1I9GA

Crystal structure of an adomet dependent methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
264
Chain Sequence
TGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN RV2118C
publication title Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1i9gA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i9gA02
2O57A 4PCLA 5K0BA 3M6VA 2EJTA 5CVEA 4NECA 1KR5A 2OB1A 4P58A 5H02A 2IBTA 2ZCJA 4C07A 3EPPA 3KR1A 4DKJA 4H0NA 4YUYA 3KKZA 3LBFA 2H1RA 3G89A 1YB2A 2G70A 3A7EA 4C4AA 4GOMD 4R6WA 1VBFA 4X61A 5LQAA 1L3IA 3CJRA 2O0LA 2FCAA 2P1DA 2JJQA 3EEYA 3EVAA 1NV9A 4M36A 4UOEA 1EIZA 3DP7A 4U7TB 3REOA 5GP1A 2VS1A 3B7PA 3EVFA 1XJ5A 4KIFA 7MHTA 5DXAA 3HTXA 5B1SA 3I64A 4CKEA 4RTRA 1MHTA 4RWZA 5EEGA 2PT9A 3VC1A 1G6Q1 1WXXA 3HVIA 1NW5A 3LSTA 5DTRA 2HTEA 3NW9A 2QRVB 2PSSA 5M5BA 1ZKDA 3BWYA 5GM2A 2YXLA 1IY9A 2DULA 2NNWB 2PXAA 3BXOA 2PX2A 3JWJA 2OKCA 3KPVA 2IGTA 1VQ1A 4M38A 5FA8A 5IKMA 3MTEA 3GRRA 2XVAA 3G2PA 3DMGA 1AQIA 4A6DA 2IPXA 5CCXA 3HA3A 5FULA 2ZBRA 3HA5A 4GOOD 3JWGA 1EQAA 3KR0A 4RVDA 4RTLA 2BR5A 1JR4A 3CCFA 2YUIA 3UJ6A 3UJBA 4Z2YA 2PJDA 2HNKA 2EJUA 5MHTA 4X1OA 5K0CA 5BP7A 5FA5A 1ZQ9A 5K01A 2BZGA 5FHRA 1EJ0A 5HFJA 1JTFA 4OQDA 5CUQA 1XCLA 3DLIA 1G8AA 1HMYA 5DX0A 1RJGA 2P3OA 2ZZMA 2YXDA 3QOWA 3DXZA 3EVBA 2R6ZA 3CJQA 3SM3A 2PBFA 3KHKA 3HCEA 5KYGA 3NMUF 3AXSA 1NW6A 2GS9A 3NVMB 4P7KA 3SXJA 3LKZA 2QY6A 4IWNA 1SQGA 2I7CA 4HGYA 4C03A 2PLWA 4QPNA 5EMKA 4AZTA 1NW3A 3GRYA 3FUTA 3Q7EA 3R0QA 5F2OA 4YMGA 1L3BA 4DM3A 3HCDA 4HSGA 3THSA 4GC9A 2G71A 2VDVE 2ORED 3FTCA 5T6BA 1FJXA 2HR1A 2ZTHA 1QAMA 2GPYA 4PGGA 3AJDA 5DSTA 2V74B 5EPEA 4DCMA 4LG1A 2NXCA 4RV9A 4B17A 1H1DA 1ORHA 3PT9A 3DMFA 3SMQA 4FR0A 4BLWA 4RVGA 2P40A 2PV0A 3GWZA 3DXYA 1M0EA 2R3SA 5GINE 1I9GA 1WZNA 2FRXA 2OB2A 2PY6A 3KR2A 3NJRA 1N7JA 4F86A 3OZSA 3BKWA 3E7PA 3KQVA 3HNRA 4HC4A 4X63A 1AQJA 2ZBPA 3LCCA 2OZVA 3TLJA 1MJFA 1ORIA 2O06A 1XDZA 2DPMA 3CC8A 3EVEA 2QM3A 1X19A 1O9HA 5FQOA 5KQSA 3PLAE 3E8SA 2JH9A 5GOZA 3IHTA 4PINA 4CXMA 2AOWA 4AZVA 4K6MA 3T7TA 1TW3A 2AOTB 3KQWA 5C9ZA 2AN4A 2CWWA 3HVHA 1SKMA 2JHPA 5IH3A 3BT7A 2Y1XA 5ICFA 4DZRA 4GC5A 3V97A 1B42A 5LQNA 3FTEA 2PXCA 2N47A 2JH8A 1FP2A 2ZW9A 3MCTA 4GOND 4PYOA 4V0RA 3VYWA 1KHHA 2P35A 2V7EA 5G02A 4PYNA 4CKBA 2AOVA 2CMHA 1YZHA 4R8RA 1L9KA 1PJZA 3R9XB 5HIKA 3CVOA 5K0JA 2UYOA 3KQMA 3LX6A 1FPQA 2FK8A 2XYQA 5FQNA 3KPYA 3CKKA 3DH0A 4JXJA 5EOVA 3H2BA 2G72A 2HWKA 4PYQA 3UJAA 4KRGA 4YV0A 2FK7A 4DCGA 2JHAA 1YZ3A 4U7PB 3LCVB 4ER5A 3MHTA 5FADA 3E23A 2GAFA 2P8JA 5K0LA 3GXOA 1X1AA 4ER6A 4PCAA 1UFKA 3MGGA 5E1OA 5EZSA 3PVCA 4YUXA 1YFJA 5EVJA 2OO3A 1XVAA 1ZG3A 4RTPA 5DWQA 3P2IA 5LR6A 5HZMA 3B3FA 1P1CA 2B3TA 1NE2A 3BWBA 4RSRA 4QVGA 3AY0A 3R6TA 1VP9A 2WK1A 2IDJA 1QANA 1RI3A 4PWYA 3UJ7A 4ISCA 3ERCA 2ZZKA 3M6XA 1O9GA 2AN5A 3ELUA 2F8LA 2ONYA 4E33A 3P2EA 5ICEA 4GBED 4YUZA 5K0FA 5K03A 4IV8A 1P1BA 1XDUA 2OPBA 2ZVJA 3B3JA 5K8VA 1Q0TA 3OU2A 3M6UA 2UYHA 3LHDA 1WY7A 2PWPA 2AOUB 3R3HA 1DUSA 4IV0A 5CVUA 2OBFA 4MTLA 1WXWA 4LECA 3C3PA 5HIMA 2YQZA 1Z3CA 4HH4A 4PYIA 1EAMA 4RTNA 4EK9A 2YVLA 4Y30A 3TMAA 4GEKA 3EEOA 5EC8A 1R00A 3VSEA 3D2LA 3S68A 3LGAA 1QAQA 1QAOA 2ZIEA 5E2BA 3EVDA 2NXNA 5GIOE 2NP6A 4QVKA 4PIMA 3T7SA 4M7RA 1NT2A 1N7IA 3HCFA 2WA2A 3ANXA 3GRUA 3PB3A 4YMHA 4OQEA 5ERGB 3LCUA 4GOLD 1JTEA 5U4XA 3IYLW 5F2KA 2Z6QA 2H00A 2Z6AA 3MB5A 3SSNA 1KYWA 3C6KA 5E2AA 4YUWA 2B2CA 3EGVA 4FZVA 3G8BA 3I5UA 2P3QA 1NBHA 5LQCA 3ER9A 5JR3A 4QTUB 5BXYA 5C1IA 5FCDA 1R18A 5HILA 3GRZA 1D2GA 4MIKA 3BUSA 1G55A 3I9FA 4KDRA 2ZULA 3I53A 2PX4A 5LQJA 1KIAA 1KYZA 3P97A 4HG2A 4EKGA 5DLYA 5ICCA 1QYRA 4M37A 1OR8A 2G1PA 3SVZA 3TR6A 1INLA 3O7WA 2Z6UA 2IIPA 2IH2A 2H11A 4CTJA 3KR9A 4RVHA 3AXTA 1JG3A 4DMGA 1NV8A 5EZQA 2EG5A 2FPOA 2PKWA 3FYCA 5CVVA 1SUIA 2C7OA 5DM2A 3KPJA 5P8WA 5CCBA 5EG5A 4HTFB 5FTWA 2AN3A 3T7RA 3OCJA 5K0NA 2P7IA 1KPGA 1SG9A 2ZZNA 4ER3A 1JSZA 4E2WA 4AX8A 4L7VA 5DM0A 5KS2A 2VDWA 3CGGA 1V39A 2CMGA 3BKXA 2G8NA 3F4KA 3QOXA 4FSXA 5DM4A 3B3GA 2NYUA 4ZTBA 3PTAA 3M6WA 2I6GA 4FSDA 1SQFA 3ORHA 5CD1A 3JWHA 5DRYA 3OFKA 3NTVA 3P9NA 3FPHA 3LDFA 1IXKA 3EVGA 2PX8A 3DTNA 4KWCA 3MERA 4PIPA 4F84A 2IP2A 2EX4A 3Q87B 3LPMA 3OZTA 2OXTA 4WXHA 3HCCA 3P2KA 3FPJA 3DR5A 5DTQA 3MQ2A 4BP1A 1KP9A 3KU1A 4FP9A 5D1HA 5FUBA 1NW7A 4RTMA 3FYDA 4HRAA 4BP3A 1TW2A 3DUWA 4RTSA 5FWAA 4QTTB 5E1BA 3LKDA 5K0GA 4QDJA 4QQNA 3MTIA 3O31A 3MCZA 4FT4A 1VL5A 3HVJA 4AZWA 2BM9A 3G5TA 1P91A 4EMSA 4PONA 2QRVA 3P9KA 2AS0A 2PX5A 3GCZA 4G56A 5EKXA 5E8JA 4E31A 2C7RA 4POOA 3NWEA 2ZWAA 4X41A 3T0IA 5CVJA 2QYOA 2XYRA 2JG3A 1RI2A 1XTPA 1R8XA 4KDCA 2O07A 3A25A 5EMMA 4RTJA 1JSXA 3FPFA 4CTKA 2ZIFA 4E2ZA 2UZ4A 4F85A 3OPNA 4RVFA 3GNLA 5T64A 1G8SA 4GF5A 1PRYA 1VLMA 3CJTA 1YUBA 1JQDA 1JG2A 3FPEA 4P7JA 4QDKA 1AV6A 1XXLA 2NXEA 4CWAA 1KPIA 3DMHA 1KPHA 3ELDA 3G2QA 1JG1A 2QE6A 5EGSA 4E2XA 4E70A 4RTQA 2BH2A 2JHCA 3A7DA 1SUSA 3B5IA 1NW8A 3SX0A 4ATNA 3FTFA 4E2YA 4RYLA 8MHTA 5JUWA 3BZBA 3DULA 4HGZA 2Q41A 4PNEA 4V0QA 2B9EA 4RTKA 2ADMA 2ZWVA 2YTZA 3IV6A 5CM2Z 5HEKA 1M6EX 2OYRA 5K09A 3ELWA 3GRVA 3TPZA 3UZUA 5C0OE 1JG4A 1M6YA 3TKAA 3TM5A 2KW5A 4C06A 