1I9GA

Crystal structure of an adomet dependent methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
264
Chain Sequence
b'TGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN RV2118C
publication title Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1i9gA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i9gA02
2OXTA 1AV6A 3OFKA 4IV8A 3MB5A 2ZIGA 3JWGA 5ICCA 5K0BA 4YUYA 1Q0TA 3EEYA 4QQKA 2OYRA 2ZW9A 1BC5A 3UJCA 4B17A 3MTEA 4DCGA 2EFJA 2UYOA 3BGVA 4KRGA 2IH2A 2FHPA 5H02A 3LPMA 3DXYA 2NNWB 5KYGA 1HMYA 2A14A 2GH1A 3R6TA 5K03A 2NXCA 1XDSA 3EVBA 2VS1A 2ZIEA 2ERCA 3KPUA 3HCCA 2VZ9A 4IWNA 4U7TB 4C4AA 5KQSA 2UYHA 1G38A 4RVDA 1SG9A 1KYZA 1WXXA 2OB2A 3KQSA 1NV9A 1ORIA 2AZTA 2R6ZA 4PWYA 1EJ0A 1AF7A 3QOXA 5FULA 3OZRA 2B2CA 5EKXA 2ESRA 5ICFA 3GRVA 2PXAA 5B1SA 1H1DA 3KQWA 4CKEA 4KW7A 2GAFA 4QTUB 3EVAA 3HVIA 2PX5A 2FRXA 3HVJA 5K09A 3BWMA 1ZHFA 3GWZA 1JG3A 1WXWA 3GRZA 3HEMA 5E1DA 1VQ1A 1AQIA 3UWPA 4E31A 3SXJA 1RI2A 2IH5A 3ELWA 4LECA 3T7TA 1ZKDA 1JSZA 1L1EA 2EJTA 4FT4A 4HC4A 3G88A 4OQDA 3SR4A 4HTFA 4NECA 3V8VA 3G2QA 4DF3A 2AOTB 3ER8A 2P8JA 5CCBA 3KPWA 5IKMA 3DMHA 3JWJA 3K6RA 3PLAE 3EVDA 4PYLA 2YR0A 2ZZNA 2AOUA 2QRVA 3MTIA 2P35A 2ZZKA 4PIPA 5U4XA 4RTOA 3DUWA 2QM3A 1EAMA 4EQZA 1VIDA 5EIWA 4E30A 4V0RA 1IXKA 2FPOA 2ZBPA 2ZTHA 1M6EX 3ORHA 5E9WA 3ME5A 3S68A 5LSAA 3CC8A 5HEKA 4R6XA 3A7DA 4R8RA 1INLA 3EVZA 1OR8A 3KHKA 4U7PB 2ZWAA 3EGVA 3PB3A 3HCFA 5DSXA 5EHGA 2B78A 4GBED 4PNEA 3SSNA 4Y30A 4IV0A 4M38A 4OBXA 4XUCA 3O7WA 1T43A 3FTCA 2QYOA 2I7CA 2N47A 2YXDA 4RYLA 3V97A 2I6GA 4F84A 5GM1A 3NTVA 3FZGA 1O9GA 4PCLA 5FWDA 2ZWVA 3BUSA 4GC5A 5DM4A 4KWCA 1X1CA 2OZVA 1NV8A 3C3YA 3DLIA 1G60A 3ID6C 3PFGA 3R0QA 4MWZA 2P3OA 5EMKA 4EK9A 4PCAA 1I1NA 3ELYA 3KKZA 3BGIA 1ZGAA 2VDVE 3B7PA 3FTEA 4QDJA 3E8SA 4AZWA 4HTFB 2C7OA 5HIMA 5EEHA 1SUSA 1JTEA 1P1CA 3G5TA 4GF5A 4JXJA 5CVDA 1O9HA 3OU7A 4MQ4A 2AN3A 2G8NA 4AZSA 1L9KA 3B3JA 3P71T 4IKPA 4EVIA 3CJTA 3DTNA 3P97A 4OA5A 5K0CA 4FZVA 1DCTA 3TKYA 3FYCA 5DX8A 2JH8A 5F2KA 1TPYA 3CJRA 5DRTA 3GDHA 1G6Q1 4RTKA 1NW6A 2O0LA 3SMQA 2AN5A 3EVGA 3G8BA 3NMUF 1YZHA 2YQZA 2K4MA 5GM2A 2NXEA 4PYQA 4V0QA 3SX0A 1MHTA 1UWVA 5LQCA 2UYQA 1NW5A 4YMGA 2VDWA 2Y1WA 4RX1A 1KPHA 1SQFA 1XXLA 3HVKA 5ICEA 4WXHA 3B5IA 2IGTA 4EMSA 1JQ3A 5C9ZA 1N2XA 2DULA 2OKCA 3I64A 3SM3A 1RJEA 3AY0A 4PYJA 3HTXA 3NVKI 3MHTA 1YFLA 2GS9A 1XDUA 3OE4A 5T6BA 1QYRA 3DLCA 5T64A 4BLWA 2UYCA 1RJDA 4GOMD 3B89A 4E2XA 3MCZA 1HNNA 1NBHA 3MQ2A 4KVZA 4M37A 5CUQA 3O4FA 2BM8A 4YV2A 3P2EA 1BOOA 3IV6A 4RVFA 4RVHA 2AN4A 3EEOA 1BHJA 5GP1A 4OBWA 3P9IA 5ERGB 4PGGA 1YB2A 4RV9A 1WZNA 2G72A 2AOVA 2JJQA 4ER5A 3PTAA 2AOTA 3FPEA 2Y1XA 2GLUA 2FK8A 3GCZA 2PKWA 3IYLW 3KQQA 3LCVB 5DM2A 1ORHA 2PXXA 5GOZA 3UJAA 2AVDA 1VE3A 1KR5A 3A25A 2Z6AA 5HILA 2O57A 4XCXA 1N7JA 4OX9Y 1BKYA 4P7JA 3M4XA 2P3QA 3PS9A 2LD4A 4GOND 3EGIA 3SGLA 3DULA 3KQPA 1X1AA 1RI4A 3B3FA 1V39A 3IEIA 5LQKA 1F3LA 2PWYA 4XUDA 5EMJA 5F2OA 4YUXA 3HA7A 2P40A 2EG5A 3EVFA 1EJ6A 3KQMA 5E2AA 2NXJA 3GRRA 2IBSA 3OU6A 3AJDA 3T0IA 2BM9A 2G70A 2EX4A 4C03A 5FTWA 1NW3A 5GIPE 2YTZA 4PYOA 2CKDA 2FYTA 4RTMA 4AZTA 2VDUE 1QAMA 2NYUA 4CTKA 4F85A 5K0FA 3DMGA 3KQTA 5ICGA 4HG2A 3FPGA 3FUXA 3KR2A 2Z6UA 4A6DA 1Z3CA 3RODA 1RJFA 3E7PA 1P1BA 2ZSUA 3BWYA 5CVJA 1SVUA 3UFBA 2JG3A 3L8DA 3TFWA 2CL5A 4YV1A 1KXZA 4HGZA 4LWPA 2C7PA 1FPQA 2H11A 3P9CA 3PT9A 2ZZMA 1F38A 2PLWA 2KW5A 2ZBRA 5P8WA 2C7RA 2ZFUA 3PX2A 3JWHA 3NDJA 1XJ5A 3GRUA 4QPPA 5E1OA 2BR4A 2IIPA 3KQOA 3MAGA 4F86A 2CMGA 2V74B 2G71A 2OPBA 1B42A 2BR3A 4GC9A 4FS8A 4Y2HA 5EKUA 3UJDA 3IHTA 5BW4A 5DTRA 1I9GA 1Y8CA 4XUEA 4E2WA 1ZQ9A 5FADA 5E9JA 4R05A 4C07A 4DQ0A 4ER0A 4BLUA 4X60A 1EQAA 1L3BA 2CMHA 2IDKA 3TQSA 3VSEA 3ANXA 3LCCA 5CVUA 3WSTA 8MHTA 4RTSA 3NDIA 4QQNA 3SSMA 3BGDA 5DXAA 5EGSA 4G56A 3KR0A 1NW8A 1P39A 3UJ8A 1L3IA 3G7UA 3KPYA 5FHRA 2AOWA 3OPNA 5IH3A 1M0EA 3EMDA 1I4WA 2IFTA 4ISCA 2PWPA 4X61A 2VP3A 4DA4A 3FYDA 1FP2A 5K0LA 1NE2A 1RI1A 2P7IA 4BP1A 1EG2A 3LDGA 3CBGA 4OA8A 5DM1A 5EZSA 1XDZA 1AQJA 4HRAA 4ATNA 3THRA 4GUAA 3E05A 3M6UA 3AXTA 3NW9A 5EQJB 4P58A 5EIFA 3UA4A 1YFJA 3CJQA 5EMLA 3TM4A 2AOXA 3UBTA 2ZULA 2XVAA 1R8YA 2HV9A 1MJFA 3HVHA 3KR9A 4EKIA 3HP7A 1DUSA 5BW5A 5HIIA 3R3HA 3T7RA 1VLMA 3I58A 1JQEA 3QV2A 3HM2A 5DSTA 3D2LA 3G2MA 4P7FA 4PONA 4LG1A 2IP2A 3E23A 3EPPA 5K01A 1YF3A 2DPMA 3B3GA 3LECA 