G0WA 3HNRA 1BKYA 3RGGA 2BM1A 1ESCA 1FXUA 2B1QA 3JQDA 4HGNA 4RA9A 4C9BA 1SFRA 2XECA 1CETA 3RANA 1M2EA 1BVHA 2R1VB 5LYYA 2IYVA 1AKRA 4A6DA 4EG8A 1KDYA 3FUTA 4HT3B 4NCJA 1ZJ5A 3L0PA 1OYVA 4IJ6A 5LOVA 1P9RA 1V5EA 4E33A 3QNMA 3EXEB 3UZUA 2H16A 4JI0B 2JFOA 3VXKA 4M6WA 2VHWA 2OAP1 3HCDA 3PPXA 4M7WA 3ZXYA 2BUBA 4BP1A 1LK5A 1C80A 1LPPA 1QFYA 2NLOA 4KPEC 3RUEA 4QTZA 2OO3A 5MGNA 1ZH4A 1J2YA 4WKCA 1OIXA 4CQLA 2QG4A 2GHQA 4FS8A 3U4MA 1FDRA 1RZRA 2UZ3A 3RBAA 1ZGJA 5DVZA 4C78A 1FQOA 3C6KA 1MRZA 1NYTA 2FMTA 1PZMA 2ZQ5A 3CURA 5I3ZA 2J0QA 6CHYA 2OKCA 1PGPA 2ORYA 1P4HA 5JS6A 4AJ9A 3CT4A 1ZN2A 4YCDA 1T3TA 2BY4A 3A0RB 3Q2IA 1E2PA 2ZRIA 3AETA 4JIMA 4BV2A 3QYPA 5DCUA 1BAPA 4TWZA 4KXMA 3UQYS 3TLGB 3ED5A 4EMBA 2B3DA 3T99A 1VCIA 4LHWA 4EW6A 3DCJA 3TR5A 3F4BA 3NBFA 3MSCA 1RZUA 5J23A 3GPDG 3R6WA 3TK1A 4KLCA 1YS9A 3PENA 3QLVC 1C7JA 4AXBA 1TM3E 2WT8A 3BGVA 2PX5A 4BE7B 2H4YA 1AK2A 2P9QA 1UFKA 4JSTA 2WJWA 2R47A 1GSHA 5HKKD 2HV8A 4PC2A 1C9NA 1J21A 1AKVA 3I8XA 2CJFA 2RHOA 3JQAD 2XWBF 1SXGA 3VISA 2NV6A 1W29A 1SKYB 2OD7A 3UMYA 2JIMA 2XTMA 4CLEA 1C7IA 1W0CA 4WBXC 2O2EA 2QJWA 3IVAA 3QKUA 2J9GA 1U2QA 2ZRMA 4ZJPA 3CUSA 3Q15C 1Z35A 2AOXA 4C0JA 5BMVB 1D2HA 4AY4A 2V3VA 4MA5A 4C20A 1FVHA 5K2MA 3SKXA 2QM7A 1U5AA 2A88A 2C3YA 2JL1A 3I2FA 5CU7A 3TL6A 4RCYA 3HY6A 3WYDA 1DEAA 2D2EA 1CY8A 2JC3A 4XYLA 3N86A 2QSYA 1E60A 2QYSA 1JSRA 1PIWA 1T2CA 1JHDA 3NBYC 5FPHA 2DMRA 1RBQA 2ZU6A 4RFLA 3OUUA 4Q9IA 1RYHA 4OP3A 3CLHA 2O50A 2OAQ1 1JE1A 1OT5A 3AF4A 4IQ4A 3WOHA 2ZS7A 2QZPA 3O9VA 3ZCTA 4BATA 4KFRA 5IFKA 1QR6A 1J0DA 2JFQA 2V58A 1RJDA 3GUCA 1OLUB 4DF3A 4D9BA 1CQIA 3P32A 3WLTA 2F62A 1PK7A 3QF7A 1T5LA 4HLUA 3TIVA 5BSWA 4DILA 1SXJD 1ESDA 4ME6A 4EB6A 4OGLA 