3M70A 5ICGA 3C0KA 2PXXA 5DTMA 3UWPA 3OFJA 2FYTA 3JWIA 3NVKI 4KIGA 4YV2A 1KXZA 5FHQA 3ER8A 3AWIA 4PGHA 2NP7A 1RI5A 2BR4A 1VP3A 2PT6A 4HTFA 5EHGA 2AOXA 3GDHA 3OU6A 5DXJA 1RI1A 1Y8CA 2IDKA 3LDGA 2BR3A 3K6RA 5DM1A 1DL5A 3LL7A 3SSMA 3TFWA 3VC2A 3QV2A 1BHJA 3GIWA 1RJEA 3LDUA 5EHIA 5DPMA 5K0EA 3BGVA 5DX1A 5EIWA 2XVMA 3TQSA 1EG2A 3P71T 3C3YA 5DRTA 5BW4A 1TPYA 3SGLA 4DF3A 2ESRA 4KW7A 3PFGA 1F38A 1U2ZA 3HCBA 1D2CA 1JQ3A 2HMYB 5GM1A 3HP7A 3X0DA 1X1BA 2IBSA 4OX9Y 3HM2A 1FP1D 4AZSA 3HEMA 3G2OA 2A14A 4CKCA 3ME5A 4R8SA 3B89A 3FUXA 5FWDA 5E9JA 4KVZA 9MHTA 5D1NA 3EMDA 1EJ6A 3SSOA 4BY9E 2EFJA 5LQKA 2ONZA 4BLVA 2AOTA 3NDIA 3G88A 4GUAA 5EKUA 3UJ9A 3G8AA 10MHA 3FTDA 3A27A 3EVCA 2LD4A 2PVCA 3DXXA 3PX2A 2IH4A 3ID6C 3IEIA 3NDJA 1WS6A 4LWPA 3RW9A 5HOQA 2WA1A 2YR0A 3BWMA 3RIEA 5LQUA 3G5LA 4XUCA 3HVKA 4R6XA 4EKIA 4YV1A 1YF3A 2OY0A 3V8VA 3OZRA 1I4WA 4AUKA 4GQBA 3OE4A 1I1NA 2P3LA 2ERCA 3M33A 4C05A 5KVAA 1XDSA 1DCTA 5CVDA 4ER0A 2AVDA 4E32A 2E5WA 3OU7A 4RTOA 1YFLA 4MHTA 2GH1A 2PWYA 4A6EA 3DLCA 2AZTA 2VP3A 4P7GA 5E9WA 3PFHA 2UYCA 2O05A 3UJ8A 2AVNA 1L1EA 4OA5A 1RI4A 1BC5A 4XUDA 3UA4A 3LBYA 3FPGA 2C7PA 3I58A 3THRA 4BLUA 3O4FA 5EIFA 3P9IA 4Y2HA 3KPWA 5DSXA 2AR0A 3UA3A 4PYKA 3U81A 1QZZA 3NWBA 5KQRA 3P8ZA 3M4XA 3HA7A 3HCAA 3OE5A 4OBWA 4O29A 4ER7A 5E1MA 1UWVA 4OBXA 5F2NA 2Y1WA 5HIIA 3PS9A 1BKYA 2ZFUA 3G2MA 3R24A 4MWZA 2AOUA 1VIDA 4FS8A 4PYMA 3DOUA 1AF7A 1VE3A 5LQRA 3LECA 4LWOA 3TOSA 4RX1A 4P7FA 2P7HA 3K0BA 3FZGA 2PGXA 4EVIA 4DQ0A 2I62A 3ELYA 3KQYA 3FRHA 5K05A 1FBNA 5DX8A 2YX1A 5T67A 2UYQA 3BWCA 2ZBQA 4R05A 1T43A 5DT2A 1ZGAA 2XYVA 1BOOA 4EQZA 1IM8A 3WSTA 3EGEA 4DA4A 1F3LA 4X60A 3UJCA 3TKYA 3KQQA 4YUVA 4XCXA 1X1CA 1L3CA 3C6MA 1G60A 1N2XA 1NKVA 4FT2A 3UBTA 2B78A 1HNNA 1JQEA 1X1DA 2C7QA 4FGZA 2IH5A 3UFBA 3G7UA 3KQPA 1Q0SA 5CIYA 2GLUA 2XBMA 1D2HA 5E1DA 2GB4A 4XUEA 2CKDA 3A26A 4C04A 2CL5A 3A4TA 1UIRA 1O54A 2NXJA 3L8DA 1NBIA 3BGIA 1XCJA 5E9QA 3FUUA 5EEHA 5LSAA 3FRIA 3BGDA 4WVLA 3RODA 4QQKA 4E30A 5GWXA 1VPTA 2GA9A 2FHPA 3GJYA 3GGDA 2ZLBA 1ZHFA 3FUVA 2VZ9A 4OA8A 2B25A 2K4MA 5EMJA 3TRKA 5GIPE 2I9KA 2VDUE 1WG8A 3KQOA 5HIJA 2YXEA 1SVUA 4IKPA 5EMLA 2P41A 1R74A 3GO4A 3P9CA 1R8YA 3GU3A 5EQJB 4PYLA 1ZGJA 2IFTA 1G38A 3KQSA 5E8RA 1P39A 3EGIA 1R6AA 3CBGA 3EVZA 4PYJA 3FUWA 2BM8A 3MAGA 3UJDA 4QPPA 3EMBA 3KQTA 2ZSUA 3KPUA 3SR4A 4C08A 3PX3A 3E05A 5BW5A 1RJFA 2ZIGA 4MQ4A 3TM4A 1RJDA 2HV9A
chains in the Genus database with same CATH superfamily
2QEQA 2B37A 1YR7A 5F7ZA 1G6KA 1MH9A 2VK2A 3FFBA 1OB2A 1SZCA 4UU8A 3I0NA 4NCIA 3HXOA 3U0BA 4RY0A 4W5HA 4G41A 4R2HA 5GGYA 2O0LA 3O8BA 3BMCB 3OKFA 1SQ5A 2FMXA 1XDDA 4D5GA 3KZ1E 3LHKA 5ALQA 1I01A 1IHUA 3BFVA 1L5VA 2RAVA 3IPYA 3LF2A 1IWOA 4V0ME 3GOQA 3SFZA 3QVMA 2Q4TA 4I4LA 3MJ4A 5A3VA 1U2PA 4RTRA 5DNEA 3ZKWA 3GZ4A 2FXVA 1NRJB 3RYHB 3L4SO 1T36A 1YD7A 1KU6A 2QVGA 3H65A 3LLUA 4Z4IA 1M8PA 1TYCA 2DBQA 4ND2A 5B1IA 2QL5A 3I9JA 1M83A 2OBMA 5ESXA 4DNOA 5HM8A 4DJ5X 5H3HA 3RT1A 3TBKA 1Z4LA 4GOXA 3QX8A 3W1EA 1AKYA 1N6PA 3W6NA 3OTIA 1ORVA 3KTDA 4HP8A 4BVKA 2VF5X 3EE6A 1GU7A 5B30A 1L4KA 5IABA 3ANMA 4EABA 4ZVVA 5D3MB 5A71A 1W47A 1RLJA 4F3RA 4JUBA 3OMLA 1SCKA 3F67A 4FGSA 4MW0A 421PA 1PJAA 3HJTA 3DOJA 1WW3A 2ZGVA 4MGYR 1KH3A 2TMKA 4Z2YA 1HWYA 1YNSA 2HCBA 2IHTA 4QA9A 4BRSA 1WDLA 2IUEA 5HMLA 2BOVA 5G0WA 4AY4A 2W48A 1JTFA 1KZ9A 4LPKA 4BWVA 3F5MA 2CXOA 5AW5A 3HG7A 5FBWB 3CPEA 3UO8B 2R6AA 1TMYA 2WJGA 3MGCA 4GKJB 1HFEL 2EX0A 3IQHX 1AZSC 1CYDA 3L05A 1RBQA 1FUEA 1XD2A 3TW4A 4BKRA 5CMLA 3A3NA 1U0OC 4U2CA 3SXJA 5JARA 3H4TA 2G9VA 4AN1A 4KLAA 3LHSA 2VWHA 3LBAA 1DJOA 1LF0A 4GW3A 1V1RB 2K7ZA 3Q7EA 3SNKA 3F7NA 3O90A 4FQ8A 3JZAA 2ISQA 2G28A 2ZS9A 2Z98A 2QQSA 1PS8A 3E9DA 2QUAA 4D1YA 3ZCPA 3DQPA 1L1QA 3CZQA 3NWJA 3LLVA 3LX5A 2COUA 3ZW7A 3GLHE 5FDFA 1JHDA 2GPYA 2VSYA 4LWZA 5IFKA 5JQGF 1X8KA 1TRHA 3DA8A 5JZVA 4HEHA 5E0KB 1L7EA 4LG1A 3WMRA 2I2WA 1CCWA 1ORHA 2XUPA 3GB9A 3BOSA 3ZDYB 2O52A 1TMOA 1WMEA 3GWZA 1GTRA 1Y9AA 2GKSA 3ZI7A 1F4LA 2YYYA 4RLQA 4ZVLA 3BA1A 3EGWA 4EUEA 5EPUA 4YMUA 3KHUA 2I65A 3SYLA 1E1CB 1M2NA 3U26A 3SF8B 2OFWA 5LZ4A 1FIUA 3M2PA 4RKWA 2N0SA 1CR6A 2WYVA 4MWBA 2C5SA 4WUTA 2DPMA 2IUTA 1I6KA 3CLSC 4FOLA 1X3LA 2JH9A 5CYPA 5HF8A 2Y6VA 3GBPA 4P5EA 1NJ1A 4ALIA 4AZ0A 4CXMA 4KMSA 1NVAA 3W0LB 2ROQA 2C7VA 1SXJC 5TX7A 4B83A 4PSDA 3RUFA 1UXOA 2XTZA 3O8DA 4O02B 4OLAA 1E7YA 1VHQA 5FOXA 4CQLB 5JW6A 2ZW9A 3V1KA 4LJ4A 4LYHA 4BNDA 3PE6A 3HYNA 3TX2A 2AOVA 3VPFA 2KM1A 3IMEA 4LCJA 1AUXA 4OI1A 1GCGA 2W93A 4MV7A 2HV8A 4ND6A 4Q0MA 1N8SA 1SU4A 2NYVA 2WSIA 3VOTA 4HWPA 4AIIA 1L7XA 4CF4A 3RBAA 1DXQA 1RWPA 3QELA 4Q39A 2M98A 5H4HA 5DNWA 4MWCA 3K30A 1C9EA 1QLJA 1YA4A 4IHJB 2X1LA 3SEFA 4AJ2A 3ZG6A 3K71B 1RPNA 1R0WA 2J9XB 5IEJA 1CUGA 1SCIA 1P61B 4L72A 2MSLA 4F91B 3QUBA 2IKSA 5AK0A 4C2AA 2Z8YM 4FE4A 3L8ZA 1O96B 1KEWA 3KAPA 3BE6A 3B3FA 4FK8A 4F4HA 5HZMA 3I2IA 3VC7A 1ZVKA 2IXTA 3N39C 2DERA 3VR4D 3ZWYA 3GFRA 1WMDA 1QU3A 4KU4A 1X1EA 2WK1A 1OAOC 4ME6A 4QFCA 3VU9B 4U5QA 5HUJA 4KR9A 1OT5A 4HFRA 4I4CA 4BX3A 1GUAA 4C4OA 4K0RA 2WVGA 5DP1A 1REQA 1SQ6A 1WB4A 1X80A 4PF1A 2ZB2A 3RM3A 1UOEA 