3BXOA 4PYIA 4FT2A 3KQYA 4FP9A 3LKZA 2OB1A 3UJ7A 1JQDA 9MHTA 3G89A 3TM5A 5M5BA 2ZBQA 3NVMB 2P41A 2ZVJA 4C04A 3C3PA 1R00A 5EEGA 4HGYA 2BH2A 1QAQA 2XBMA 3M33A 5FCDA 3I5UA 2P1DA 1NW7A 3SVZA 5CVEA 4P7KA 3VYWA 4AX8A 1VP3A 4QVKA 4FGZA 2ZLBA 1VPTA 3GNLA 3LHDA 3P9KA 4EKGA 4GEKA 2PSSA 4CXMA 5DX0A 3MERA 4GQBA 4X41A 3HCBA 5FWAA 1VP9A 2PY6A 2HWKA 5DM0A 4GOOD 1QANA 2I9KA 2XYRA 1ZGJA 5JUWA 3BWBA 3GRYA 2HNKA 3KR1A 3LL7A 1D2CA 1KPIA 1XTPA 1G8SA 1L3CA 3A27A 3CKKA 4MIKA 5DXJA 3GJYA 5LQNA 1SKMA 1R18A 4R6WA 3UZUA 5DPMA 3DP7A 4C08A 3GGDA 2HMYB 1R6AA 3LDUA 3R24A 3TLJA 4YUWA 5LR6A 3P2IA 4KIGA 3FRHA 2HTEA 4QTTB 4AZVA 4BY9E 2C7QA 3TPZA 4YV0A 4PYMA 3OZTA 3LGAA 1U2ZA 1RI3A 3RIEA 4BP3A 5E2BA 5T67A 1JR4A 3FUVA 2CWWA 2PGXA 3OU2A 1N7IA 3EMBA 5D1HA 5JR3A 1PRYA 2H1RA 5E1BA 3SSOA 2OO3A 5FQOA 4C05A 2JHCA 5DT2A 3HNRA 2PBFA 4CTJA 2ONZA 5KQRA 3HA5A 2PXCA 4DCMA 4DKJA 1EIZA 4PYKA 5DTMA 1DL5A 3VC1A 4MTLA 3HCAA 4PGHA 5MHTA 5CM2Z 5EOVA 5FUBA 5HIJA 4K6MA 5K0EA 4R8SA 5GWXA 3GO4A 7MHTA 5HFJA 4RTLA 3KU1A 5HZMA 5LQUA 1UIRA 5HOQA 10MHA 3BKXA 3I53A 4A6EA 3M70A 2WA1A 3C0KA 3FUTA 3G2PA 4FSXA 4OQEA 5DTQA 1XCJA 3TR6A 4CWAA 1XVAA 3EGEA 3CVOA 3KPJA 4RTPA 1X19A 2AS0A 1X1BA 3X0DA 4M7RA 1SUIA 2FK7A 3GIWA 3LBYA 5D1NA 5DLYA 5E8RA 5EMMA 3DR5A 2XVMA 1VL5A 3FPFA 5FQNA 1G8AA 3G8AA 4E70A 3Q7EA 5EVJA 2ADMA 2PX4A 3OE5A 1IM8A 1NT2A 4KDRA 3QOWA 4RVGA 2YVLA 1SQGA 4Z2YA 5F2NA 3DXZA 3H2BA 4CKBA 3K0BA 2YUIA 2E5WA 3CGGA 4FSDA 4X1OA 2WK1A 3UJ9A 2XYQA 4M36A 3REOA 5CIYA 2UZ4A 3A7EA 3M6WA 3PFHA 5EC8A 5HIKA 4GOLD 4KDCA 3LBFA 1G55A 5K0NA 3GXOA 2JHAA 1TW3A 2OY0A 1KP9A 2O05A 3AWIA 5E8JA 5K0GA 5GINE 2IBTA 5LQAA 2YXEA 4P7GA 3LX6A 1P91A 4LWOA 2ORED 3HCEA 4DM3A 3PVCA 2I62A 1KYWA 1R8XA 2F8LA 3A26A 4PYNA 2YXLA 1WG8A 4QPNA 4DMGA 3JWIA 3R9XB 1UFKA 2PT6A 4ER7A 2B3TA 3NWBA 2Z6QA 1D2HA 2GA9A 1YZ3A 3G2OA 3P2KA 5EHIA 2PV0A 3ELDA 2B25A 2PVCA 2IDJA 2PJDA 4E2ZA 4E32A 1TW2A 3KQVA 4QVGA 5GIOE 4O29A 2IH4A 4PIMA 3NJRA 5EPEA 3LCUA 2R3SA 3FUUA 3P8ZA 2XYVA 3Q87B 2Q41A 4L7VA 5C0OE 3U81A 2GPYA 1KHHA 2WA2A 3ER9A 3PX3A 3UA3A 4ER3A 3O31A 5E9QA 2G1PA 1NKVA 3NWEA 5EZQA 3FTDA 3HCDA 5EG5A 3FPJA 1QAOA 3FPHA 3AXSA 3EVEA 3LSTA 3M6VA 3BT7A 2NP6A 4RTQA 1FJXA 5DRYA 3FTFA 1O54A 1IY9A 4RSRA 2NP7A 1VBFA 5FA8A 2ZIFA 3C6KA 3GU3A 4YMHA 3M6XA 3HA3A 5CVVA 1JG2A 4CKCA 2AR0A 2IPXA 4ZTBA 1JTFA 4C06A 3BKWA 2GB4A 1RI5A 3A4TA 3UJ6A 1ZG3A 2ZCJA 3CCFA 3P9NA 3T7SA 3RW9A 5CCXA 3TOSA 1D2GA 2AOUB 2QRVB 3LDFA 3DXXA 3OZSA 2HR1A 2OBFA 3TRKA 1QZZA 4HSGA 1JSXA 3BWCA 4RWZA 4FR0A 5LQJA 2H00A 1JG1A 2B9EA 3MGGA 4QDKA 2YX1A 3LKDA 3I9FA 3OCJA 3TKAA 4DZRA 2P7HA 2PT9A 5KS2A 4HH4A 4UOEA 5DWQA 1PJZA 1RJGA 3DH0A 4E33A 2AVNA 3BZBA 4PINA 4E2YA 4H0NA 1M6YA 2P3LA 2O06A 2EJUA 3F4KA 1FP1D 4YUZA 5K8VA 4AUKA 4RTRA 3UJBA 1WS6A 4POOA 2BR5A 4X63A 2FCAA 1XCLA 3C6MA 4BLVA 1KPGA 4KIFA 5KVAA 2BZGA 4YUVA 2QY6A 4RTJA 3KPVA 1NBIA 4RTNA 5BP7A 1Q0SA 3OFJA 2ONYA 5K05A 2O07A 5K0JA 2V7EA 1X1DA 2PX8A 5DX1A 1WY7A 3ELUA 3DOUA 1R74A 2PX2A 5FA5A 3THSA 3VC2A 2NXNA 5E1MA 4ER6A 5BXYA 3ERCA 5C1IA 4WVLA 5LQRA 1YUBA 2JH9A 3TMAA 3FRIA 3DMFA 2QE6A 3FUWA 1JG4A 2JHPA 3EVCA 5CD1A 1FBNA 3MCTA 3G5LA 5FHQA 4MHTA 5G02A 1KIAA
chains in the Genus database with same CATH superfamily
3IPCA 4Q4LA 1X8KA 1E3IA 2HHJA 3LHIA 4IO0A 4ND1A 3ZS8A 5JFOA 3DHNA 4LBWA 3R20A 1YZYA 4J1TC 2QRMA 1O9BA 4J1QA 3HXTA 4KFRA 2YUJA 4LJAA 2H08A 4QOFA 1JHUA 1E0JA 1XKQA 1IY0A 3EXFA 1L8OA 4KWHA 3K9CA 4U8HA 1R6DA 1Z7BA 2VIIA 4DPLA 6ABPA 5H3HA 4QYTA 4GUDA 2ISQA 1QKIA 2HA0A 2JGJA 4BQSA 5KYGA 1EFHA 2B4KA 1BRTA 4BQPA 1M7GA 1G38A 1ZR2A 1LTQA 1Z07A 4P5EA 3TXXA 5INTA 3QF7A 4I4TB 3CLSD 1JDVA 3E4CA 4PGAA 5EE3A 5K8UA 1OAAA 3CNQS 4EHAA 4P3YA 4HLUA 1FTGA 4GP9A 4LGYA 4BS9A 3GGOA 3Q7TA 1W34A 2W2VA 3OZRA 5H3LA 4MGHA 3R9IA 4KH1A 4V39A 4PAQA 3OIYA 1NHWA 3I72A 4HK4A 4HTAA 1GYRA 1X7ZA 4JQCA 4KW7A 3GRPA 3TIVA 1GZ4A 4KRFA 5HFAA 4EQ6A 1E2BA 1U3FA 3QBJA 3EWNA 3HUEA 1TCUA 3GRZA 1E3DA 1E3JA 1M2HA 1MU0A 1T2VA 1Z29A 3LGSA 2CNLA 2OCBA 1C1DA 1DI0A 1ODJA 2XVYA 3IIKA 3NP9A 4LV8B 3W7VA 4BBJA 4BQEA 4EHFA 3OTIA 3EGOA 3OKFA 4F2GA 3EEQA 2R00A 4FT4A 3G88A 2A2ZA 5LOVA 3V46A 3FWKA 1EB9A 2Y9PB 3DTYA 2H17A 4O8CA 3IUBA 5AW4A 3H5NA 3QSGA 3PDCA 3SIXA 4UNRA 3GVXA 1FMCA 4PYLA 5A4MS 4AKHA 2OEPA 3PGMA 2JFHA 4HQRA 2VTEA 5KNLA 1E77A 1AN0A 2UUAB 1N77A 2AUMA 5EIWA 5IZ4A 5JCOA 1UMDB 1VCOA 