5LB4A 3W5BA 3B85A 4FXPA 1G7CA 2B98A 5THKA 2GARA 4W9RA 5A04A 1SY7A 3K70B 2ZXEA 1UBNA 1SXPA 5KSPA 4QOIA 1NR5A 4YT8A 5B5SA 1UXIA 1J5EB 1CY7A 1DAHA 3AHJA 4HPXB 1G1MA 4W7SA 3GEHA 2ZUBA 1TIBA 1OH8A 2YHBA 4DYHA 1EDDA 1FNSA 1XFAA 5C3MA 2RB5A 2HIHA 4OD0A 5KX5A 5TGTA 4C3ZA 5KNCH 5K0EA 5A7HA 3OY7A 3G13A 4ZGBA 1BDBA 4GM0A 4LY3A 2P5UA 3EVEA 4NBSA 3ET4A 4EYKA 4HVAA 2PVPA 2GTHA 1XTSA 3DUWA 4ENTA 1OWLA 2VYVA 2BTQA 4K3UA 3AEQB 3STXA 1E77A 2XD9A 5JVDA 1XEXA 4G5QA 4LHYA 1P5ZB 1IOVA 1NQAO 1BCRB 1YXMA 3LMKA 5CEFA 2Y1DA 2YNMD 2MU1A 3COVA 3PGLA 4L3WA 5JC1A 1BEZA 3BS4A 3HYCA 2A1UA 4JP8A 3CNHA 4R2XA 1ULTA 1QRAA 4D3SA 1B6GA 1BJTA 1R5NA 1ZM2A 2BBTA 3IUJA 1IQRA 3NB0A 4JWTA 3SHQA 1NM5C 1ZH0A 2HFJA 3GXBA 4NY1A 4E21A 2IHNA 1HF3A 2IDJA 4CKWB 2JZCA 3OEHA 2QE6A 1X7YA 3KTDA 3WLKX 3H0EA 3QLEA 4ACBA 2BHRA 4R9UC 3UBTA 4LFBB 3S3TA 4ANFA 1KRWA 3G0BA 1QYXA 4NESA 5FUVA 1JWAB 2WEKA 1GQSA 2R84A 4G36A 1IZ8A 4FZ5A 3G9ZA 4IVRA 3J7AC 2XVZA 3HTXA 2AFHA 2PZJA 2YJ5A 3A9UA 4JLUA 4A03A 4DUZB 4RA9B 1L5KA 2ZBFA 2Q50A 1WW2A 4HNHA 3ZIDA 3HN6A 4N82A 1GILA 2UUBB 3VX4A 4F84A 1CUJA 2NO5A 3BWVA 2VXBA 1M54A 3TLKA 3SY8A 1E2MA 5EHNA 5LOVB 2D2FA 3W0LB 2JJ2D 1J1ZA 3IBGA 1KIMA 3QBVA 5AW4A 2G83A 1RQ7A 6GPBA 5EJ9A 3CZPA 4Q18A 2IIQA 1XCLA 1OR8A 2JIQA 3IAXA 1OVGA 4M6WB 1OU4A 5DNYB 2F55A 3RAJA 1T9BA 2DFTA 4FNOA 1YFJA 4F1WA 1NRXA 1PWZA 4NQZA 2XMQA 3NYQA 5AMXA 5ENDA 3TI7A 1ZR2A 3W5CA 3GL9A 1Z74A 2CMKA 2HK8A 3K73O 3PLNA 5DF1A 1GQ2A 2IXGA 3DD1A 5FJIA 3ES9A 2H54A 5FADA 4CV0A 4DOMA 5LMZA 5EERA 3O90A 5LQDA 2HSDA 5CT8A 1G4HA 5CVEA 3UMSA 3GVCA 4YT2A 1YH3A 2W6IA 4AY5A 3ND7A 3H5TA 4YRZA 2B0CA 4IXWA 5B58C 1VECA 5DGXA 1H1DA 1OI4A 3GMDA 4LI3X 2AOTB 5ARCA 2CFIA 3BC1A 1R4MA 2WUEA 3JU3A 