4LA4A 1ZC1A 2P5YA 4D2IA 4A26A 4V2UA 5K8VA 1P1JA 1KAGA 3ISVA 1TD1A 4RK1A 4XGNA 1EJBA 4XOUA 1T13A 3RUDA 3USCS 2K5UA 3E4CA 1OBCA 3WHLA 3ZZUA 4EJ6A 2UYGA 1GKLA 3U4CA 3FNFA 2DBYA 1EAMA 1FLAA 1QGED 4QFBA 3UOAB 3MWDB 4EK9A 1YJCA 1IL0A 3WGNA 3AUKA 4LWQA 1IK4A 3TJMA 1QFXA 3O1JC 3VOSA 4D9FA 2RGNC 1KF0A 4LEIA 4BE9A 4U7JA 1D09A 4G2NA 3DZKA 2Y0CA 3T3MB 4JLNA 1XZPA 5EJ9A 3IVAA 3MT0A 4DC0A 1GL6A 2HPZA 5BVHB 4O4IA 4PO1A 4F1JA 1NLMA 1PZGA 5HBRA 5IJXA 5T4HA 4U3JA 1B43A 3GT0A 3F6SA 3C3WA 4M22A 1E7MA 2OO7A 2ASEA 3GJTA 3I28A 1VKNA 3I5UA 5TV2A 3QZUA 3TFQA 2JI6A 1P1IA 1A9TA 4LF8B 2BKAA 4YCCA 4DMRA 1XBTA 2R5WA 1KA9H 5IYZB 1CIVA 2X40A 2AFIE 3LY5A 1KY3A 2E4VA 1PQYA 1DKUA 1QVRA 1YACA 2FR8A 4OLJA 1B6RA 4URUR 5DYYA 3JQ7B 2I1LA 2LGJA 2QTCA 3CNEA 4QT0A 4DV3B 5ICCA 1ORDA 4N82A 2WIJA 2G40A 2OGWA 3L43A 2VYND 1A50B 5AM5A 3ESAA 1PWZA 1U28A 4UAVA 3D7SA 3BJIC 2R7MA 3CKLA 1X1QA 4KQMA 1WV0A 4Y2VA 1PN3A 2BEVA 5IC6A 4B6PA 2H63A 3K09C 3AXTA 1JG3A 2VJCA 1PR6A 4IVNA 3EGDB 4LYYA 4IZOA 4OJNA 4DJEC 2PKWA 3O03A 4FMCB 1DI0A 3DVAA 4S1VA 3FSRA 3HLKA 3S55A 4DIBA 1YRYE 3ETDA 2CLEB 5JQGB 5DBIA 1IJBA 2VEOA 3MT8A 4NFSA 3KDSE 2O8EA 4OOFA 3D3WB 3OPYI 4ZO4A 1CHDA 2X13A 1SG9A 1ZC4A 3D6FA 2RHTA 1KI7A 2DP4E 4EZIA 2XUIA 4FKMA 1OYWA 4DV5B 3ONNA 1RPZA 3PTAA 1FJ2A 1CF9A 1P1KA 3FG9A 5CITA 4JC8A 1EVEA 5FUXA 3VZQA 4OQQA 5FTJA 3QUQA 2IYFA 1XJQA 3LIIA 2QLJA 1MVOA 1EZZA 1U9ZA 2C3MA 1U02A 4LX8A 2EX4A 4PIPA 4YDHB 2FFBA 3RV4A 3UICA 4F6RB 4WXHA 5IHPA 4GVXA 1PKXA 1RM4A 2H1LA 3V7YA 5JAQA 3PIIA 4QX6A 4ZXPA 5IDYA 4BRZA 5FUBA 1Q6ZA 3B2NA 2QJRA 4WIAA 3MT9A 1KVRA 3ESXA 1LC0A 3FWZA 3PC4A 1T1IA 4G1CA 2J6CA 1OZGA 2N1MA 4OJYA 4BO8A 2QX4A 4X1IA 1NFFA 2LVBA 5EE0A 3I4LA 2QRVA 4JLDA 1T5TA 3CBQA 1GOTA 5MFPA 4CCSA 4LZJA 4KN8A 4POOA 1NRWA 3C16C 3ZZNA 3LJKA 5IULC 1CB0A 4XARA 5EMMA 1E60A 1P2GA 5DBGA 5F4BA 3H2HA 3SCZA 1GXSB 5LFAA 4GGMX 1CT9A 4Q3EA 1EK5A 3LVRE 4MULA 1JJVA 2A0WA 3QTBA 4JR0A 1R4MB 1LQUA 1NX6A 2HSJA 3WBJA 2D59A 2WWWA 1MP0A 3RVDA 3QV1A 2VNKA 3H1PA 4PVDA 3SR3A 1KPIA 3G2QA 3LUAA 3AOGA 4MMYB 4OTZA 4J7AA 5LBTA 5IUJC 1DBSA 1PD1A 3A9VA 3EUAA 2CV2A 1A88A 3A2LA 3H5IA 4DIMA 4HMOA 1U7HA 1DVRA 3R3UA 5ALTA 4DMLA 2G5TA 4WUVA 3P4YA 4QDOA 1H94A 5BWNA 2PU5A 4HDKA 4MUBA 1ARZA 4OMDA 2BFNA 1QRRA 3HACA 3TIXB 4F9EA 5I4BA 3AVYA 2PZBA 1FMJA 4GT1A 5E6UB 4A8JA 4EYSA 1U81A 1KQOA 3BCUA 3FDIA 4H15A 4JT9A 1AGYA 1OUMA 1UAYA 1WKBA 1R9MA 1UDBA 2D5LA 5CA1F 2GHIA 2PUJA 3LOQA 1GPUA 2G6TA 3CG0A 4BAZA 1SBZA 3HWX1 2Z4TA 3JCZA 5JFTA 3KLBA 2PT6A 4AYTA 1G8HA 3OLXA 1Y8CA 4OP3A 2AZ4A 1TVMA 2QAJA 1DL5A 4H0FA 4UTPA 4R84A 3K70C 2XBUA 2WV9A 2ZATA 4BKUA 1UPUA 3DEZA 1QIGA 2I8LA 2QP3A 2WDZA 2YVAA 4UNSA 2NO5A 2I33A 2GHRA 3I1IA 3CUTA 1H93A 3ONWA 3TQSA 1ZYUA 2H4HA 3MSCA 1H9BA 1TPYA 1ZC3A 1WCIA 2PWZA 3PDJA 1EHYA 3WJAA 2GK4A 4K5QA 4FGWA 5B1YA 4ZV4A 2A5GA 5E7MA 3QVLA 3CLVA 4JI0B 2HMYB 1NQOA 2HNAA 2PK3A 3HJCA 3HP7A 4PRYA 4CUKA 4OX9Y 4R69A 4BFXA 2WFLA 3KXPA 4GYKA 3MBKA 1XQYA 3AUUA 1RM5A 3DDNA 2A14A 3CRW1 8AT1A 5LB4A 4MIYA 1ZUNB 2A9PA 1FVFA 3ZGNA 5C8YF 1P73A 3A1TA 3ZY6A 2E5LB 3G88A 1GZ4A 3OHMA 4PX9A 5FTLA 2QVCA 2XE4A 2Y67A 2JIPA 3JXEA 2NU6A 4LNUB 5EP4A 4WCFA 3QP9A 3GGOA 4GECA 2VQDA 2VJMA 2CLFB 3FLBA 4HAVA 3A0RB 3BMNB 4XXHA 4M46A 1RTKA 4A2PA 5IJ0B 1E3JA 4HLNA 4WXRA 5HDQA 1ZITA 3NLLA 4R6XA 1P0FA 2WNIA 3DE6X 2FUCA 4H2DA 3LI2A 1DZIA 3DBLA 3GAMA 3FLMA 4Y1FA 1VJRA 2IYQA 2A9QA 2N42A 2OC9A 5F33A 5JSYA 1ISMA 4RZ2A 2YOGA 1GRCA 3B9PA 1F06A 1MIOA 2QR2A 2R7KA 1MKYA 3NVDA 4P2BA 4BKQA 2OCYC 4EEKA 4ZYYA 1LFDB 3VHXA 2BFFB 4OYRA 3IUBA 5ALDA 2BYTA 1JI3A 3F8SA 4MHTA 4GZMA 4NZNA 3ZXSA 5TQJA 2JGDA 1SCAA 4TS9A 1U9IA 1X1SA 3HJUA 2AVNA 3HJBA 1H2WA 4PAMA 4PXAA 3H75A 1GPNA 1RRKA 5AKKA 3PUWA 3OETA 3Q7PA 4MW7A 4CVNA 2VXOA 3F3MA 3AQIA 2H07A 3A1CA 3LDHA 5ALMA 3TX6A 2JV2A 1KMHA 3M89A 5A2QA 4O29A 2QKYA 2FMIA 4AJHA 4MPJA 2X0RA 2LNDA 5DFAA 1X7YB 2JZOA 1CLEA 2Y1WA 3VTZA 3GDFA 3VU1A 1KQGA 1C7QA 1KEUA 3WK7A 2XWSA 3PHHA 1VA5A 3Q3HA 5EHXA 5KREA 1IHYA 1X7HA 1Z0AA 2PMDA 3NS7A 3UMJA 3ICPA 4CMGA 1QH8B 1SVKA 3GEIA 3EPHA 1MPXA 2FWPA 3K8ZA 4LN1A 4MMZB 1KC1A 1FLDA 2FX3A 1NR1A 1JALA 4LMBA 4DQ0A 1I36A 4UNQA 5F35A 5AT1A 1XHEA 2X0NA 1S2LA 2W2LD 1KVQA 2KSQA 5EWLB 5KDOA 5ILQA 2QTNA 3C4VA 2V55B 3H6KA 3HFSA 4PGMA 4AECA 3AGQA 3C8MA 2XBLA 1MJ5A 4IZ6A 2XWBF 2RFLA 4JLPA 2PTHA 3B6IA 4K81B 1QIDA 2YJ5A 5AM1A 5JAUA 2HU2A 1V11A 1YBFA 2QR5A 3U9TA 1N2BA 2IU0A 3PQ7A 1L4MA 4Q7QA 2IHBA 3H19A 2RGBA 1PLKA 1NMXA 3O4JA 1ZMBA 3CZ9A 4WN9A 4HDMB 1MZVA 5HFNA 2Z56A 5AK3A 3WYCA 2Q19X 2EAUA 4DLRA 4Q1VA 4L3WA 1BMFD 2R68A 4ZICA 2GBLA 1SZPA 2CHQA 3L6DA 1O54A 1YZKA 2NXJA 1ULHA 1Q3HA 2VXYA 2CUZA 3DEIA 4OMUA 3AHFA 3ZLUA 4EG4A 1SOUA 3MZ0A 2BFPA 4CV1A 2AJLI 3IQIX 2B21A 5J5VA 3ZX5A 4PWYA 3ZOKA 5KIAA 4HRYA 3L1VA 2B25A 1CNMA 3R0IA 2V3CC 2PSFA 1NSYA 1IEQA 1GA6A 1WVMA 2AX4A 2C2BA 2PMKA 1U0EA 1NM5A 2V3WA 2Y66A 2YXEA 3P9CA 4OAOA 4Q4DA 5T3UA 5E8RA 1R6AA 2O3JA 2I6SA 3DE0X 5KZMB 3W4JA 3ORYA 3W8EA 3ZWDA 3FUWA 1DQNA 2W2NA 4OD0A 4EB8A 3T3DA 1QP4A 4X8OA 2OV6A 3ZY5A 1YR9A 3GW8A 3U7QA 2FZWA 2Z1DA 4DUGA 1BGWA 1RJDA 3N8NA 4R83A 3FHTA 3E27A 1OD6A 