2Q49A 4BO9A 2I4TA 3H4MA 3MYRA 3WQHA 4JUIA 4YECA 1DQZA 5IW8A 4WXMA 5K5EA 3O82A 1R0SA 1E3WB 1N1DA 3JS5A 4Z9XA 3QX3A 3ZXYA 1CXZA 4B2YA 2OGUA 1GNRA 4CEIB 1RYYA 4GW3A 4F1JA 4K46A 5ITWA 3MBKA 5AJUA 2BL4A 1T5SA 2ZWVA 3NYIA 1QFSA 4P1ZA 2C7GA 2VDLB 2AEFA 1C9JA 1YE3A 3DO8A 3WLHA 5I8PA 1PGNA 1Z7EA 3ZQ4A 2A30A 4RESA 4EK9A 3QLUA 1H2WA 1UBMS 3K94A 3T1NA 3SIWA 1CJBA 1DEHA 1GG9A 1V9LA 2ZDHA 4FWBA 3SEFA 3HDYA 3SNHA 4A5OA 4EB6A 3QYPA 3FTEA 2QIOA 3H9CA 4G0ZA 4OXQA 4QYWA 1DUVG 1CR4A 1T29A 2ZB4A 4HNHA 4RWEA 2J7PD 1DE0A 3NBZC 1KO5A 2R7NA 2I3GA 1Z06A 4HX2A 4IKPA 4OB6A 1DEKA 3N0VA 4X6LA 4U7JA 3SYLA 4Q02A 3BK7A 3HNPA 3MF4A 4P7BA 1SCUB 1IDOA 1KFEB 3DFZA 1EM6A 1TPYA 3GZNB 4AJNA 3KFXA 4L9SA 3RYFA 4OGWA 3TGWA 4HLUC 3U0BA 3Q9UA 5IT0A 3OM8A 3SEAA 3OEEA 1JHXA 3GT3A 3K8YA 3WIUA 1MC8A 2XEDA 2H65A 1Z35A 5GM2A 1ID8A 1PO7A 2PQ6A 2YW2A 4XSHA 4G4JA 4BNMA 1YB6A 3U4IA 1MOQA 2V96A 2G5TA 3JTMA 5I6DA 5CRIA 1O03A 4GL4A 1IQPA 5LJLA 3FDZB 2BLNA 1XXLA 1ZM2A 2GFQA 3B5IA 1LI7A 2D74A 3QE4A 4EMSA 3EDOA 2FPXA 2DULA 2Y68A 3I64A 3OIUA 3FWYA 5KAMA 4C6HA 1P1FA 4PYJA 4KOAA 3D4BA 3U80A 5T6BA 1DCMA 3KWLA 1OFIA 2GO7A 3AONB 4B84A 1P17A 1R0WA 1VB5A 1SULA 2RHDA 4QXMA 4AU1A 2HDHA 1H2FA 1MBZA 4U9IS 1Z7WA 4DG5A 2AT1A 1HZZA 3QGMA 1NM5A 1GQQA 1BXGA 3OO1A 4RV9A 5TR9A 5JCOC 4ER5A 1TF2A 1BMFA 1FFAA 1L4FA 1USIA 2Q4DA 5FBHA 1XT6A 4WZBA 3TOXA 1G6OA 2GLUA 3H11A 4F96A 3ER8A 4J90A 1VE3A 2Z6AA 2OC9A 4BX3A 1J0BA 4ZICA 3IQZA 4GZLA 3U3DA 3DBOB 4POAA 3MINB 3H9BA 4NPAA 4BVEA 4CN8A 4CIAA 3OZ7A 3SGLA 3CLRD 2NTVA 1KZYC 1HDOA 4DRZA 4ZALA 3K9FC 1B23P 2XH8A 5A9SB 1URPA 1IPEA 3O83A 4ZOQI 1AB6A 1K7SN 2H9IA 2HF7A 2PZJA 4OU5A 1PNQA 4X71A 1CCWA 4J4TA 4Z7QB 3QLUC 2C3MA 1S3IA 1CFZA 2I2FA 3EHEA 4FILA 2J9GA 4IJWA 4J91A 4FYVA 1HTBA 2F1JA 3LCJA 4MDYA 3WMGA 2NVUA 4ZCMA 1RXVA 1PBTA 3DEAA 4LGMA 1RXYA 3BCRA 2V97A 4DBLE 1RPAA 3RBVA 4AZTA 1YZUA 2VDUE 3KYIB 1VL8A 4JQOA 2G17A 5TV2A 4ZGBA 3UJHA 2OR3A 1CS4C 3DDNA 1E0KA 3K9NA 7ABPA 1HFWA 3SU8A 4A6DA 2AD1A 4CE6A 5I7SA 3K0CA 1Q2XA 4J0JA 2QVLA 3NUGA 1CJVC 1TF7A 4BN4A 4CCSA 3HKEA 3PVSA 4WGFA 4QXPA 3QPAA 4LW8A 3L8DA 3O1LA 2JS7A 2ZSAA 3AI7A 1PJRA 4MUHA 4ALJA 3HBAA 2RJNA 4UFPA 3H9GA 1N9ZA 3BD7A 1ID1A 2OD7A 2WSYB 3GLRA 3NDJA 5BR7A 1XI2A 4EA8A 4WOPA 2BR4A 3R7WB 3BDVA 4MZXA 3TLXA 1NQAO 1L5ZA 1USUA 4BP9A 3W5BA 3THWB 3ZD8A 1QQ5A 1F8GA 4G1CA 1ZQ9A 5LVAA 2JAXA 5KNBA 3BD6A 2DCUA 1CIJA 1NJFA 2VPWA 1A9OA 2ID4A 2VSQA 4BWFB 5IU6A 3HP4A 1WXQA 2WC1A 3DO6A 3OWXA 2Q2OA 3VV3A 2C9ZA 3BB1A 5BR8B 3KR0A 3WC4A 3N7TA 1JJAA 1Q0QA 3ZW8A 2HCFA 2ZJYA 3VPBA 4QLBA 1U7WA 3DE4X 1LSJA 3JAMA 2XCOA 1J2TA 2BM1A 3L6OO 3P2OA 4AXXA 1P0QA 2IUYA 1VIVA 1V71A 2O0MA 3ACDA 4GWKA 2P7IA 2CFIA 2R7AA 2P9YA 3WWZA 1QGED 1TYEB 4PZCA 3NYQA 1GG5A 1SHUX 2IYVA 1JHVA 4GUAA 4LY9A 3ASZA 2IHKA 3NW9A 3U4GA 1YJQA 5K6TA 1JU9A 3GLSA 3LH5A 2BTOA 4IAOA 4YJ3F 1XIVA 421PA 2NUBA 1Z0FA 3O2NA 5HP4A 1P80A 3RTAA 1E79D 3M9WA 3EYWA 3ZWCA 3W5AA 1C4KA 4N54A 3N39C 3NATA 3U3KA 4DJ5X 5JQGA 1BWQA 2I0FA 1OA1A 4TLMB 3UKJA 3HM2A 5BN4B 3W7BA 1F6WA 5LUBA 4ZXPA 1Q2UA 5I7OA 1N3LA 2FSIA 4KMRA 1EWYA 2Q4RA 2DPMA 3MQ4A 3I30X 2YICA 4KK4A 2IY7A 4QYXA 1TJYA 5FLKA 2XE4A 5NULA 4EATA 1MW8X 2RAPA 3BAFA 2VYVA 2W4MA 3GLKA 3M1AA 2EGHA 3PQEA 5M5BA 2XUGA 4MP6A 4B2IA 1Y4UA 2XXAA 3GYBA 3N1UA 3LPNA 1TA9A 4B0OA 2GYVA 2AFHA 2CNWD 2PUAA 3QWFA 1XNHA 1DKUA 3I5UA 4YRSA 2G07A 2A3RA 4AYWA 3SVZA 1JDBC 2BHNA 5BOSA 3GARA 1XPUA 3L6RA 2NZWA 3DMNA 4K9QA 4B3XA 1LLQA 1U04A 2WWFA 1IVSA 2G82A 2XD9A 4S2UA 2OD9A 3PQ3A 4WTOA 5GADl 3VO8A 3BH6A 1SC3A 4BNWA 4O4JB 1EFLA 4QPZA 4Y9DA 2R0QC 5A9TA 4ZAXA 5K8LA 3D8RA 4IIJB 4GOOD 3V7NA 3CUTA 5AK5A 4MEJA 1X9GA 2Z95A 1RBZA 1GM5A 2A9JA 2BONA 5IDYA 2FUKA 2I6XA 4FE7A 1UAYA 1RRGA 3UENA 3EARA 1U8YA 4PBSA 2K87A 1ZK2A 4R5MA 5B7QA 1Z26A 4KUGA 3WK7A 1AKQA 2NGRA 4IQGA 2B7CA 4IZ6A 3AFHA 2O7RA 4N0DA 2UAGA 2ZRDA 1GTL1 4O4IB 3RIEA 4B82A 1RI3A 2J3LA 3AL3A 1LI5A 3PC8A 3STTA 1HYBA 1JR4A 2HLDA 2QJTA 4H6PA 3OU2A 2UZ1A 4Q7JB 2FDCA 3E5MA 4HDMA 2CZCA 3F90A 4R9VA 1DG9A 3FYTA 4MGEA 1CZOA 1N2CE 1T5OA 3E81A 5FOSA 2ONKA 2SKEA 4AF8A 2I76A 4BE7B 3E7XA 3ZQKA 4D8YA 4QREA 2IYLD 1WB9A 3VC1A 2HQSA 3AB3A 1JIJA 4KXWA 4XYBA 3GPCA 3O47A 1U3VA 5HIJA 4K6MA 1C9KA 2IODA 1X2EA 4AF6A 1I14A 4NH0A 4YQYA 1CQZA 1V2HE 2G7MC 3BF7A 3DB2A 1YU6A 3M70A 1Y1RA 3DWIA 2GJSA 3U3XA 3FUTA 2V58A 2Y6UA 3G2PA 5K4GA 2FE4A 