1NN5A 3AETB 3Q3CA 4GNRA 4GKAA 1GN8A 3F74A 4C21A 5CNMA 3IPLA 2C58A 5CFNA 3ZCRA 3ZE2B 5KYYA 4HAVA 2FG6C 3NETA 3EULA 1IZYA 2AB0A 3P27A 1X6VA 4Q7JB 2V6GA 4I1SA 4NFYA 1UBCA 4ML3A 4F3YA 1SELA 2ZSJA 7ABPA 5KTYA 1N6OA 3KQQA 1E0AA 3R3JA 4WOJA 1T8SA 1DAMA 4CF3A 4E5KA 2C4VA 1B16A 1BXGB 1SHUX 1H2BA 2PKYX 4L0QA 3EXFA 1DV1A 4LOAA 4X84A 5DGIA 4DUGD 1XQWA 2DKFA 3PR1A 4BVBA 2BFAA 2QM8A 3CN9A 2C96A 1BVUA 1Y80A 4B6OA 1D0IA 3KUDA 3KQSA 5TF4A 3TJZA 4AF7A 2LZ0A 4TMZA 2WKWA 4CEIA 2X58A 1GPUA 3BJEA 1SWVA 1HZJA 1XXHE 3M3PA 4ND4A 2APJA 2FRDA 3EIWA 1M73E 2CFCA 1T25A 1DJNA 2O8NA 3OKPA 4MV3A 4MI3A 3FRHA 4RAQA 4IKEA 1ZOIA 3SS7X 2EFJA 1JVNA 3ZEAA 1XU7A 2E5WA 4KN6A 1VSVA 2RGRA 1SKQA 3HXTA 3DCYA 2ZS9A 4YCNA 3OCXA 3FVWA 4P4SA 4YT5A 1FYFA 4ZRMA 1KYQA 3RYFA 5K3OA 3K5WA 3FVVA 1A9OA 2XMDA 2P2CA 3OP4A 5AESA 1DAKA 3KQLA 2EEZA 4K1LA 4NR0A 3P9YA 3B1XA 3U44A 2FKAA 1Y9EA 5EXPA 1OC4A 4M0DA 1VKZA 4HV4A 2ZYTX 4EB6B 3GT7A 1QDLB 3WWOA 3Q9UA 3GZNA 3DB2A 4RKQA 4M0CA 2X8AA 2X4DA 3BXZA 3P2YA 3DXZA 2UVQA 2AC7A 5KNDH 4R1UA 2BUAA 1GRCA 1P9OA 4O4JA 1E1YA 1US8B 2OO7A 4KLAA 4AMBA 4NK4A 2B7BA 5DTRA 1WMEA 2P30A 4PY2A 3EQ6A 3R5HA 1CG6A 4HQKA 1FC0A 4JC5A 2ZJOA 4MV1A 3KOMA 2NGRA 4LWOA 1DRVA 4C4TA 2AEFA 2VF4X 3DOFA 3WMXA 5I7SA 1U8UA 1GTRA 1ZD4A 4WCFB 3M70A 5HM6A 1N25A 1HURA 2Z4RA 3LZDA 3L7DA 3TFWA 4EKDA 2GF2A 2VTBA 1YS7A 2Z4TA 4D9CA 1GRQA 3ZCUA 1FRZA 4KHZA 4F0JA 4DR1B 2XTJA 5G41A 4MDEA 4O5AA 2AFVA 2BTQB 2NADA 3DBLA 4UKDA 5ICEA 5LDHA 1E7RA 5DYYA 2FKNA 4HUQB 3B1ZA 2VQ6A 3PJFA 2ZDGA 3LPLA 4JBYA 5KJFA 2B61A 5KNCA 5I6DA 2X86A 4PICA 3E0XA 3AB8A 5BVGB 3A6PC 4CM9D 2OQ2A 1YQDA 5AUPB 2YN2A 2OHOA 3T3DA 1BMDA 1V96A 2FQXA 4XD7D 4Z7OB 3ML1A 1YR1A 3SZOA 4CDNA 3K0AA 3BMXA 