2EJTA 1A76A 3E82A 2FMFA 3GVIA 5HQ3A 3B5JA 4H08A 4UQOA 5CB4A 2FETA 4IQ4A 4NDAA 4OGGA 4LY6A 3S8YA 3O8QB 2DVMA 2G70A 4ZEVA 1VE9A 2YDXA 3FUCA 3OSZA 3EA4A 1GZ6A 5AD1A 3D4NA 1I7PA 1L4GA 1VJDA 4MI9A 2FMTA 2YN0A 3Q7SA 5A5FA 4IVQA 5IDXA 3MBOA 1SHZA 1X2EA 4EG5A 4ABTA 2WRZA 3QOFA 1LK7A 1SD1A 2R62A 4ZOLB 3VC1A 4G9EA 3WMGA 4ZPJA 2D00A 2GEFA 2FEMA 4QOIA 1G20B 4NZMA 2HIMA 4BMCA 3AU9A 4MUIA 4C0BA 1GR0A 4JU9A 2Z8XA 4HQ6A 1HLGA 5JZ9A 1E4YA 2WIKA 4MH0R 4YRAA 1TTQB 3WB2A 1FXSA 2IGTA 1MJGA 4BO0A 5K3OA 2A5DA 5J3JA 4W63A 1COWA 2QLBA 3DZ8A 4DN6A 2O7RA 4EVQA 2PUWA 2I4RA 3N74A 1Y89A 5J9FA 1Q2UA 3EWAA 2C78A 4QL3A 2IPXA 3S29A 4UU1A 4BFCA 5CCXA 2R5NA 3CFYA 3FYSA 4BIMA 4EI9A 4RULA 4GBGA 4RTLA 3V4VB 4AK9A 3GT4A 3T5AA 3CCFA 3F6BX 3CF0A 4BZZA 1AQUA 5MHTA 1K7SN 1XG5A 4ZV7A 4QDZA 4X1OA 3VUEA 4E5VA 2Q4BA 1MGOA 4G36A 1QHFA 1ZAYA 1SC1A 1ZCBA 1JGTA 1JIQA 3E9ZA 2F67A 1L8XA 2NYAA 4CLOA 4KCGA 1KIMA 4YCDA 3SM3A 2PBFA 3S7TA 4TQUS 4XX1A 3HCEA 3TRIA 2YJZA 3E1KA 1EK1A 3NVMB 1FZQA 1GN9A 1ORTA 4JLKA 4Z3KA 1XKQA 3BF8A 3AO0B 3KQUA 1DAFA 2CUTA 2JGIA 3PFKA 4IAOA 5AUQA 5JEEA 1BKDR 3A32A 3NEAA 4C7MA 1M6VB 3ITKA 2QJFA 2YHIA 4M54A 5BT9A 1HY3A 2CD7A 3G79A 3UT6A 4B3HA 1E1QA 3U7RA 4TKVA 3W9YA 3BH7A 2NVUB 4XCVA 1ZCAA 2COKA 1TKAA 4B0PA 1XEXB 3HBAA 2WTMA 3MJRA 4FYJA 3GP5A 3EHEA 5CP8A 4EHKA 1K2VN 3K9BA 4OV6B 1E9RA 1H1DA 2F3RA 3R4CA 4N0DA 2ZI3A 3DMFA 4NU8X 2I99A 1Y0BA 2UUPA 4RFSB 4KQ1A 2NQ2C 1KO7A 2XRFA 6LDHA 3FNBA 1E6KA 4LFCB 4DV4B 1OV4A 1ULUA 3DV9A 4RGQA 4XJSA 3TK1A 3AF4A 4AP6A 3K70B 1NL3A 1VHTA 1SQ0A 2E4WA 3UV6A 2IEBA 2ZBPA 4I3FA 3RVMA 3T1YB 1EDZA 3VKFA 1U0BB 2EDCA 4B6EA 3IIJA 3AR5A 3EVEA 2OESA 3LC1O 3G0OA 3C6XA 4OU5A 3DTYA 3A1DA 2QYTA 2GZ1A 2RGYA 1MIHA 4L8WB 3AP2A 3HXQA 1ZMXA 4NBTA 5ALPA 5TRTA 3IPCA 4A8PA 4INZA 8ABPA 2CWWA 1B3RA 3HWRA 1U8EA 2W2QA 3L5OA 4U8GA 4XGKA 1CQPA 2BHLA 5EVCA 1MLDA 3T12A 4NHEA 1B42A 1Z26A 5C7OO 1UDXA 3T38A 1GL3A 5EIBC 2QRMA 3B8HA 4YRBA 1X7ZB 4HQOA 4J9VA 2FN7A 3FLEA 5GONA 3RC1A 1OAAA 2ZYHA 3R9XB 2BMJA 4P31A 4GE0A 4NR0A 2VH5R 4NV0A 1XFAA 1N2IA 3V7FA 1FB5A 4QGAA 5JVDF 2ZJ4A 3R0XA 4BFLA 3GFPA 2QQ0A 4PYQA 4ZU6X 5INTA 1V6AA 4OOEA 5K9ZA 1IBKB 2IYPA 2C3OA 3W9SA 1YMQA 4YV0A 1QHNA 5CK5A 1IUNA 1EPUA 5FNVF 3TG2A 5JV5A 1OASA 1CZNA 2P8JA 5JWRA 3JQRA 4DANA 3NTRA 4O4HB 5EE5B 2QX7A 5THKA 5L3QA 5C4IA 1IC6A 3CN9A 4D9CA 3KXKA 4O63O 5B7GA 3OP4A 2AWOA 3LUKA 2C99A 4UXIA 4ZT4A 1KWKA 1PNTA 2O3TA 3HY4A 1KWGA 2AC4A 2VYVD 2WYUA 1UPAA 4QVGA 1RLOA 5G0VA 5LA6F 5FLXA 5I01A 2ZM6B 4FCVA 1JBEA 2C3YA 2XOEA 2ZRJA 4IQFA 1G63A 4D9IA 3U37A 1QGAA 2HA6A 4WZAE 2BBSA 1UXJA 4GBED 3PX7A 3OH8A 1P0PA 1ZNQO 5C35A 2HA3A 3E70C 2OPBA 1CYEA 1YHYA 1QHSA 4ITRC 5DNYB 3WLOA 2FSUA 1YGPA 1U7DA 1UR5A 2V3VA 2JAOA 1A3CA 3AK4A 5AKEA 1A7KA 2GN1A 1KAQA 3ZVMA 4ENPA 4F4JA 5JC1A 1VPWA 1K5PA 4PYIA 5G3ZA 2IBMA 3I9LA 4LHZA 5DW0A 1F6BA 1G8PA 1GQ2A 1E1RA 2G04A 3AF0A 1IVSA 5CT6A 1FNCA 2OILA 2R60A 1IHDA 1O0SA 3GIDA 1RFGE 1WLSA 2NXNA 3A37A 2PJHB 1C3JA 3AZPA 3I4FA 1CE8B 5AHWA 2BGWA 2PZKA 1EM6A 1BROA 3HADA 2EHJA 1QRDA 3FCSB 2WA2A 4WOJA 2A84A 2BP7B 4OQEA 3R75A 2KHZA 4AMGA 1B76A 3JVIA 1AQYA 5J2UA 2BSXA 2FPSA 2P0YA 2Y9PB 3E2PA 3W2FA 5CXUA 1BMQA 5K8CA 1Y1SA 5LQCA 1EVQA 4JEUA 1V7CA 5IAJA 2HF8A 2AC7A 4UUMA 2QUJA 1GNPA 2V7XA 1WABA 4B2YA 1E20A 2GGSA 5JJBA 2P68A 3CCBA 1BS9A 1W4RA 4J0QA 1KYZA 2YNMD 1EUDB 1IAQA 3WZLA 2FSPA 4HS4A 5J4YA 1D7OA 3RABA 3N8DA 4XEUA 1MFZA 3OF2A 3JX9A 3U3ZA 1NR5A 1PDWA 1UODA 2FG7C 3LUCA 4UVEA 2HGSA 5G40A 4EA6A 2CZGA 3P32A 4Y1GA 1A9ZA 5IDVA 5SYNA 2ODTX 2EG9A 2MMCA 4BJHB 5KQMA 3KWJA 1QGOA 3W78A 4AY2A 1J0XO 5EZQA 2YY7A 1YTUA 1DE0A 1E9EA 1F2TA 1OU0A 2YZNA 2LKCA 3Q0IA 1BD3A 4Y0AA 1RPJA 1FW6A 4PS0A 3DCIA 1NUHA 1I0IA 5EG5A 5C7IO 3GLSA 3AIIA 3Q6IA 5C37A 2VHZA 3K1YA 2FHSA 3P2JA 5AKYA 3OC0A 1JSZA 5TXGA 3A6ZA 3GRPA 3T5CA 3FROA 4M89A 3OG9A 4C2TA 1M1XB 4JJFA 2XI4A 1H22A 2B3DA 1ISIA 1HV8A 4XQ0A 4DSNA 3WLHA 1F0PA 2XJ4A 2VSQA 3OQIB 1UADA 1X39A 2ZPAA 3B1WA 5CD1A 2CL7X 3AR6A 1XE3A 1HEUA 2VUUA 2AFHA 5BORA 1YE3A 1BA3A 4E5PA 1ZK0A 1A04A 3MOIA 4IINA 4KE6A 4L4RA 1PL6A 4COOA 1PVDA 1NQXA 3AHJA 4H16A 1XVVA 2PWBA 1ZLXA 2AFRA 3G5MA 3H9QA 1YVPA 1G5RA 2Q3BA 3GLVA 4E88A 3CNOA 5D1HA 1DXOA 1NLYA 3FB1A 3I2HA 4EATA 4N5IX 1U8FO 1SRQA 2AF3C 2R00A 4NCKA 1F20A 1P9LA 5JVDB 2WAYA 2JFYA 3ZQUA 4TTSA 5K2MA 5IG2A 1G7CA 1M1YB 5EPPA 3JYLA 4LOIA 4R1LA 3U1VA 1RYHA 4ALJA 3C39A 2XMSA 1GZDA 1NBMD 2IXGA 2QRZA 4FXPA 2ZWAA 1SFRA 1TJPB 3KRTA 3IP5A 4B75A 1JXOA 3NALA 1P3JA 1MUUA 4KDCA 3PJDA 5FI0B 2Q6IA 3JPYA 1LPMA 3X1MA 1XP5A 4NENB 4TVBA 3KUDA 3G8DA 5G2OA 4CTKA 2RHCA 2M6KA 1RJ9B 2CBZA 4J91A 2AR7A 2C04A 4GF5A 1QIEA 1R6TA 5FPTA 5A3JA 5JY1A 4NBNA 4TQAA 1Y6QA 4M1MA 1NULA 1E2MA 3U3RA 4TVKA 5EGSA 1E59A 3VOBA 3EX7C 2OLKA 1N6RA 2E4AA 1UBKS 2BMDA 3KYBA 4Z0NA 2QG9A 1RVDA 1XJ0A 3RU3A 3URKA 5I7RA 4IYRA 5JNRA 1U3VA 2BGKA 2OAEA 3CZPA 2OYRA 3UT0A 3A9CA 3GRAA 1MDFA 4NONA 5BSTA 2AMVA 1SIBE 1TUBA 3HNPA 4NYMQ 3WTCA 3WLLA 3LUBA 1QP0A 1E9FA 4JELA 4Z4EA 3NH6A 1GNTA 5HJ2A 3L1UA 3UWPA 1V5EA 3JQBC 2RKBA 4RSHA 2JK1A 1XNHA 4HYQA 5AJUA 4MVJG 3SR0A 2R79A 1T0JB 4R1PA 3LT4A 3CRVA 