5IUNC 4JFAA 5C1BA 2R6DA 1V4NA 3IQGX 4EFNA 3HDVA 3SHFA 2HB6A 4JL8A 4X7RA 3ZK8A 1GKKA 1UKVY 2ZRLA 3IQIX 2IS4A 4GO1A 1P1RA 3LBYA 4HPXB 2GCNA 2TMKA 3PF8A 2XEXA 2MSDB 2PO7A 3QG5A 4LI3X 3R7DA 2DMRA 2JDIA 4Q7EA 3AB8A 4EYOA 3QBEA 3T3DA 2DR2A 3PX7A 5DGIA 1FVOA 1PQPA 2YC2C 3JSAA 5BVGA 3Q3VA 1M34E 1IM8A 5DHFA 4EGCB 5MN5A 3OZUA 2P62A 1BDIA 4FXPA 3ZZ0A 3T06B 4FMDB 1AZWA 4LJLA 3H2BA 3ZVKA 2WIBA 4K1XA 4JVMA 2P30A 4ZHQA 3OCWA 3R7AA 3CVYA 2DUWA 3HJAA 4QUDA 3ZV6A 4L8LA 5CIYA 2VJNA 3S55A 3BREA 2QD5A 5EL0A 2QNIA 5JNTA 4BZPA 1AM4D 4DMCA 1DKNA 4WH0A 1MAHA 4Q03A 3C6QA 3T1OA 5GINE 1I3NA 2O05A 1JIUA 1Y1KE 2EL7A 3N86A 3LNCA 4HEHA 4RMHA 1D7OA 3DTVD 3L6BA 4NPCA 1R8XA 3FJOA 4DDUA 4FQ7A 1NNSA 2ZJ0A 2WE8A 5KWSA 2A3NA 3DZKA 4KLNA 3JWIA 2ID7A 2QAGB 4NEQA 3W9YA 4AYXA 1JIKA 2J6IA 1ISHA 3Q8XB 1WUKS 1YS1X 4HXEB 4P82A 2QTRA 2WHPB 4EUFA 1MIHA 4NU0A 3AEUB 4Q3KA 2Q0QA 2Z3ZA 3LKBA 2IDJA 3W1VA 3C7AA 3CURA 2JFYA 3S2FA 4BC0A 1YR2A 3COVA 1CZRA 1V9SA 4QDUA 1QE5A 3W6PA 4DC0A 4PIMA 2FG6C 2JGAA 3GZJA 4JUAA 2M6SA 1YIOA 4TMWA 2BI7A 4TV8B 4IGIA 2GCGA 3ER9A 3PX3A 5D3MA 3DFIA 3RJMA 1Q7GA 4XB1A 3PC8C 2OVBA 1H9CA 1BXRA 1E1MA 2JLWA 2AN1A 2C8KA 4WKGA 4U3JB 1X9IA 3EVEA 3LSTA 4JELA 1E1CB 4UUPA 4YAGA 4E15A 3ITKA 4NJMB 4C0WA 2NSJA 2D13A 2XCRB 2NADA 2PUDA 4C30A 3C6KA 1IG0A 1XYGA 3RRMA 3A4NA 1PS9A 3WOVA 1XZQA 4U0JA 2XI4A 1OI4A 2ZAGA 1S2IA 5CX1A 3VBEA 4D4MA 1EEXB 4OD0A 2TMGA 2FPIA 3DO5A 4DN6A 1TLLA 3ND5A 1XNQB 2YKGA 3AUFA 4XKJA 1SQ5A 2ACEA 4ABTA 5JV5A 2HR1A 3IQHX 1WKBA 1CLUA 3OZSA 4OUDB 5KNCD 1GPLA 1WY5A 2VJMA 5EWLB 3T0FA 1I2MA 1O6GA 5EMHA 5TMPA 3VA7A 4L78A 2CV1A 1BVRA 2JAQA 3K0AB 5FT9A 2Y05A 1E96A 4HEA1 4IM7A 1M8FA 4EPYA 2JLSA 3TRIA 1IY8A 1XTVA 2YMQA 4H7JA 4HH4A 2IRWA 3AP1A 4BMDA 2WWIA 2I87A 3I39X 4R3UC 1WA5A 1WWKA 4LJ8A 4O8ZA 3HU2A 5CM9C 3WFIA 4YCCA 2ZJ4A 1M6YA 4QBTA 4BAZA 1SOMA 2EJUA 4F3YA 1KNQA 5IK2A 4DIKA 5C2JB 3G23A 3LZCA 4BJHB 2YFHA 4FNAA 2JV2A 3KEMA 3DDSA 1YR6A 2BE7A 5HCNA 3G1UA 4HZGA 3AKDA 3RK0A 1E8DA 1IBMB 1FFWA 3PBKA 5K05A 2D4HA 2YJ5A 3SC2B 2OHFA 2E21A 1UBHS 4MPRA 1VZ2A 4AN0A 4Z4CA 4UE3S 4YMVA 1OT5A 2D7JA 5T8KA 3A11A 3ESDA 4QOGA 1QHFA 3DZJA 2OESA 3IMGA 1DAEA 1UZNA 3VC2A 5D6NA 4ALIA 4BWVA 1LBEA 4C2TA 3PFBA 3U56A 4YAKA 1D4AA 4YK7A 5FTLA 2W5UA 3GFRA 1C4OA 4MHTA 5U1PA 3K2BA 4OM7A 4P8RA 4K28A 1PAUA 2FU5C 4XIGS 4KXNA 4QU9A 5CTAA 2ZW9A 2Q5OA 1XTRA 3SK0A 1XU9A 1XUOA 2VP0A 2VRNA 3MTEA 3PFFA 4R2WA 5F7ZA 4B17A 4DJAA 4NBWA 3EFOB 3I01M 4KO3S 1T0BA 3CUUA 3LPMA 2LZ0A 5IFKA 1DFHA 2QORA 4Q4DA 1M73E 4I55B 3TTWA 2FSFA 3EC2A 5G0SA 3U7HB 3SHWA 3DZFA 3UHFA 3NVAA 2WT4A 2UYHA 4YIKA 4QT0A 4RKQA 1N5DA 2QZ4A 4YO7A 2PGLA 1I9CA 5AJVB 1YIAA 3KLMX 4Q4HB 4MO2A 1SU7A 3NXKA 4JLDA 4P86A 3E15A 5BR1A 1U9JA 1IUPA 2CUNA 2W6QA 2RSLA 2WM3A 3B9BA 3PFKA 3PDIA 1MIOA 2YN2A 2QRNA 2ESRA 3A3YA 3HADA 3HJNA 3I45A 4MMYB 5AXAA 5B1SA 2RGGA 1OOEA 2OVFA 4D80A 2HMUA 3NDRA 4E46A 2RHOA 2PCJA 1ND6A 2QSYA 3HVJA 4MMXB 5KU1A 1E5DA 3HDTA 2DETA 5GJBA 1FW8A 4QNNA 2COKA 2GEDA 1VQ1A 1EZ4A 3QY0A 1E2QA 1PJQA 1DWPA 1NX9A 4FKMA 3WKEA 3OEHD 3SKYA 1NXXA 1IN1A 2QTHA 4IOJA 5KREA 3TSOA 3BWVA 3IAS1 1TM3E 2JBAA 4BJ3A 4LTMA 4BFZA 3S44A 4B6RA 3DMHA 3REQA 3P26A 1ONOA 1IMOA 1IHYA 1UEIA 2VEOA 4PS1A 2D54A 3NC4A 2HA4A 3NT2A 5AM1A 3EXFB 3SM9A 4C22A 1IBRA 2IVZA 4CL8A 4D8WA 4XGQA 1ZJJA 1ZN9A 2E4XA 2JLAA 2QF7A 2BFDA 3B8EA 5LSAA 4NF2A 5LB4A 4RZSA 5HEKA 3RRBA 3G6KA 3CEPB 3TSZA 2Z5GA 3PXUA 5J2TA 4Q1CA 3M3PA 3LBHA 5KYXA 5BURA 4U2BA 3VZCA 5LNK6 1R12A 1Z13A 3FTCA 3TTSA 3FLMA 3F2IA 2QL5A 3OHSX 1GPNA 3GQBA 3TAHA 4AKTA 5T8KC 2ZUCA 1GRQA 3EMKA 3FSJX 4R2KA 2IHBA 4IVNA 2KMLA 2I6QA 1LZLA 3IURA 2B36A 4EQ6B 1BYUA 3PFGA 3QE3A 4JR2A 5I45A 4MWZA 1SXJD 2EU8A 1C0EA 3ELYA 1C1DB 3HY6A 3ND8A 1UEXC 3BHJA 3T5BA 5JS7A 1OXVA 1D4ZA 4KZPA 5A0TA 2FNAA 2JGKA 5LOVB 3DBLA 1SIUA 2DHRA 2C7OA 1YVUA 5EQDA 5FBQB 2C2WA 2CNNA 4LGCA 3WB2A 5GPBA 2B4AA 3HUDA 3C7DB 1O96A 4AI6A 1QHXA 1KDPA 2ZBGA 4LKRA 4WN3A 1UK6A 3RKUA 5CA1A 5EE9A 1QPBA 1ZD1A 4ENUA 3GF4A 2IHNA 1NW4A 4OSPA 5CXUA 1LSOA 3G8CA 1B41A 1GG2A 3U9SA 4BQQA 3TX6A 2PWBA 5F2KA 4K9NA 5KNCH 1YUNA 2CBGA 4ASUA 3AR9A 4CV2A 2XA9A 1CZUA 5F4ZA 2YWHA 4BXOB 4YMLA 3SMQA 2GM3A 3EOZA 3GJ6A 4I9UA 1Q1ZA 6ADHA 1Y5IA 1EWRA 4M3NA 1IHXA 1OXUA 1U1FA 3EGDA 2JGNA 3PWTA 5B3AA 2A5YB 3UHPA 3EDCA 5JSZA 1POWA 4JITA 5ELLA 1KPHA 3F71A 1H8EA 4M1EA 2PR7A 2IUFA 1N5OX 