1HRDA 1PWEA 3W2HA 4WJZA 2XQVA 1WEKA 3ZHXA 3MK31 4Y2QA 3LHDA 1MV5A 1PT6A 3TW4A 5F1KA 3HU2A 2WV9A 2R00C 1EJ6A 3Q98A 4EVQA 3GVHA 5A4KA 2ETXA 3G82C 2PSJA 4HWGA 4Q7EA 1D1SA 2AFHB 2IEIA 5TPZA 5TQ2A 4D8WA 1Q0ZA 2MMCA 2Z1DA 1WTCA 4A1OA 4GI2A 4CG1A 4PZZA 1UANA 2DXIA 4BRSA 5H02A 4RGYA 1HY3A 2QGZA 4Q9HA 2UYHA 2A4KA 4NH4A 1IL0A 3G79A 4RVNA 5JRZA 2GYVA 3I61A 1TZBA 4EG6A 2V9CA 2OAGA 4MP8A 1S8OA 1V5IA 1S1MA 4ARVA 1MX5A 2N9UA 2XKJE 4YPOA 4HB2A 4HAOA 3MWFA 1DIBA 2YY5A 1YZTA 1SBHA 1ORWA 1K2WA 1IOZA 1B3RA 2GZSA 3BZUA 3N1UA 1Y5MA 1XDGA 2E55A 4YRLA 5KEIA 1PV1A 1L1RA 2XZDA 3FZGA 1GKKA 3O3NB 1RWKA 1WQ4A 2QTAA 1TC1A 2PV0A 4U2KA 3ACBA 1QBKC 2P2NA 4LXQA 3ZDYB 4DLTA 2PJRA 5U1PA 5EJ7A 4H7DA 1YTUA 4KQCA 4JVMA 2YJ4A 1VI5A 4FXOA 4L8VA 1SCQA 2Z1NA 1KZHA 3R7SA 1CR0A 2QUAA 1XMQB 3OJ0A 1GZ5A 3IEXA 3TIIA 3ZVMA 1TU3A 4EI2A 4L7VA 4X91A 3UH1A 2FWAA 3U5TA 3VSCA 1GTZA 1QUEA 2VHUA 2XUAA 5HQJA 1P29A 2YQ4A 3Q7SA 4BVHA 1X1CA 4UPEA 4I19A 2FR0A 3LFUA 4FWIB 4JD5A 2FEPA 2NZWA 4HKTA 4NU5A 5IEBA 1Y4ZA 2FP4A 1WU7A 5TGZA 1Q7GA 3ZCVA 4EF4A 5GZ3A 4GZMA 4QXMA 4HB0A 4LC0A 2FRVA 3U39A 1G8AA 4KWTA 3ZGVA 1MW8X 4AQYB 5CJJA 2GEKA 1AZLA 2UKDA 4U3JA 1QE0A 3TBHA 4CLXA 3JWEA 5H68A 4EGCB 1W1WA 4PLHA 3QYFA 2Z6QA 4RMHA 2GK4A 3ZU5A 1SM4A 3AYXB 2DWCA 3L0IB 5ISMA 1L5HA 1A9XA 1U9YA 4I1RA 2DGDA 3IUEA 3OVMA 5K4AA 4UBJA 1J5XA 3QKRB 4Z53A 2VSNA 5J2UB 5CA1A 1LKZA 4QZVA 3E1GA 4DSTA 3K6RA 4II7A 4TTSA 4DLKA 1WSDA 2OORC 1B6SA 3SF8A 1IXYA 2GSWA 3ILSA 1Z0KA 4M55A 4CF5A 2YH2A 2H1WA 2VWQA 1YI1A 2Q4OA 4CEIB 1N7GA 5A5FA 4TMKA 4P4GA 1Y0BA 4HLDA 1OI2A 5EP1A 5KTKA 5J2UA 1DWQA 3L0YA 1CKEA 1TVCA 2F3UA 2P2LA 4FHZA 3SYKA 3TE6A 3CINA 4QVGA 4UULA 5FV4A 4MMYB 4YFYA 5JH7B 3AM3A 3U7HB 1T8UA 4