2JEYA 4JX9A 3R8XA 3STVA 4N1AA 5BNWA 5CVTA 3PXXA 2JLUA 1NMSA 3GDHA 2NT3A 1OY1A 3AESA 2CDBA 4ILKA 2CLCX 2C8LA 4GMGA 3U7HB 1PGQA 2A78A 2FPXA 3ONDA 2YUTA 3BGVA 5DX1A 3KWMA 4XIIA 1MTOA 3R7LA 1U4SA 3LYUA 3SI7A 3BEDA 3L7IA 5K3FB 3SPXA 3KOYA 2QVLA 3QVXA 4MPRA 5BW4A 4JJ8A 1IBMB 1OXXK 3OLVA 4DAEA 4EPXA 4XRGA 1DG1G 1LBEA 3NIDB 2R8ZA 2C1ZA 2HHLA 3KAJA 1Q0LA 2CMFA 3QXGA 1NMEA 3ROQA 1G64A 1LA2A 2DPHA 3HYLA 3WGLA 4LY0A 5DMXA 3IDZA 5LUAA 1BNCA 4N12A 2ACKA 3O21A 1FP1D 4PLTA 1XZHA 3R7NA 4GHWA 1F12A 3BIJA 4DLSA 1KR2A 2PUEA 1J56A 4LZNA 2ZJ6A 2YOHA 4A92A 1VKRA 3TQQA 5KNDD 3K6SA 4GWGA 4AQYB 2XB4A 2WUFA 4BLVA 2AOTA 4ZA2A 1DRVA 4JBGA 4DSAA 1TJYA 3M5WA 2DY0A 3RS2A 4JJ6A 4MW5A 5JCOC 3G2KA 3R20A 2B98A 5A3RA 1IBLB 1WX1A 1MZPA 2O19A 5LU8A 2X8JA 4YAFA 3NHUA 3VR2D 2R6R1 4R0MA 2YS6A 2AL7A 5E6RA 3N75A 2VCYA 2I4IA 1N5JA 3BWMA 4PFKA 5GOTA 1JI0A 2JFNA 4P4TA 1XDWA 4UBMA 2VUSA 2VHQA 4B3XA 4OK3A 2ERCA 1XZGA 3WR5A 2WSBA 1UZMA 2I3AA 5H9WA 4DPLA 1G7TA 1WTCA 5BR7A 1OF1A 3D6NB 3KTAA 1DBIA 4QQRA 2VJNA 3VXKA 1FMFA 1YQDA 2PUHA 4IEIA 2ETXA 3LC0A 3SOPA 4K0KB 1BHO1 1NNI1 1KBZA 2JBHA 4G1UC 1GHTA 3GRFA 3WQQA 4BB0A 4ZQEA 5DYIA 5DO9A 5JAMA 3THRA 4BLUA 4DXDA 3H5OA 3L49A 5G4LA 3NJ4A 1U7UA 4B9AA 2CJXA 5B3LA 4BWYA 3ZV3A 4G8JA 4O4LB 4BVHA 3V1UA 1T9HA 2O3SA 1P5ZB 1QO9A 1UKAA 1QR2A 3LCRA 2VR1A 4Q4JA 2NO4A 4IJWA 4P4UA 2QIPA 3ZYCA 2Y27A 4TLAA 4YALA 1T2AA 2CXUA 4ZJPA 4XVQA 4LWOA 1QCSA 2BCEA 1A69A 3OX4A 3X1JA 4ZZ1A 1Y8AA 9ABPA 1MXFA 3ABZA 5JPIA 5DM60 4ENRA 3QEBZ 3B5EA 3L0OA 4O08A 4WZZA 3PCTA 2NPOA 3FKQA 3OEHA 3ZX4A 3B1JA 2BFMA 3EZFA 3O2NA 2J7PD 4IVPA 3RTEA 2EFDB 3BHNA 2X4LA 4H3HB 1CFJA 1JF8A 2YZMA 4F3TA 1I6LA 2HGZA 3OA0A 2GPBA 1SJ9A 1P2DA 3GMSA 5A05A 4HNQA 3GPLA 3HDVA 4DA6A 5LVAA 3KSBC 2OXFA 3EGEA 4EY3A 4ZHSA 2ZRDA 3AGPA 1GG5A 1ZN7A 4AUEA 3D4LA 1WY5A 1D1SA 2OZKA 1EE9A 2QV7A 4UHBA 2A1UA 5GV7A 1W25A 2SKCA 4N41A 3GMDA 1R8JA 1MF7A 4Y2GA 1A0OA 1QG6A 2PUTA 3N05A 4ZT7A 3S81A 4B81A 5DWVA 1VBMA 3R0VA 1XV5A 5KYUB 1D2HA 3INRA 4Z1MD 121PA 2PWAA 1YB6A 3G2NA 1KK2A 3DKRA 3R7WB 2B8JA 1TAUA 1PT7A 4KN6A 1U1EA 5A9SA 2JD2A 2EQAA 1UP4A 2BFEA 4YRDA 4DBZA 3A1NA 1VYTA 1JHXA 1EM8A 1XU7A 3L8HA 5GZ3A 3FRIA 5JYBA 3SKXA 4ZDIA 5GWXA 5EJ7A 1HGXA 5AK6A 2I9KA 3LP5A 2K4MA 2B1JA 1IY0A 3R7DA 3MPOA 4LFBB 3KYCA 4YQZA 1M76A 1OBFO 3DP9A 5IXSA 3U0VA 3BK2A 5K45A 2GJ8A 1XQVA 4KXUA 3TWOA 1K4KA 1ADJA 1K6IA 3MAGA 1G5QA 1GFSA 2BUAA 3I09A 4KAAA 5FOWA 1IEXA 3E0QA 4C08A 4D02A 6AT1A 1U31A 1MABA 1UMDB 2ZIGA 3LYLA 3OWOA 2R1TB 4GP6A 2G9ZA 2DFDA 2FVYA 2V9PA 3NYIA 4O2AA 1E4EA 4J07A 4YREA 2OC4A 1XZLA 4PCLA 2GFAA 5AHKA 3SBOA 2WTNA 3NOQA 3DWEX 1I5RA 2C2MA 3IEUA 1YDFA 3STHA 4N6NA 4AY3A 1RQGA 2W6ID 1IN5A 2Y2UA 3WG9A 4C07A 4EKNB 1MAHA 1FMLA 3V1YA 2OD7A 1XLTA 1X9HA 3CJRA 4GKBA 4REQA 3FTNA 3LHIA 1SXQA 1N9ZA 2C00A 5ICMA 1QRSA 1VI6A 4LDRA 1VYVA 3AFOA 4AJ4A 4UBLA 4KE8A 1M0TA 4PRZA 3K1ZA 3WLRA 3H6HA 4FZ3A 3W2EA 4EZEA 4HVAA 5CAEA 2AMYA 3GNQA 3WLMA 2V8OA 1F0KA 1DELA 2VF2A 2HQSA 4UE6A 5ILOA 1SH7A 4R3WA 4KPUA 3AEXA 3H8VA 1FNBA 1ACLA 1I14A 5F5LA 3WFIA 5FBKA 2DULA 4YAUA 1Z5VA 2OKCA 2B94A 3V4LA 4R8LA 4IBOA 3U6KA 2QJTA 3F9CA 5ESDA 2IHJA 2ILTA 1SWVA 5MDHA 3V1NA 3N2IA 3OTQA 2OD2A 1LTQA 1TEHA 5FOVA 3M3DA 3VVLA 2JZNA 4RD6A 2JK0A 2DZDA 3VSCA 3KB6A 1JR4A 4QSHA 1QCCA 4Q7EA 2O6LA 4TM8A 2EJUA 4LXGA 1MEOA 2PS0A 4IUCS 2ZITA 4O2BF 3INNA 1XZBA 5DTJA 2IF2A 3LK6A 1F4PA 1HDXA 3IQEA 3N5CA 1FDUA 1ZD1A 1WLYA 4L1KA 4UCWA 1CS0A 4KG7A 2FWAA 3I0ZA 2GDJA 4DLYA 1DKNA 3G5UA 2XCQA 1PZFA 2C88A 5D6XA 2IHVA 2WIAA 3M1AA 3K7EA 3OIVA 3TSCA 4K86A 2VBCA 4ZMBA 1TVKA 1MOZA 2XUFA 4YAWA 4IDNA 3TLGA 4A5OA 3N2EA 2PLWA 2WBLC 1GZ5A 2ODPA 1XQ9A 1FYVA 1LUAA 2WB2A 1IWPB 1ENOA 1W0KD 2Q4OA 2QMYA 5LMUB 4B4DA 1TZ2A 4YDQA 2YY6A 2XHEA 2O2HA 2VDVE 3A3YA 1KO4A 2GBFA 3WB0A 4EFDA 1P0QA 3TO5A 4BNFA 2IRWA 2QF7A 4PGGA 4XDGA 2QN9A 5LBUA 5EUBA 3QU4A 5DSTA 1IDOA 2M6SA 2EEPA 4J0CA 1XTUA 3BAFA 1ZISA 3PE4A 2JIMA 3PT9A 2ZRCA 1KFJB 4WLVA 2J7KA 5BN3B 5ELLA 1ZIOA 3JATB 2WWHA 1WZNA 3RTCA 4JQYA 1KNXA 3AR7A 2GZAA 3NTLA 3R8CA 2OXCA 4CG0A 1E3QA 4YLEA 1UC4B 4RDIA 3G2HA 5KQGA 1O8BA 5ENDA 2OGTA 2JATA 2ZSHA 1GRNA 3LUFA 3NHMA 4G5SA 4C7VA 4CKCB 3UHFA 4EFMA 3MUNA 5EZYF 1KY2A 4DJJA 3IA2A 1CDEA 1SHUX 1WQ1R 2Y9MB 4L9WA 4RANA 5K4HA 1DQPA 3GNTA 3LQ1A 3M6IA 2DQ4A 4FDTA 1XZKA 2PAFA 2GJ4A 4GC5A 1E79D 4K2HA 3IT3A 1J0CA 1VLZA 2BBWA 2H7CA 1F8YA 3ASVA 1C7IA 1H0SA 1U2TA 2VDPB 3TLEA 2W8BA 2YWHA 4QOGA 2CMHA 1YZHA 1FXWA 2QMZA 3M4YA 5HIKA 2B36A 2G5CA 2E4UA 1OFTA 4KVAA 4X7MA 5MN5A 3IOCA 4JXJA 4XFDA 3R5KA 3RS5A 4EA8A 4F72A 3ZC3A 4EM6A 1J8MF 1TM3E 4DCGA 1A9YA 1WZEA 2WM8A 5CA0A 1EXDA 1L4HA 4I99A 3CEAA 1SURA 1JXMA 5LUBA 4FB5A 2F00A 5FLEX 2IIQA 1N2EA 1PQ4A 1BRMA 3OFVA 3ZIUA 4W9MC 3O4VA 5EVJA 1E9SA 2KBEA 5DWQA 4QXOA 4ARBA 4BLPA 2QTFA 1ZWKA 3QE3A 5CFQA 4OUDA 1A4XA 3ZQJA 4BEVA 2IV7A 4EG7A 4AKEA 1WOYA 1XYVA 4PNHA 3ZWBA 3A2MA 2VRNA 1YRQA 1QHHA 1QZ3A 4Q93A 1DEOA 1U5BA 1KDTA 3HBJA 1RE0A 1U1CA 1UWKA 2QPLA 4ROSA 1P7ZA 3A10A 1CP2A 3HP1A 4PX2A 4AU1A 5DNDA 3E53A 2X15A 1BVRA 4XDYA 5LLSA 4TRJA 1DKLA 1O08A 3IBGA 2F4VB 1L8LA 2EZ4A 1VB3A 4ENTA 1OQAA 3NZEA 