1U8XX 4KVFA 1MG0A 1SXQA 3PA6A 4MWDA 4DREA 5J5VA 2XTZA 3QLVA 3W3AD 2H3EA 3SYRA 4P4SB 4EVQA 2IZ6A 1CUUA 3OE4A 4UBOA 4EB6B 1K6IA 1Q0PA 3D7NA 3QX9A 4FCVA 3KNZA 2JLVA 2ZBDA 3LZ6A 5H5JA 3UY4A 2BLLA 1IJKA 3RU3A 5KQLA 3A6PC 1KRWA 2H1FA 2ZJ3A 3W5VA 3S2GA 3TN7A 2P5YA 3KKLA 3KVYA 3M83A 3MTQA 3DEFA 3PXCX 4IMPA 5D85A 5GP1A 3TL2A 4A15A 2G72A 2JJQA 4EG7A 3PQ8A 1R37A 3NHLA 3GCZA 1U8UA 1I1HA 2O3RA 4KWIA 3GJTA 4FMCF 1ORHA 2VNAA 3T7DA 1RWMA 3A25A 1FUEA 4JLBA 2OPHA 1IQRA 2AC2A 2DHDA 2NO9A 4N5IX 3A4LA 5KJ6A 4OU4A 5TB5A 3RYFB 4BU1A 1Y48E 1BKYA 1TTHA 4NYJQ 1IJFA 2PD6A 4BIIA 2C8LA 2I54A 5CURA 2BMEA 5EZ5A 1MOSA 4DWWA 3KQPA 4J4BA 4JXKA 1G3QA 2NM0A 3BAZA 1SU4A 3OICA 4I8XA 4F7WA 2GN0A 1N2OA 3HGTA 2RGDA 4TYYA 2I7DA 1S4QA 4UHDA 1ZWLA 4HB4A 2O8NA 4WERA 5JVDF 1TVEA 3KL2A 1K0UA 4JX9A 3GRRA 5E2AA 3BTSA 2ZIUB 2Y3IA 3D0OA 5D3KA 2EX4A 4ZZIA 3ZHYA 1M74A 4BQRA 3FCXA 1HH4A 3Q9SA 4IJ6A 1QVZA 1Y1LA 3MD9A 3RO7A 5K0FA 3RRZA 3JR3A 3NGMA 5JC1A 3A4VA 4OQLA 2ZUBA 2BTQB 1Y8RA 2PDAA 2XE6A 4NATA 4WXEA 1H2HA 1BXGB 1CG6A 1JA0A 2C3PA 1U0JA 1RYFA 2ACVA 2GPBA 3M2PA 4UOQA 1T0JB 3ASYA 3S29A 3WLNA 3UMBA 3ICVA 4WZBB 3GDFA 1DC4A 3DQPA 2X2EA 4KE7A 4N7MA 2GXUA 2HZ7A 4PPNA 3VC3A 3X3HA 4YV1A 3VNQA 1U11A 3P9CA 4EW2A 1F38A 2ZXUA 3NALA 1TJ3A 4GSKA 3DEKA 1M5RA 4U7HA 5FL3A 2BGTA 3FZYA 3GGJA 3AF0A 2WWXA 5BWCA 3E9NA 4F86A 1KP2A 2GXSA 1A9RA 2MSEB 3ESRA 2V7BA 3GBVA 5IYZA 2NZJA 2A9OA 4MUFA 3UJDA 3IHTA 3KVOA 5CTJA 1FZTA 4HPWA 3NC1C 1E6MA 2ZYVX 4DQ0A 1N9GA 2Q5FA 1TX4B 3GFQA 1EGAA 2VOJA 1L7BA 2P65A 5DK6A 5CX4A 5FBVB 3H8VA 1M6VA 2YY7A 3QLVC 2VRCA 3NDIA 4Q34A 3IBGA 3IBTA 5JI3E 5I3CA 4G5FA 3KZNA 1N7HA 1NKTA 1RMTA 1YD7A 2I7XA 1FIUA 1V5IA 2PEZA 2WAOA 3ONNA 4PPYA 3ND6A 5CIWA 3LS2A 1GQOA 1SURA 4ZRNA 3WMXA 1Y9ZA 5AVZA 5I47A 4HXFB 1AZLA 3WTBA 1YQQA 5DKFA 1Z74A 3KRTA 2WABA 1CR2A 2WVHA 1YVRA 1KEPA 4M22A 4XQGA 2E4WA 4IMJB 1JDBB 2REQA 3D6MA 3HKEB 3KELA 3CUVA 2DBYA 2DQZA 3MT0A 4RC9A 5AI9A 4YYEA 1MJGA 1PT7A 2E5FA 3WZMA 3AKEA 3EFEA 2FR8A 4WFKA 1Q6ZA 4P58A 5DYGA 4XJTA 4QL3A 3AFGA 1CTQA 1QYWA 3O8QB 3QTTA 4Q3AA 5BWBA 5F1OA 1YFJA 1OH5A 1K3FA 4A27A 2VTVA 4HB0A 2H4HA 4XTRA 4UFNA 1YZQA 2C0QA 3QA9A 1OGIA 4A10A 2CV0A 2PK3A 1P9LA 1J8FA 4BNFA 2ZITA 3IO5A 4KO4S 4L72A 2X42A 1XA4A 3IBFA 3L79A 3AM3A 4JP1A 4X3CA 3CF4G 1O97D 2C4TA 1KVRA 4ALMA 1F7VA 3HZOA 3Q3IA 1TEZA 1T9GS 3DZIA 3MT8A 4JSTA 1TF5A 4I6GA 1QOZA 3ESXA 1T3TA 2YMLA 4C0QC 4DCUA 1E3LA 1VIMA 4JJAA 1G5FA 4U6SA 1DADA 2ZYHA 1BE8A 4J2TA 1R00A 3UJNA 5EQFA 4DBLC 1PX0A 5DM1A 4E14A 4LXGA 3FOCA 3RSZA 3RS0A 4OSEA 1IFXA 1UBSB 5BSWA 1E4EA 1VE7A 4AMUA 3EG5A 4MJLA 3VJRA 1HQCA 1P81A 1V4VA 2R1UA 3LPDA 4IDOA 5F52A 4M1YA 1AGPA 3QXGA 1DV2A 2YV4A 3WGNA 2VDNB 4MGIR 2F4VB 2NZYA 1E1LA 1SC6A 4PY2A 2LNDA 2VNHA 4IXTA 4IICA 4YJ2B 5AD1A 4C9BA 3ZWYA 3S5UA 3DONA 4B2PA 4MUGA 5MGBA 1QTQA 1S2LA 1U7UA 4BO4A 1VHQA 3C43A 3KB1A 5LIRA 5TC4A 3COSA 3V8MA 2DH5A 5JCZA 1YMQA 1JDUA 2OBXA 2SICE 3WYBA 1LQ2A 3EH1A 1PFQA 1X2BA 2W8BB 2GD6A 1KI2A 3LUFA 4P4NA 4ZO8A 3WLSA 2INGX 1DMSA 3SLRA 3BEOA 3V2GA 4QFMA 2W6NA 5L53A 3IV7A 5BSMA 4RK5A 5DBGA 3CZAA 1U1CA 2J9YB 3A3OA 2A9VA 4I0WB 4Y9UA 1MVLA 1QO9A 5E2BA 3ACBA 4DT1B 3OQ6A 2ODWA 1WD5A 2DCMA 3MW8A 4M60A 4NEHB 3OQJA 3KJGA 3RYHA 2I55A 5KTMA 3HXQA 1EHIA 2OO3A 5A9RA 2G5CA 3I09A 4GT1A 3M5WA 4EUEA 2GZAA 2P6OA 3SN6A 3KXLA 4LOHA 4DILA 4L4YA 4K9PA 3GJ4A 4BOYA 2FFHA 3R5KA 1K5PA 4PZZA 4S1OA 3CE9A 5CM2Z 5BOSB 2IS2A 3I9JA 1ABBA 4TV9A 1N2CA 5K0EA 5B1HA 3U19A 2FR8C 2PLNA 2R1TA 4E51A 2CJWA 4OH1A 4JD5A 2DHCA 1F6DA 3BHMA 2F3PA 1UQTA 4ND3A 3SJAA 4L3VA 4F38A 3D31A 1WF6A 3AR7A 4Q7QA 4EYSA 4Z0HO 5FORA 3CVOA 1Z4NA 2VHQA 3L4SO 1X1BA 2J9FA 4J0KA 2C4VA 1BEUB 4CDMA 2CT8A 621PA 3GN1A 4LYHA 3MMNA 4QU8A 5DZSA 1FXSA 2OHIA 3H75A 4EABA 1HT2E 5DI3A 2EKQA 2CFSA 4BNDB 2HSEA 1TGVA 3H2JA 4B73A 1QR2A 1EVZA 4RVGA 2D1RA 1GG8A 5HUJA 1ADGA 2PYDA 1I7DA 1HORA 4L6CA 3R8CA 5ESRA 1T35A 4ZJUA 2HA7A 1F8XA 2UZ1B 1I32A 4MDEA 2CEKA 2I6FA 4HDMB 2QXYA 4Y1GA 1M34A 5JQGB 3DSRA 1MGPA 1PD1A 1SXHA 3N59A 5LPNA 3FHOA 2W2QA 3K9LA 2GETA 3WHKA 2RHBA 2XGJA 1H65A 2OWDA 3L8HA 3DFFA 3PHHA 2IZ7A 1M0SA 3C8UA 2F1IA 1JVNA 2HCBA 4UEOA 4FOOA 2YXEA 5LZ5A 4NCHA 1Y5LA 2QP9X 3FSRA 4XFJA 4ZV7A 3PVCA 3UAOA 1W4ZA 2PNJA 4C7MA 2XNKA 3ZWWA 1J8MF 2D1YA 3T41A 2G9UA 4UMDA 4RZIA 5JMOA 3DNPA 3NWBA 4NC9A 4WI1A 1XJCA 4UCQA 2YY5A 2Z6QA 3BPSA 2Z8YM 5K3BA 