4P84A 4ZVQA 4IIYA 3Q10A 1WB9A 2Q3FA 3FVQA 4GXNA 4OK6A 2OVBA 3DSRA 2BE9A 1H69A 1QHXA 2WTAA 4FGLA 3FVTA 5EC8A 3F73A 3ORSA 2ZXFA 4GP7A 4C22A 2D62A 4J8PA 4FCCA 4R5MA 1QAQA 1QAOA 3INTA 2WKRA 4CLHA 4K9RA 1OJ7A 1TCUA 3I6QA 3ZE1B 2JEZA 1U0NA 1SOWA 1UBEA 2C9YA 3HHPA 4BVEA 2LUOA 4JXZA 2FPGB 1Y7LA 2FR8C 1OX6A 1TF2A 2QR3A 3DKKA 5IVHA 4XGRA 3S7ZA 1GLGA 3CX3A 1KY5A 2IW3A 4YUWA 2QL7A 4O2BB 1DIHA 2HDHA 5CBPA 1A72A 2OQ2A 3A58B 5JEDA 1HQCA 1U28C 1TC1A 1VIVA 3H4MA 4U2FA 1BCSB 2XGMA 3PKJA 4FEGA 1NF2A 4NG5A 3KKOA 3LC7O 3RTGA 3T7CA 3SBXA 1UBHS 3H2JA 2ZYIA 4JIGA 4YJ3A 4HG2A 4XKJA 2H48A 1KE2A 5B7NA 2V7TA 2XDPA 2WAOA 2ZXEA 5KYWB 2C03A 1R0YA 3LT5A 3VR6D 2FN4A 3M1IA 1Y9DA 2GF0A 5F1PA 5JNTA 3TXXA 4C01A 5A5EA 1VJGA 4J1SA 1EK2A 1BWQA 2NTEA 2GKOA 2W2MA 2QYHA 3QI2A 3PEWA 3ZGZA 1JFRA 4HGNA 1JQJC 1M9NA 1YBVA 1JDUA 1P7PA 1TO2E 1LDMA 2QMQA 3OQOA 3FYCA 5CVVA 1OHHA 3AEKA 3OEWA 2YS7A 4WXPA 2I4TA 5F1OA 4BAUA 3L93A 4BVFA 3KPJA 4NMLA 3RO7A 3GX1A 1SHLA 3FN4A 4MO9A 3UXHA 5LP6F 2OPHA 1LNZA 3K20A 2XDQB 1L5GB 3BILA 4F7DA 1YZGA 3FPAA 4FI3C 1XKTA 3DTVB 4JZKA 4LC1A 3ASUA 1NN1A 1EFDN 1Q7GA 5KWJA 1IUPA 3F4KA 4Q6WA 5G41A 3TRFA 4BMNA 5B4VA 4MXDA 3U4AA 3TIIA 3Q8KA 5IJAA 3UK1A 1N0HA 3OM8A 5HUQA 1TNDA 2P4QA 1PLLA 1U3WA 2A9RA 4G0PA 3EOZA 5ESRA 3PDCA 4DR3B 1IXKA 1EDOA 2YRFA 3C5WP 1A5BB 2VK1A 1EUCA 3OZTA 3L7LA 5IVIA 5KX5A 2ID4A 4N3BA 4W1QA 5FBVB 2PRZA 1P33A 3FNIA 1SNYA 3G0GA 3IP8A 4QUDA 4GSYA 4G4SO 4RE6A 4O3MA 1RWOA 4CQMD 4DTIA 1UC9A 1H05A 1OXKB 1WVGA 4A1FA 4B80A 3ZKWB 1T36B 4JHLA 3GEGA 5KQPA 1TW2A 1XI2A 4WDRA 3N2KA 4F5YA 1KI4A 3GLRA 4I2VA 5KOHA 3TRHA 2I4OA 2I7TA 2QVZX 4NL4H 3CR3C 1VPDA 3P96A 4GI5A 4F4CA 1U7ZA 1UK7A 3PNBA 3P9KA 3LYAA 4RPLA 3E1SA 4TT8A 1ECJA 3KJGA 1GAQA 1H2HA 1GAWA 4O0MA 2PGDA 1JX6A 2WKWA 1CJVC 1KI3A 4U7GA 4R1TA 4CEHA 1PFYA 3SNHA 5IZ4A 1JSXA 2AMFA 2JJMA 1O3YA 2PH3A 3SN6A 1WSAA 1C1DA 1DZ3A 1QNFA 2ZDHA 2H1SA 1GYRA 4D4HA 2YHUA 1FSZA 1JG2A 2ECQA 4NPHA 2FRDA 4MGKR 4MV4A 5EIXA 1DFIA 1LS6A 4RTQA 2WHQA 3OJOA 4E70A 4G24A 4A8JC 1ML4A 3QWZA 1ZICA 4S1TA 4AY5A 2WG0A 4YP7A 1K97A 4P4SA 4CF7A 3BZBA 4FMDB 1UXKA 3FPTA 4N40A 4PNEA 2WB4A 3QPUA 4JJIA 4RTKA 1XD2B 2YTZA 3GVHA 5CM2Z 5IM5A 3SOZA 1I6WA 4YPFA 2QXYA 3OQMA 4Q7MB 3GPCA 2B5VA 3I39X 1HR0B 2B1GA 2ZTLA 5EXSA 3G2LA 4L8GA 3DE1X 2VHWA 1N2CB 3PUKA 1FTSA 4LOJA 4W8GA 5EESA 3ZJ5A 4E13A 5ED0A 4EYKA 1R5NA 3NNNA 2VRCD 8GPBA 2G8LA 2H4YA 2MSEB 3DB1A 3N0VA 3SZRA 4B47A 5IM4A 2Q6LA 1GQOA 3I04M 4YCJA 3WKEA 1D6SA 4YWJA 1VHLA 2B7CA 3AUSA 4KR3A 3ND6A 4R2XA 3GA0A 5J1SB 2OV3A 2B4QA 4U2GA 4JVOA 2HAEA 4W9NA 4DARA 5JY6A 4DV6B 3S3TA 1HTTA 1Y6ZA 4M0UA 3NH9A 4TVSA 1RZUA 3HGQA 3N0TA 4Q9LA 1KJ8A 4C0KA 4K2AA 4E5UA 5TQ2A 3ZWOA 3LZ6A 2A1IA 2Z4RA 4TPKA 1IG3A 2PRYA 1GSOA 1SKYB 3OCWA 2EW1A 3U4IA 4C14A 1AT1A 1TF7A 4QOHA 4CNQA 1GZHB 2GVZC 3DFKA 2PZEA 2IYWA 1BYUA 4FEEA 1RZVA 4WCFC 4MKGA 4O6VA 4ZO7A 1E2KA 1Z5NA 2NTNA 4D8WA 1YZNA 5E9JA 2VH1A 4B3SB 4ZCPA 4HB4A 5D1NA 4MOWA 4PZDA 5GVSA 4G5HA 4H1TA 1P7WA 2JAQA 4PC6A 2ZAGA 2EJBA 3I9KA 3JZMA 3QY9A 5EJGA 3ZD8A 1G5TA 4BNDB 4F3YA 5AW3A 1NN0A 1HNXB 4TWZA 1KZ4A 2LD4A 3FZQA 621PA 1KL7A 2WQ6A 2NU8B 3SZUA 5D6YA 3QELB 4KR2A 4ZDWA 3JW8A 4JKYA 3VPBA 5LD2B 5GADl 4WT7A 1U9IC 3I5AA 5B3AA 2C4KA 3KDAA 3H3XA 4LXIA 3UCEA 4Y2TA 1UMBA 3H18A 4TXLA 5U4QA 1D0VA 4ND4A 1XLVA 4FX2A 1PVVA 2CMDA 3L7BA 4GD3Q 4LJKA 1XDSA 4KO1S 3IBTA 3GOHA 5BVGA 5CH8A 4KNWA 1V71A 3OU7A 4YY3B 1JHYA 4YUAA 2PWYA 5BMOA 2VHTA 2AD5A 4KYTA 2C83A 3COJA 3OJCA 1A98A 2VP9A 1KEEB 1X9IA 2F43A 1W4LA 4LC0A 2QMHA 2R6DA 3HGTA 2VCHA 2AUTA 4M9RA 4MQLA 2YVKA 1HYHA 4NJEA 3AFGA 2F3QA 4CV2A 1X80B 3TVDA 4LDAA 2Q21A 5EIFA 3NBAA 4MUKA 2PSDA 3C7KA 1U2DA 2H9YA 3GJ4A 5TMEA 5CFOA 3RBVA 1YJXA 5JRJA 3HCAA 4TSRA 4DQKA 1PEAA 2JDIA 2XNDA 4URXR 2HREA 1GUDA 1ZJ4A 2H2GA 2VDJA 5JBNA 1WPRA 4ASUD 4KYVA 4E1AA 2X4IA 5TSDA 1ISPA 3V7WA 4MWZA 2Q3LA 2AOUA 1LPSA 1ZGHA 1K3UB 1JZTA 1O94A 1Q1ZA 2CNWD 3JWPA 1GPKA 1M1UA 2AXNA 3JD4A 2YICA 3MIZA 3SBDA 3NBUA 2R7LA 5DYWA 3ZNPA 1IIRA 3HXPA 1TO1E 3M5PA 3FHCB 4RX1A 4K9NA 1JWBB 2QM0A 1G4HA 4LHWA 5F3WB 4XYMA 3V2HA 2WF7A 1MBZA 4J4TA 4EHJA 1F8XA 2IYSA 4DMCA 1R0KA 4Q1CA 3IVXA 5AIBA 1Q7TA 4O4IB 4R1MA 3WYDA 4WCDA 4AKGA 2Q0QA 2Z4SA 2H1HA 4W99A 4X62B 2P9EA 4GIBA 2VDKB 4U3JB 5JWHA 1S3GA 1HC7A 4V24A 1QU2A 4XM2A 3MCVA 5TPZD 3GROA 3UJCA 4MRMA 4EPYA 2GBLC 2QUZA 4KMOA 4OGKA 5C5EA 4J0EA 4FT2A 4FYHA 2ZS7A 1RCTE 5DK6A 2YQ4A 1L1RA 5JXGA 2DG2A 4FZRA 1J97A 4H7FA 2XBMA 5D5QA 2YKGA 1Z12A 3QVUA 3GUHA 1G6OA 1W5BA 1OLSA 1C3VA 3NPAA 4XUEA 2X4GA 5F51A 3T35A 1MDBA 1TU0A 3EGXA 3FW1A 3IUQA 1NM5C 4O1HA 2FPLA 5EXDA 5J59A 3KG2A 2EQBA 2BEVB 4FHCA 1E3DA 4ZZIA 2QQRA 1SBCA 4IIUA 3LVQE 1K75A 3LRTA 2NN3C 1DTWA 1ZXBA 4DDUA 3DVAB 2FW8A 3UUWA 3LQ4A 4KQ2A 2XADA 3AM5A 4ETWA 3Q1KA 1W4CA 3UATA 4G5OA 5T4EA 4OXKA 4MRPA 1M72A 4IKPA 4JJKA 3HO1A 4D9NA 4GMXA 1WULS 2IYYA 5KNCD 5J40A 1ZBDA 3TDNA 1ZR4A 3L0YA 3V80A 1HOTA 1IB6A 1RM0A 5FWXA 2QT9A 1Q83A 2XMRA 4QZVA 3W5IA 4QARA 3DM9B 1VMDA 1GNRA 5DI3B 4RMJA 4MQ4A 4MLPA 1ZEMA 2NAFA 2XQIA 3SXUA 2PE5A 1CZ5A 4CUJA 2CHFA 2FN3A 1R1DA 2O57A 3G1UA 2I5PO 5CVEA 3R3SA 2G08A 2UKDA 3KR1A 5LYJB 2Y99A 3MMXA 3UAXA 1K7CA 1HUQA 4DCMA 1YB2A 4HDSB 2C5LA 4KZPA 5ALZA 3VNBA 1PYOA 4I5GA 4JCOA 1J70A 4U2EA 1CF2O 4U7TB 3IUYA 6REQA 1Z4PX 5BMVF 3ZPXA 3R40A 4PU0A 5EIEA 3FR7A 4EG0A 3UN1A 1A2KC 3GDGA 3SYTA 4CKEA 1ZI8A 2ECKA 3K94A 3KL4A 4I8IA 4RWZA 1F2UA 2OMKA 3A4YA 4R3NA 3WDLA 4WLNA 3NASA 1HX7A 2X22A 2V6GA 4WK2B 2ZU0C 4X1IB 4YK7A 3SAJA 2QRVB 1A8UA 3N2GB 1ZL0A 5KYYB 1AMUA 2QXTA 3RYTC 5M5BA 5EAIA 1FSPA 3ZNNA 5EIHA 3PQ3A 5L4NA 2GNPA 3DAGA 4LRWA 4MKRA 3TL6A 2FW0A 4TWBA 5IKMA 5J2TB 1YK1A 3GRRA 5CVCA 3SJCA 2JLYA 2J3LA 2XVAA 3G2PA 3DYBA 4KQ6A 4XX0B 2Q7DA 4G25A 5BYKA 3TFOA 1C9MA 3FOCA 4FFWA 3KR0A 2C3UA 4TM7A 1W2GA 1I3LA 1RJWA 2A5FA 3E61A 4XW2A 1PZHA 3VX3A 3VSBA 3LZDA 2EKLA 2IYXA 1DCKA 2IWRA 8LDHA 1ZINA 3B1FA 3EPRA 4G4JA 4BZXA 3OC6A 2BZGA 1U8XX 2XCRB 3VRHA 1JYFA 1ZA2A 5B4TA 5KSWB 1UC5B 2X42A 2WT9A 3DLIA 3P9PA 4HFNA 1SVMA 5DX0A 3M1LA 2GN9A 5D3ZA 2I55A 5NULA 4DLAA 4S1NA 3C1AA 3DVSX 4HDKB 4JD5A 1C0LA 1T8TA 3W5SA 3E7FA 3S1LA 1EB9A 4NNJA 2W2XA 2PUDA 2EWVA 1NRIA 1RAHA 1B14A 3WSWA 2RH9B 1U7WA 2BY4A 4N3NA 1EWYA 2PDAA 3PXAA 1OKKA 3QHPA 4GC9A 3RSOA 5JJ5A 1V3QE 4YPOA 2HR1A 4MZXA 3CF6R 4C6TA 2PQ6A 4UPVA 3OZGA 2HO5A 1YVEI 4QNRA 2PMEA 4DQUA 5EPEA 3RFFA 5T4FA 4ALMA 2PLFA 4MYUA 2IYAA 3K8OE 1S3SA 4ES6A 4AKSA 3GEPA 2P40A 1N5OX 4K9OA 2P75A 4N49A 5BNZA 2AXEA 4QAJA 2GUGA 3CQ9A 3NJRA 4YDSA 2FDCA 1VL2A 3B6JA 1CEYA 4HC4A 1T24A 4Q7LA 1YI0A 3TSYA 3IEKA 1MAUA 1AF4A 5L7TA 2QD4A 2OV8A 3AKDA 4MI6A 3PCRB 1BMDA 4QDXA 1QM5A 1TJ4A 4K6MA 1Q22A 2DKOA 4D3ZA 3JVEA 3T99A 3MB8A 4ABYA 1MTZA 3BT7A 1W0JA 1P2TA 1PIWA 2WICA 3F4BA 3ZHCA 4BC1A 5I4IA 3E7XA 3I01A 3PL5A 1FLNA 1LW7A 1ZVQA 1N2HA 2IYUA 1VKOA 1AGPA 4PWZA 4BKMA 3PDUA 4KFUA 2X6RA 3G1TA 4EBFA 2JGLA 4YNBA 3N8HA 2RGWA 3RBXA 3N5KA 4H77A 3KQMA 2Q5CA 3BSSA 2CE7A 5FQNA 2GYUA 3DH0A 3JALB 3DBLB 3OY7A 4KDIA 1ENZA 2HWKA 3KX2A 4MMXB 1NJGA 1Z56C 1JHMA 1Y4AE 2XVYA 4MI1A 4RETA 4UBIA 2FK7A 3VPSA 3X1YA 4AKTA 3N3BC 4I6EA 1YZ3A 4U7PB 3MHTA 2JFOA 2EU8A 3R6DA 3K9QO 4WFKA 3OF5A 4LUCA 4OG2A 4BFTA 5SY4A 3RAFC 4TTVA 4ER6A 1F5SA 3RSQA 1J9GA 3U56A 1YFJA 2VHYA 2JGDB 1EI9A 3TN7A 5CX4A 5EJ2A 1IBCA 3JD2A 4RA6A 5BSMA 1CQJA 4U6SA 1XEWY 2Q5QA 2BGJA 3DWGA 4TMWA 4X00A 4FDUA 1LVGA 5FYQA 4BCBA 4Y1RA 4ZT3A 1XVUA 3W5VA 1H4SA 1PF7E 2ZZKA 2C59A 1FUIA 1LV7A 3J7AC 3HYSA 1KMHB 3EQ6A 4R01A 2AEMA 4RLSA 5K0FA 1TL7C 3OPMA 1LDYA 3WMWA 3TDMA 4Y67A 1GGFA 1OFUX 3AI2A 4HQFA 1E7SA 2UYHA 5BMVB 3CLTD 1KAOA 5FOSA 4IEFB 5GPBA 3S8MA 1FQJA 5AKZA 3DF7A 3QG5A 4R2LA 3EUWA 2ZP1A 4CR8A 1C30A 2YQZA 4RNCA 3HGMA 4P3NA 4A8TA 2H2IA 4PS1A 4DWVA 5I3ZA 3P20A 4ENSA 2RGGA 1QP7A 3RUHA 4PNZA 1IY8A 3KZOA 4TTTS 2C5HA 1USUA 2YC4C 5B2EA 2IXEA 1VMEA 2ZIVB 3HN7A 3OPVA 3THWA 1EVZA 4CEJA 4MS1A 4IJ6A 4FNOA 3EPJA 1B26A 1DU4A 1R0LA 2TMDA 3PGVA 3QNUA 2XUAA 2G36A 4H7KA 2P62A 1GSIA 1VDZA 2IOHA 3GRUA 3HCWA 3GPBA 1D2RA 1D0SA 1WXEA 4ZCTA 3IPLA 1G59A 5CGQB 3QQ8A 2PANA 1E6MA 4I4IA 3L8EA 4Q5IA 2GPSA 3C6KA 3ILVA 5BOSB 3EGVA 1DAIA 4QRDA 3N0WA 5COBA 4OJTA 4AICA 2UZAA 2DMRA 3DAPA 2ZR0A 1L1FA 3GRZA 5HG0A 1E62A 3LA6A 1Q57A 3WHIA 3B6ZA 1FNMA 4WN9B 2PX4A 2VHXA 1D2EA 4CMBA 1H5NA 4QOJA 4CIWA 4S3MA 4RF4A 2YHSA 1CDDA 2ARKA 3BHMA 3E3MA 1K9VF 3IKVA 2VJKA 2W58A 4H1VA 4HEQA 4I50F 3IERA 2HEIA 1Z5WA 2C5EA 4QUBA 3SVZA 3UUFA 3GLUA 5SY6A 4FNGA 2I6TA 3RS9A 1OB5A 5A1JA 3RJTA 1NXWA 3W8RA 1I2BA 4HRXA 2GJ9A 4QO8A 3RVJA 5U1PA 5EP2A 1FFWA 2R4UA 4O5AA 1V8BA 2Y0EA 4QREA 2C4VA 3GLIA 1YE8A 1ZKMA 3W04A 2Q0XA 4JB8A 3H5LA 3ROMA 1U0HC 1UQUA 4WECA 2X0DA 2R47A 1KJQA 1I4LD 5FL3A 1TEVA 4B40A 5IDWA 1CR0A 4EX6A 2YV2A 3G6WA 4BXOB 5HCIA 1ZO8A 3Q15C 3OCJA 4YJ2A 1YONA 2ZZNA 1G41A 3M49A 2GCNA 4GDMA 3TTXA 3HSSA 5A4MS 2ZI4A 1DMRA 2ZEJA 1PR9A 1VMIA 4RORA 4KQJA 4NZ9A 1JS1X 4MCAA 3VQTA 1JSCA 3CXRA 5IDQA 5EHNA 2E1RA 3ENKA 3HBLA 3LCMA 5IW8A 1TRKA 4HEA1 1SXJE 4M2LA 3BZWA 1O03A 1Y7PA 3PEUA 1YS4A 1QFMA 4X64B 1Y6FA 3LIPA 1DJMA 4RKEA 2OHIA 2DQYA 2JGMA 4QOFA 4TMFA 2P2YA 1AKVA 4R9RA 2R00C 1ZU4A 1QYVA 1TMGE 1DC8A 2CVOA 3D8HA 1T5OA 5EZ5A 2FNAA 3H2KA 5KTYA 4MVJA 2PCJA 3HCCA 2XNJA 1W5EA 5AVWA 1ICIA 1STOA 3DG9A 2NWQA 2HWUA 1YKGA 2OHVA 3TTYA 4WEQA 3VI4B 4BNYA 5F12A 4Z4QA 4G0ZA 1P9OA 1W85A 2DH5A 3IBCA 5K0SA 3JAKA 3B51X 4YHHB 4X1YA 3DGFC 5FWAA 2C9MA 3DLTA 5ITVA 3IEMA 4C5AA 3CRZA 1ABFA 2P9ZA 1YBHA 4MV6A 4QHTA 5EJ5A 3F2IA 2JANA 3J81A 1UJMA 2OCLA 4D9KA 2R2GA 3NCHA 3TGWA 3D7LA 1IXZA 4DA9A 5KB3A 5JANA 5E3IA 4ZYTA 3HXMA 3H5NA 1RI2A 4RDHA 1JMYA 5LJIA 2H1FA 2YZKA 2BGMA 4OFBA 2HDWA 4AG3A 1DIBA 2D0IA 2H57A 1CY1A 2C2HA 4QDKA 4A0HA 1OTXA 5TVKA 3GBSA 1H66A 1ICEA 3FBWA 3BB4A 3HUDA 1IN4A 1JG1A 4IGAA 3NBZC 3RU9A 2ZIAA 4M6WA 4E2XA 4EDHA 4TS3A 4ZYZA 3KB2A 5JUWA 1A8HA 1XAHA 2N46A 2PKCA 3W5HA 3JPWA 2Z9DA 3T0FA 3W9UA 1B6GA 2VFAA 3TIGA 2F4NA 5JYDA 5DGXA 3E48A 3F47A 1P7VA 4PGFA 4F5DA 3NHWA 3UZUA 2EFGA 5IF3A 2ST1A 3TM5A 5KUTA 1B8UA 1V4VA 1XK7A 1V1MA 1Z4NA 2A9OA 2ZJAA 3DT9A 2JJ1D 2B0CA 3ACBA 4J4BA 4ARZA 1L2TA 3G9UA 3QYJA 4Q3LA 2PD3A 3CU5A 3V46A 4C4PA 3NOXA 2O5RA 2PMFA 4C20A 1CUFA 1Z6QA 2FPMA 1I33A 5DBEX 2DUWA 3GP8A 1EE2A 1ESCA 4KOAA 4OQLA 3V5NA 1VTKA 1WMSA 3RCBA 2NIPA 2BFAA 