3BMOB 2FWJA 3IUJA 1DBVO 5FB3A 1FDUA 4DM7A 2EATA 4NESA 2QG4A 1VCHA 3R8XA 2Z1NA 5B7GA 2R97A 4L7VA 1ULAA 2Q41A 4MUXA 1WHSA 2ATXA 2Y1EA 3ZGVA 4ER3A 3EXAA 3RVSA 3OLQA 4B6JA 4F5ZA 1HF3A 4B3SB 2Q3JA 3DOHA 5GQSA 1D1TA 2LUOA 3N8NA 1ECPA 3O74A 1GEGA 2I03A 2FQXA 4F9FA 1UC8A 2W0MA 4TTIA 4ZHQB 2FSUA 4GD3Q 3I5MA 1O54A 3Q7RA 3H6HA 3QRWA 2WUGA 3TD2A 1FJXA 3GCXA 3VU9B 2EIXA 2FG7C 3ZHRA 2IPXA 2XV1A 3LWZA 5I4CA 4C06A 3TQQA 3GMTA 1GO2A 2IS1A 3DKRA 3UJ6A 2ZCJA 2ZWOA 4PRYA 3JVUA 5DNDA 2EV9A 3E9RA 5CCXA 3FCEA 4YPFA 1ADJA 2P6UA 4F8JA 4ZQFA 3L9XA 1QZZA 4DGQA 1UWLA 2X8BA 1XB2A 1GAQA 2PWAA 1RVDA 3RAPR 3E8MA 4ZU3A 4GLBA 1T2CA 2PAAA 3MGGA 4TYQA 3LTNC 3ECAA 2B4QA 3ZUGA 1XEXA 4K0RA 4Y9RA 3A6JA 1C3EA 3HXPA 1EDBA 4Z1MA 1G59A 3MOSA 3RB8A 2I3BA 4TKUB 4Q1EA 3W5JA 4CG3A 4KNWA 4GVPA 1KL7A 4HZIA 5A7HA 4KR2A 1XQ9A 1YRHA 3IVMA 1D9ZA 5JRJA 2GN6A 3H05A 3OD5A 4RNDB 2JFZA 4YACA 3ANTA 4WFIA 1J1UA 5GJCA 2PR2A 1KPGA 1BXRB 4ND6A 5DOVA 5JSYA 1ZFNA 3NG1A 4RXTA 4YAIA 4MUEA 1E6UA 4KB5A 2VHVA 3KPVA 2Q21A 1FDSA 2ODTX 2P27A 2PGIA 3ZDRA 2G9VA 4RAOA 5HS4A 4MINA 4J2HA 4MX8A 3LK6A 1WY7A 2HRCA 2Q5CA 3BK1A 3DHEA 3ELUA 4D1YA 5CX1B 9GPBA 1XZLA 2WT8A 1X94A 3I42A 2CNOA 2A4KA 2FPIB 3AEQA 3KWMA 3SP1A 1EBFA 4QYSA 1SUDA 1E2GA 2ASVA 2QE6A 5C52B 4PTZA 4FJ1A 2OSBA 5KOJA 4QQRA 1Y89A 1JQLB 2VJMB 1M0WA 1BE0A 3SF8A 3WGQA 2X5JO 3KOWA 1JKIA 1NA5A 1RWNA 1T1EA 3HHPA 3K1AA 4JSRA 1GITA 1J2YA 1R0LA 3E84A 3LY8A 5T4HA 5C4IA 1W94A 4BBPA 2J0VA 1DVRA 3S81A 3WAGA 4MV7A 4PZUA 2BGJA 1JXMA 4EGQA 2XB8A 3SSAA 1C3VA 3FN4A 4JR0A 3IL2A 4LF9B 4AUEA 5JNRA 4V1CI 3R6TA 2HSJA 1G9XA 4R1OA 4EAAA 4RA6A 3F4BA 1PZFA 1RYNA 1TRHA 3JU3A 3UT6A 5LQCA 2C5FA 2OMKA 1EFCA 1GDDA 3UUFA 3LBAA 1KY2A 5BORA 3EOBI 3FWPA 1A7AA 4OP1A 5DMHA 1EJ0A 4BNLA 4EG8A 4D81A 2B2CA 3OIFA 3R5XA 2FJ0A 4HNVA 3BL5A 1TZMA 2DUMA 3IE0A 3K15A 2QE7D 3F8WA 3L0ZA 2Q45A 2H6EA 1K98A 2C61A 2JGFA 2VH2A 3FWHA 2M6LA 1P72A 4DV1B 1WXWA 2IOHA 3GX1A 1KYTA 3HEMA 4PX5A 4JV5B 5A4FS 2ZM6B 4FHDA 1YHYA 3QBDA 2GQ0A 2UZIR 2W58A 4LBYA 2MINA 4QASA 3KCQA 1ZKDA 4CLHA 1HE5A 3NHAA 3T7JA 2WSBA 4Y2XA 4WNAA 1P7WA 2JIPA 3HCPA 4HLDA 4AJ2A 1MAUA 4KV7A 3HZZA 5TQVA 2QVYX 5KTRA 3OM9A 3UTCA 1B0PA 1ZM4A 1VMAA 3MTDA 1CVLA 1NW9B 1S8NA 4RPHA 5E6RB 4QQ8A 2JZOA 5KWEA 5ALQA 1PV1A 1NZJA 1XQVA 3AINA 4D3XA 2IXBA 5BSUA 1L5LA 5KVVA 1GZHB 2CL7X 1P3DA 2BFFA 1INLA 2QS9A 1OR8A 1L8LA 3KHKA 2ZTMA 4LGVA 1N3YA 4PLGA 1GTSA 1TAGA 3WK6A 2NIPA 3G49A 2ZYUX 2K5UA 2VSYA 4M4SA 4ZT2A 3VVLA 1NP7A 3R9XA 3PDIB 3SX4A 3AP3A 1Q3HA 4PLFA 1E63A 4EZEA 3AOGA 3FVRA 1OHHD 3MJVA 4GC5A 4FNOA 2J3QA 4JJ8A 2C7VA 1B14A 2FUG6 4QXQA 3V3TA 4BUCA 5EMKA 5FKJA 4ZVNA 4MWGA 4CDGA 1XEWY 4N7JA 1OGJA 3ZX4A 4DE5A 1BQEA 1GSIA 5EZYB 4QULA 1U7OA 1PZMA 2GJAA 5LZ7A 1KIMA 1XROA 3DJYA 4X1KA 3OQMA 1Q1NA 5FUWA 2H57A 1A2OA 8ABPA 2JBAB 2QYHA 3CH5A 4J16A 4NCAA 2VWGA 4HVTA 1XP8A 1I0LA 1FS6A 2UUPA 3KZMA 3WB9A 1BO6A 1U1IA 1XTTA 3A9SA 4JLNA 1GSOA 2V8OA 3EDQA 3EPJA 1RIFA 2JFNA 1X7XA 3HS3A 2OUKA 2GEUA 2P79A 2VRWA 2FPGA 4IXWA 4RS3A 2J9RA 3ILYA 3L4BC 4Z9YA 4DMMA 1Z0ZA 1XN1A 3QOYA 1PL6A 4JSYA 1AMOA 4QECA 3CGWA 4Z86A 4AB1A 3CZMA 4P83A 4ZDIA 1A7KA 1OFTA 3CJRA 4DMRA 1XMQB 1RNLA 1B76A 1LBSA 5J2TB 3QVSA 3R3YA 1CZNA 2W2TA 2YC4C 2WNHA 4LVNA 5KYXB 3C87A 4XPIA 2UUBB 3GVPA 1ZMRA 5D3QA 4L95C 3D3KA 1S9HA 2D1FA 2JCGA 3EZLA 3HRHA 3T3MB 1EXVA 5HXAA 4XJVA 4BZQA 1O95D 1DG3A 4M1MA 3PNYA 1HDGO 3NT5A 2VHUA 3DVLA 4TTJA 5TMDA 1TJ4A 2HRRA 3SBEA 1Y0BA 3SIPA 4YRGA 2DLDA 4DV7B 1NXSA 3K9GA 2P6RA 5KO2A 1PR6A 3VDNB 3E9DA 4XARA 1G8HA 2CEAA 2XDWA 3AY0A 1LK5A 1ULBA 2JFOA 4KR9A 2ZUFA 4BB5A 1SKUA 1FDIA 5THQA 3DBLB 1KI7A 2Q0SA 4BMVA 3B89A 5JU6A 5BUCA 4KVZA 2DPYA 1T3LA 1S4MA 4J07A 4YV2A 4CLRA 5K6RA 4JXZA 2O59A 5CA1B 1PIWA 3NYRA 3VSDA 4BV2A 4UEWA 4I8DA 3LT0A 2E3JA 4BJ6A 4K8RB 2BEJA 3HN2A 2FK8A 5CITA 1YCHA 2TECE 4RXMA 3HUUA 1C7QA 1BW9A 2PS0A 5ALGA 2O57A 2X7HA 1UMBA 4XQCA 4HXYA 4IIBA 1HKHA 1Z39A 5FI0B 4W9MC 1Z6ZA 3FGPA 4HF7A 1N8NA 3U4QA 5C8YB 1AKNA 2E0IA 3OE7D 1U2GC 3IQFA 2QJFA 2O2GA 5THKA 1UJCA 3RUHA 3ACCA 4LI0A 5C4GB 1ZCZA 1QVVA 2P40A 2CCJA 2LVBA 2F3SA 1JRLA 4NWIA 1AUVA 1PW5A 3TZHA 3FFTA 3IULA 2G70A 3EAFA 5LQDA 2XPCA 4J16C 3L18A 3E70C 4S24A 3V8PA 3E9YA 3P7MA 2Z08A 2WKRA 3BJMA 2Z6UA 4Y1RB 4D45A 1UMCA 4OYHA 4AICA 2HU8A 3E7PA 3LMKA 2V6MA 2RHMA 4ZOLA 1WRBA 2Y2VA 4Y6SA 2PGNA 3ZLVA 4EPVA 4AJ4A 1ZAKA 1ZJYA 