4R5HA 4ZQIA 4M1ZA 3IH5A 4MRVA 1RU3A 3VC2A 1ZOSA 5BSHA 3TSAA 3QK7A 5CD9A 2JJ8A 5E4JA 3MEQA 2CVZA 2R5FA 4DDTA 2FFAA 2ZB3A 4JHXA 4QEDA 4DMUB 4IR7A 1IM5A 1NDHA 1EG2A 3MWKA 4FMBB 4DLTA 2HHAA 3FMGA 3L1KA 3PHGA 2ZRGA 3GD7A 4F6LA 4B7CA 3N87A 2A86A 2GFHA 3D6JA 4FZ5A 4FW9A 3ST7A 3OECA 2EARA 2X5NA 4A2WA 4KQEA 1BQ4A 1JR3A 2DAPA 3H2ZA 3NC0C 4N7BA 4MHOA 2J3QA 1MH1A 3Q0TA 2HCTA 4N0PA 1RRCA 3H0KA 1GKIA 2Z95A 1EJ6A 4GXQA 1U0GA 2I76A 3NBQA 1NJ2A 5G1OA 3UJ9A 5AR1A 2X0KA 3W7VA 4IOJA 3EVCA 2G0AA 1BX3A 2J45A 3KE9A 1IG0A 3VR5D 2IU4A 3GUZA 4MR7B 5SYAA 4HDQB 4BO3A 1G3QA 1JJAA 2UZ3A 2YR0A 4K9SA 5FBLB 4P0PB 4YQEA 1DHRA 3HVKA 2D7DA 3E0XA 1JT9A 2X1VA 4J2OA 1YF3A 2CXNA 4JJZA 3OZRA 3WIUA 3KKQA 5KDLA 1I1NA 1E1YA 1H2EA 5L3QB 2OCBA 3KB8A 1QV6A 2QRQA 2E48A 2QE7A 1UBFA 3OX1A 4IL5A 4C3VA 3GFTA 1USKA 1Y3FE 2GHTA 3CX8A 1FU8A 4D4IA 1BDMA 3SIWA 5KC9A 4HN2A 3OEYA 4K9PA 3VU3A 5AH0A 1G20E 2KQUA 2WF9A 1GYPA 3OZAA 4R3UC 4YGYA 4RQUA 4XUDA 3SJAA 4I66A 2G6BA 5EJ8A 1Z4IA 1XPUA 5HGJA 3EFHA 3RVLA 4ESEA 4KKVA 1NYTA 3P9IA 2JVJA 5KKAA 4PN7A 1A9OA 1ABEA 1RAEA 2ADFA 2BI8A 2ZUDA 3OIUA 3U81A 3VYUB 2XUDA 1U0RA 4PZ9A 1DJQA 1JP7A 3PWTA 1D04A 3LW7A 5ECGC 4HPJB 1Z17A 1OI7A 1RWWA 3K32A 2JFUA 1J8FA 3IT0A 3KAQA 1Y5NA 5LOVA 3U39A 1ZS9A 3DE5X 1Y5MA 1DAOA 1JMVA 1C7RA 2CLHB 2YZ2A 3GVPA 3LUJA 4DG5A 4LJAA 1P18A 3PNMA 2HMAA 1YCFA 2W2OA 4YP5A 5K2OA 1JHOA 2BGNA 2RK4A 1VPEA 4PVCA 1Y3HA 4ML3A 1T6ZA 1GAXA 2JKZA 4D56A 3H5AA 1ONOA 1VLQA 3I23A 2DBZA 3FRHA 5ALGA 3WFZA 1AD2A 1E1DA 1Z7WA 5J2UB 2YHAA 1A4IA 2D2VA 1XZFA 4EF5A 1DKMA 2XYVA 1BOOA 3FBGA 4DDKA 1XRLA 2GESA 4NH4A 1QFSA 2A4KA 3L6EA 4LRXA 1CC1S 1R6VA 2IUSA 3IJEB 1Q20A 2VTVA 3PTLA 3TW8B 5ITWA 3HFRA 2FW9A 2JKVA 3KJHA 4J0IA 1WV1A 3RU2A 3LBHA 1EP1B 1P72A 1FTQA 1A27A 2H1VA 1FFEA 1RQ7A 2R4TA 3D4PA 3C43A 4IDFA 4RK6A 1T3TA 5JADA 1Q17A 1XKXA 4YB8A 3V8NA 3VOAA 2O1WA 4BGIA 1SUAA 2LRHA 1GO2A 1OROA 2DEUA 4JOSA 3AP3A 1TQDA 3A9RA 4IHQA 4LTDA 5CLLA 1V96A 3B82A 3AHIA 3EEQA 4NBVA 2I8AA 2WQZA 4G2TA 4IDPA 4HJXA 4K87A 1W75A 3TUZC 1X38A 4AJPA 4BS9A 1W19A 5JD6A 3E3LA 1ADYA 1UT8A 2ZLBA 3RT7A 3FCEA 5GIPE 3VR3A 4LI0A 1PNOA 2VPXA 3EZLA 3OE7A 3DZGA 1KEKA 3T1VA 1LH0A 1ZGJA 2IFTA 3SYNA 1JHPA 5C5CA 3HBFA 4ZTUB 4X71A 3RAGA 1YE5A 3OUTA 3L4KA 4D97A 3HEBA 4GPEA 3AEUA 3T4UA 3CMMA 4DMFA 1H2ZA 2JLAA 4M1EA 1XLTC 4OY3A 1J2YA 3QQPA 4Q19A 4EB6A 2JCGA 3CZCA 3CLRC 5E2IA 2K2QB 4ESVA 5FHRA 4GWKA 3CPSA 3RRYA 2LDXA 2YIVX 3RROA 1YR3A 1JDPA 1V37A 3KEQA 2WFMA 4K03A 4KE7A 3I5YA 4HAUA 3R9KA 4UPDA 3DBHA 1LTKA 1NW9B 4NECA 4TQGA 3RPEA 5ETJA 4GMDA 4WD3A 5K3DA 4YUYA 4V1CI 1SC6A 2O3UA 3A7EA 1LLCA 4IDBA 4GOMD 3RUCA 1BA2A 3GFFA 3NKFA 1NLUA 1B2RA 4J7XA 4QYIB 4MP6A 4V0KA 2D3WA 5FL7A 1NJSA 3REOA 1HOXA 1JIXA 1J42A 1U5CA 2D54A 2JVIA 4GG1A 5E9AA 3VO2A 2PUAA 3QVGB 1GGJA 3GFBA 4WLOA 3A11A 3VZPA 1MHTA 2JCVA 4DKXA 2REQB 2GYWA 1G6Q1 1VMKA 4P1ZA 4EPTA 3SS8A 1E1MA 2OV1A 1KFKB 3U3KA 1GTG1 2IYTA 3VR1A 1UFQA 2PKYX 3WFJA 3TGLA 1X70A 1DKQA 2IPMA 3P9RA 4Y6LA 1RXVA 2GVNA 2IELA 3IALA 1U3GA 4D6XA 1RZRA 3TUJC 4LF6B 2PXAA 4UDNA 4BE7B 3FAKA 1CJBA 3KZNA 1YL7A 5I9MA 5A6VA 4DCNA 3HB9A 1AURA 2DR0A 5IVPA 3L77A 4B31A 1S2IA 1SA0B 4HGRA 1MW9X 2AGVA 5D7BA 1XCMA 1N6NA 3FOEC 4X95A 4Z9YA 2W37A 4RVDA 4OHYA 4KVGA 2GO1A 3NDRA 4MCJA 1ZJ6A 4AS3A 3H0CA 4FHFA 2V96A 2PJDA 3BJEA 4L27A 1Z7BA 1GT91 2DJ5A 3NETA 1IB0A 1IULA 3WADA 3A4MA 4RV5A 3KJQA 5FWYA 1Q74A 3L7KA 4ZZ2A 4GOJA 1NOKA 2YXDA 3QOWA 1TUBB 1ZNYA 3A4IA 3IO3A 4IQ8A 3VYSB 2O4CA 2QY9A 1FP6A 5KYGA 4PNPA 5AJTA 1NW6A 4F8JA 2X1MA 4PZ0A 3LKZA 1QB7A 2QY6A 1MJGM 1Q1BA 2I1VB 2I7CA 3JD3A 2IXBA 5KAPA 3WGKA 4CTNA 1LKZA 4RO0A 2JAWA 3KVNA 3IKTA 3G23A 4JYCA 4BNVA 5HJ7A 1PEDA 3HLYA 5F2OA 2E21A 1AN0A 3R0QA 5TPWB 4TWAA 4YMGA 1S3FA 4BYGA 2O48X 2ZJOA 1VSBA 4WY8A 3IAXA 4F9GA 3GN1A 3AESB 4Z5XA 4XPZA 4EPWA 3LRPA 1MNQA 1P6XA 1ZXXA 1CUXA 4JNCA 4X94A 4HDNB 1MX1A 2O9JA 4ARSA 2RCNA 1NHWA 3AJDA 1XJWA 5L7YA 1KJIA 2V74B 2D7CA 1PUJA 4WPGA 1EXMA 3WL5A 1WO8A 4J9UE 4LXYA 5AW7A 5BV2P 2F8SA 1M0EA 1H1LA 1KI9A 2FRXA 1J06A 2PY6A 2Z3WA 3FNEA 4YRTA 3ROFA 1GKKA 5DISB 3S1AA 3ZXUB 3S6JA 3D1LA 3H86A 3NEPX 4OHWA 1CU1A 5DCYA 1FP4B 1L7AA 1WU8A 3BB3A 5BUCA 3AVVA 1OGYA 4GX5A 2HHCA 1YR1A 1Z38A 3O3NB 4D9HA 4YXWD 4OL0A 3LVBA 2ZJ8A 3BMCA 4PZAA 4RXMA 1RAAA 2J30A 3E84A 1V5FA 3OP1A 4MW1A 4AZVA 1JECA 5C9ZA 1IZ0A 2AOTB 4KRXA 3K6SB 3DYVA 2OV4A 3VNSA 1M34E 4D9GA 3HB4X 4QUGA 3A2NA 3I34X 4FFBA 5HKBA 1ZCFA 1S2OA 2QJWA 1JB9A 4I1VA 1FP2A 2DHQA 3CR7A 3MCTA 4IWXA 3SC2B 1GT6A 3HL4A 5E6RB 2O23A 5DU2A 4BN4A 1DEHA 4MV1A 4RY9A 3RADC 1YQEA 8ADHA 1XQ6A 3RGWS 4L0DA 1EX7A 5JZBA 2HJGA 5B6CA 1DC7A 1SOMA 2JI7A 2VTEA 4GICA 2RGCA 5IVDA 5CDGA 4D44A 4DDWA 3GZNB 4KRGA 2LKDA 1FF9A 2FW1A 3F49S 4Q7KA 2JHAA 5D3MA 1E5QA 1UOQA 1Z8HA 5LPNA 5CDUA 1T9GS 1H85A 4IG4A 4R8KA 1YULA 1YS7A 1TQ6A 1KFBB 5DP2A 4ZWNA 3WLPA 3KTAB 3F6YA 5CYOA 2HH9A 2V4MA 2O0JA 2OO3A 3UQZA 5FFMA 2BPOA 2ATCA 2FZCA 4QYWA 2WABA 1Q2XA 5HDBB 3S0JA 4IIBA 1M1YE 4C5BA 3R6TA 4TLBA 5KMGA 2IDJA 3HJFA 4JBIA 3TB4A 5K0TA 2QBYA 1TYBE 3EAGA 4QSMA 1U2EA 1R27A 1RYBA 5JBQA 4CR7A 2DPLA 2IYLD 3ZLTA 3P2EA 3ECSA 5K03A 4S35A 2