3BE4A 4D6PA 3QWBA 4YAUA 5JAZA 1V4BA 4AFNA 1ZS9A 5B55A 1DAHA 1Z6YA 1GCUA 3HRKA 5CNJA 2XCIA 4U7DA 4TRNA 3ZHOA 5L3QA 5E1OA 4OQPA 4E0BA 3HM9A 3OAAD 5DHUA 5E4TA 3W6OA 2OGSA 1GQFA 3TSAA 4Y2HA 4NCIA 1CF4A 1CULC 1A8UA 1T0UA 2COEA 2PO5A 3LVBA 1Z75A 3Q15C 2ZJ7A 3HYCA 1AA9A 4X00A 3VISA 2FEXA 3VOBA 4DJJA 3PQCA 1JS1X 1RKBA 3QMPA 4FYYA 2Z2JA 4ER0A 3ZNOA 3GA0A 4O1HA 3UKDA 1QCZA 4K6OA 3ZWBA 2NUAA 3OLZA 2XMZA 521PA 2AJDA 5JHGB 1MQAA 2VNJA 2W2NA 4ND2A 4J43A 3PCTA 4B8WA 2C58A 4ARCA 5AKJA 4GPEA 4MMZB 3GZTB 4HJRA 4LE0A 3OPNA 3DLBA 1MH1A 2I2CA 1UDXA 2YVQA 5GONB 1EGMB 2QXTA 3WRXA 4B4OA 4DDKA 4XX1A 1IWOA 1MPXA 5CJJA 3IXLA 2O14A 2VJCA 3JVIA 4WECA 1VKNA 1D2AA 2PUTA 3DGEC 3X1KA 2OAQ1 2GDJA 4MI9A 3VU0A 2EYQA 2Q7XA 2ZULA 4XE5A 1R8YA 3A6GA 1Q57A 3OPYA 3ZU4A 4ZRMA 4PZEA 1TDJA 4B71A 4XZ3A 5JXHA 2WIKA 2C78A 1W25A 4NULA 1QQ6A 4TL9A 1G66A 1NSTA 1VI2A 3JY6A 4YNBA 5IYZB 4QUGA 3RANA 5A5FA 1LD3A 1L5VA 2O2EA 3GMIA 3I1YA 3LCRA 1N9GB 1R6VA 2ZBVA 3WGZA 4RNCA 5K01A 1FLVA 1QBKC 3BIJA 1F3OA 4EFKA 3WZLA 4EUNA 4Q00A 3QVTA 4UDYX 3T54A 4QJBA 3UK6A 5L3SB 1N5IA 1CQJA 5G0VA 2OGWA 1MJHA 1S3SA 4JX8A 2IU0A 4QQFA 1CY6A 3ZNQA 2Q6VA 4AX8A 2P9CA 4P7KA 3TOCA 2F3QA 1OI7A 1VE6A 2PUCA 3FPKA 4UBKA 3F7OA 4DHWA 2PQ2A 3Q7SA 1ZOIA 1LVUA 2REQB 1M33A 5EIOA 5G2OA 4CCWA 5L95A 4AIRA 5IKXA 1XD8A 2IWHA 4CI9A 4F1KA 1OXBB 1DOAA 2L82A 3TB4A 4ADSG 2SKDA 2CXNA 4Y0AA 1IBKB 3CZ5A 3VNVA 5G3YA 4M53A 1SUBA 3F5MA 3FBTA 4MUJA 4OMCA 4N7RA 5FUVA 3W06A 4LXYA 4BX0A 4NBUA 1Z5UA 1VIAA 1R18A 3KB8A 1DXOA 4HDAA 3U3ZA 3STUA 4AO7A 1IU9A 1KZ1A 4C08A 4Q9LA 1FUYB 1R0ZA 4XM1A 2LCFA 2BHRA 2JKZA 5AVQA 3F8SA 4YFYA 4AKIA 2EVWX 2P75A 2YWRA 2JD0A 3JRXA 4B75A 3O3CA 1TUEA 4KPUB 2YCLA 2PFKA 1P6UA 1U94A 2ZTVA 3FUVA 5T67A 2ECOA 3DAOA 4UFOA 1DRWA 3ESBA 4LOAA 1KVUA 3HL4A 4GP7A 2F17A 3FI9A 3GG2A 5KKAA 1Z8FA 1OLSA 2HLHA 4TZKA 3TSWA 3H13A 2H0AA 4O5OA 3WS7A 4DYVA 1JIIA 3F5QA 1OIWA 1ZRHA 3LY5A 3GN2A 4CGZA 1P4HA 3GGGA 4MDHA 1V3VA 3WB1A 2R8BA 2R44A 3AY3A 4H6XA 2F1HA 3AFMA 3HWWA 1PFWA 1RADA 1YB1A 5FJJA 1Y1PA 2YZNA 3WTCA 5EOVA 4AS3A 3OFSA 2AZDA 4PLZA 5GWXA 2OHHA 3CISA 2FPUA 4UAJA 3TIFA 3C41J 1TKBA 1U6JA 3D7SA 4IOKA 4R40A 1CERA 2XOKA 1VHTA 2ZRMA 3DEIA 3JVDA 4KR0A 1P9WA 1YQWA 1L4GA 3FNIA 4M76B 2NZ8A 5A06A 1H3EA 2WD7B 3WKCA 1YZVA 5HZKA 1O94D 3B1KA 3H4IA 4GM0A 3D6JA 4YJ3A 2QB5A 5KPJA 3K72B 4CU2A 3AQ4A 4OM8A 2GFAA 2FR0A 4H2DA 4WKCA 2OO5C 1V8PA 3OJLA 4Z1OA 2IV3A 4E70A 1JMYA 2X0DA 3ROTA 4BJ5A 3K0KA 2ADMA 2I22A 4L5JA 1VG0B 5J4KA 4KDRA 4I5EA 2FMKA 3PQFA 4ZCQA 4D9HA 3ZD7A 1IHDA 1TZCA 1O6CA 5AHXA 2CNDA 2IV2X 5AKZA 2KHZA 2VCYA 1THMA 2H2WA 3AEKA 3CW8X 4JK3A 1KQPA 3A1TA 2XYQA 1RPTA 4P53A 5KOHB 2CZGA 1OAKA 3H8SA 1I5OA 4GOLD 3LBIA 3VU3A 3JD0A 2RJ3A 2K2QB 2F48A 1E5XA 1KP9A 2PZLA 2TYSB 3EYAA 4FC6A 4AN1A 4I36A 1L7NA 5FEMA 1F20A 1E5TA 1H2XA 3IQDB 1N2CB 4I50B 1OFUX 4C7JA 4G1FA 1T8WA 1TMYA 4W1RA 5SICE 1MF7A 3CF2A 1PR9A 4G2TA 4JDUA 4QPNA 2IYNA 4A2PA 4DMGA 1UFKA 4ER7A 2WB4A 3AF1A 3M3HA 1CJCA 4IVRA 4RIEA 4I1UA 1V5GA 5KS2A 1P9NA 2WDPA 3OH8A 1ISMA 1QIHA 2ZJ6A 5GV7A 1TW2A 3AU8A 4EI9A 2J9FB 4NDNE 4BQIA 2IITA 1ORDA 4CLXA 3LQ2A 1KYQA 3LCUA 5EPEA 5JZMA 1C1HA 2XYVA 2AXPA 4DYDA 3L05A 4FFSA 4RW0A 2BHTA 3NBAA 5EI5A 2WMYA 2PQ0A 3B2NA 4GPZA 3UAXA 1R9JA 3HSKA 1ZD5A 2EJVA 2VHJA 5E7QA 1KDVA 3M6VA 1JWLA 4GI7A 4KFTA 2IIQA 4L28A 3LPLA 1COWD 4Q3OA 2J5QA 1L4YA 2P0EA 3LM8A 1NBOA 4JODA 4N8DA 1M34B 2ZJBA 4J94A 4G36A 1PR1A 1XNGA 2CWDA 2XNDA 3A2NA 5DTJA 1IULA 2AR0A 4ZTBA 3WSVA 2CB9A 3GOHA 1GPDG 1P9OA 3MJFA 4WBNB 5CMLA 3EX7C 1X70A 4LRYA 4FDAA 1N2BA 1Q6YA 1W4LA 2P5SA 4OHRA 4UQOA 4DQDA 3LDFA 4M0CA 3TAUA 4KI7A 2IELA 3DDUA 3L7IA 2DBRA 4J3FA 1CKEA 1JUDA 2C3UA 4H3KB 3N2IA 4JU9A 4RD0A 4EEXA 2VXOA 1OB5A 3PEEA 1FTQA 3F6YA 3JWPA 2P9JA 4MRNA 1APBA 3J80A 3HXLA 3FPRA 3N8KA 3N70A 5CLHA 4N6GA 2RH9B 1K9SA 1WD7A 1ESMA 2FZKA 4YCDA 1IZ7A 1K5DA 4R7GA 3SQMA 2X3FA 3RS4A 3OM0A 4EZIA 5U9CA 1QFMA 1RXUA 2P6MA 3H9QA 3P45A 4GI3A 2Q29A 1RM3A 1AHHA 1X15A 2HI0A 2RHLA 3I0NA 7REQB 1JLKA 5KX5F 1QMGA 1KMQA 4CV1A 2O06A 5I9TA 1WHSB 1V1JA 3GLFA 1RM0A 3OKPA 3AJ8A 4TLLB 2GDZA 3DCIA 3RT1A 3FFAA 3FMFA 3RJ5A 1UM9A 3NJ4A 4XUGB 4EF6A 2M9MA 3C3JA 5B2EA 2ZUWA 1HLPA 1UT5A 4G0WA 4RTNA 2BSQA 1WP4A 2EHDA 3RIGA 3BJIC 3RVDA 4N4AA 1Q21A 3SFZA 1ZCBA 4B46A 1BDMA 1ZVJA 4RLQA 4IDEA 4W1PA 5BV8A 1MN6A 1W2WB 3S28A 2DFVA 4ZI7B 3THXA 3BGOS 3RYIB 4D4LA 3IPAA 4RHCA 5E1MA 5TDHA 1G8JA 1M2JA 2BMVA 4TTTS 4TMZA 4EB0A 2NT4A 4UUNA 1PHPA 1GSAA 3FRIA 5IEBA 3P2YA 4M7OA 3BH0A 3KYDA 2JHPA 4MKFA 2XMBA 2XT6A 3QF4A 2GEKA 5G02A 1EFPA 2HXSA 4HVAA 4L27A 2LIVA 2V7TA 3LPAA 4AY3A 1ZLXA 2FOIA 4K86A 5BUZA 2R48A 3HXKA 5B58C 4OFWA 1XEXB 3IMEA 3W34A 1IXRC 3Q7PA 3IEXA 3IMKA 1OKKD 1GU0A 1YCFA 2B4TO 4MB2A 2DB3A 1OSNA 4JC5A 3FNGA 5LQSA 5FR1A 1U2SA 1GN9A 1JE1A 4L07A 1NQWA 2NXCA 1VI5A 3LT4A 1FXUA 1JHYA 2JARA 4HSEA 2IPOA 3HCCA 2H5JA 3I2HA 3D3QA 2VDWB 1P1KA 1Z6GA 3I4FA 1EH5A 4ZP1A 1SG9A 1I6WA 4NFYA 1FX0A 1NV9A 2PRZA 1R1DA 3B1JA 5I9BA 3TLCA 1ZJWA 5EKXA 4IKOA 2G04A 3LHSA 1ZJ6A 3P9ZA 4W63A 4O4HB 4X8MA 3TRJA 4CKEA 5FFMA 2BFBA 1UT6A 1GUFA 2BH9A 1OPXA 5GZ1A 3IOMA 5E4JA 4D3DA 2IPAB 4I1YA 3U44A 2GCOA 3AEQB 2YYYA 3OSZA 3QENA 3VYTB 2NVWA 4HS4A 4BP8A 1JFVA 5ALUA 5C8DA 3W9UA 4L74A 3GEGA 5IXSA 1GOTA 5IUJC 3K6SA 2ZB7A 3VH3A 2PXHA 3EZGA 3NC0C 4NECA 2EX0A 3MTGA 3SF8B 4B34A 2D7CA 2OYCA 1ESZA 3O0DA 4B45A 3A2MA 4LC0A 3ORSA 4JCOA 5K45A 5L7YA 5CAEA 3PDHA 1LVHA 4P5PA 5EXPA 3B1FA 4LDPA 5H9VA 5JW6A 3N28A 5F5XA 4PFJA 2I3ZA 2VUUA 5BMVF 5I01A 1EMDA 1Z6TA 3DOOA 1YDFA 4IDHA 3F49S 3ON5A 4MVJD 5F5NA 3RHFA 4C3ZA 1II9A 1LSUA 1CVIA 4I5IA 4V0LA 5FUQA 4G25A 3U4AA 3E1GA 2J0SA 2WU8A 1BMQA 5KSPA 5AQEA 3OTGA 2IYXA 5BV7A 1TXGA 4GDFA 4YCMA 2DY1A 2F64A 3VGPA 2DR0A 4HO1X 1ITZA 4RA9A 3NANA 1U6IA 3L0BA 4P36A 1CEEA 1S5PA 3TVTA 4YXWD 3IJPA 3V48A 2XA1A 3JQ9A 3L8CA 3NZEA 3GEHA 1JIVA 4YX9A 5AK6A 4ZI3A 3EG9A 2MINB 4KAAA 5J1SB 1MZVA 4ZWNA 4WNAB 5HIMA 2D5LA 2LDXA 2IIBA 4OL0A 5BWLA 4C7KA 3ZDYB 3E9CA 2Q3HA 3OPXA 3TF5A 2CSXA 1VLZA 4TMYA 3B20A 2ACKA 4ZV9A 3O9VA 4X45A 4FOTA 4EVIA 1N5JA 2HPZA 1NIJA 3UMGA 1K8RA 1D2EA 1IEXA 1RLUA 2V7GA 4ZYWA 3WLTA 1BFUA 3U4MA 2F8MA 4H0FA 3F67A 2VBIA 1XRLA 2QQSA 4UCWA 3NHMA 4V02A 1TPZA 1ODIA 3PPWA 3TQCA 1FFDA 2ICAA 1F0KA 4IPTA 3ABIA 3HB9A 2N0SA 3TEJA 4KQCA 1UM8A 2PPVA 3ZHQA 4PYQA 3O4GA 1GPJA 4N5DA 4R1SA 4OJYA 3GRCA 5ELMA 1TQ8A 5SZKB 4DJTA 5DGCA 3ZG6A 1M8KA 1SXIA 5AJYA 2RKWA 5TGZA 4BN0A 1RPNA 2FDXA 4RZQA 5ILQA 4ZZ3A 5K3EA 5LXTA 4WNYA 2XAAA 4WXHA 3TIWA 2ZRHA 1VHLA 2MR6A 3JQRA 4JIMA 2CVFA 4DR1B 1VIYA 1J0XO 3CT4A 4TKVA 1C9DB 3NVKI 4GL2A 2AL7A 2KLHA 2QL9A 1ECJA 3IIMA 3IB6A 2IOQA 4KQJA 3HDQA 3LQRA 2DQYA 3ENKA 2R25B 3MQ2A 5K0SA 1MRSA 3CV3A 3CEJA 1BOOA 1KYYA 2QNBA 1JQJC 1I1QB 5ALTA 3HDJA 1CHDA 1XPJA 4AC9A 1PLLA 1RSZA 1X7XB 4NMMA 3COPA 2FPGB 2QAIA 1D8AA 2HXGA 3I5XA 4Y67A 3GEPA 4WK0B 2JI6A 2NZUG 5FBKA 3ZGNA 3KD2A 5MN4A 1YBFA 2DHEA 3SOPA 3AFNA 1PEKE 3LSYA 4LX8A 3VOTA 5IARA 4CN9A 3TLBA 4L22A 1P74A 1I7LA 1PDOA 4IZHA 3QQPA 4XPIB 4CKYA 1SXJB 3NCTA 6GPBA 4MLZA 1LLUA 3DVAA 5DGXA 5BMVB 4INAA 4JKYA 3U7RA 5KTTA 2CW5A 4UHHA 4RANA 4UCFA 1R4AA 3H84A 3KKPA 3KZ1E 4NCJA 1CP2A 2PUWA 2X9GA 1L7DA 2XBUA 3ILHA 1ZNZA 3JQ9C 2YVUA 4CKWA 3RQIA 2IZ5A 1XWWA 1EEHA 1WZCA 3ENQA 3QK7A 2VP9A 4OMDA 4R8MA 3X1WA 4DUGD 1CY7A 3NOQA 1XZGA 2WTEA 4AMZA 3VKUA 2GUWA 4I81A 5C31A 4BNGA 4E5MA 4P93A 4F6RB 2IT1A 2OOSA 2HRQA 4LHVA 4CKXA 2R7LA 2XLCA 5FAXA 3Q41A 1VMKA 4QLOA 4ZC1A 2B4YA 1IN8A 4WJZA 1QQAA 4L75A 2VAPA 3MHPA 2AQIA 1VA4A 4UTXA 4HH0A 1D6JA 1KI9A 2V5AA 3BWYA 3OVMA 1SWVA 3NEJA 2FOXA 1EI9A 1P0IA 1OI2A 1TUGA 1HMPA 2B1RA 3P27A 1DSSG 5J5AA 3UBMA 5DF1A 2JG3A 1DC6A 2CXUA 3ZLUA 4IH9A 3HL0A 4DSNA 4PW0A 3CLKA 2JFFA 3IKJA 3G0GA 3UYLA 4MDFA 2PLAA 5P8WA 5JNVA 3DMPA 1P4GA 3Q40A 3U4QB 3L8ZA 2WJJA 3R3SA 3K05A 5EN4A 2JGMA 2ZJ8A 1UKAA 4YALA 5LL6P 1ICEA 1NY6A 1YR8A 2JNWA 4XFKA 2YXPX 1J21A 3ZE8A 2GBLA 3FKSA 2PANA 5AJWA 2OLKA 3AUYA 2PVPA 4WXYB 4AY2A 1OX4B 2Z9CA 4RTSA 1YB4A 4TXHA 1BHO1 2VSNA 3M2TA 2XQJA 4G23A 3WJAA 1I51A 2YNMD 2HO4A 1BCRA 1MX3A 4I19A 1JYSA 3KX2A 3E58A 3UJ8A 1BROA 2R2AA 4ZAVA 5FYQA 4G8JA 4LRSB 4ZT6A 1YFZA 1PFGA 3CR8A 2CSUA 3FH0A 5IH3A 2AF3C 4CIVA 5JEDA 1UMCB 1QGYA 2PWPA 2RBGA 3E9MA 1FP2A 3MUNA 1ORRA 1D0SA 3OQIA 1UPCA 1ENOA 1XMSA 2B37A 4FYKA 3SAJA 5TY0A 3JD1A 4MRMA 2QRPA 4YASA 3M6UA 1UAAA 3LBNA 2Z09A 3V42A 3RVQA 3DXFA 1FU4A 1OAOC 3A6EA 3U0VA 4BLPA 1DTSA 3FPBA 1AURA 1DUSA 1B6RA 3ZI7A 4XYLA 1AD2A 3NP7A 4WE3A 1P2SA 1J4AA 4OXRA 3W8DA 2A4MA 1CY0A 4JWKA 3RSHA 4TUYF 3AGQA 3WLKX 3RYTC 1JEOA 2W93A 2QUIA 3PEYA 3PE4A 3LUAA 4B4WA 4FFPA 3R9WA 2XMPA 4BEJA 1L7VC 3A9CA 1JAIA 1QE3A 1TD9A 5JVDA 2OB1A 1UOPA 1TM2A 3HU1A 4JLUA 9MHTA 2H1SA 1RAIA 1VRCA 3DBHA 5BSHA 1B2RA 4PC7A 5C3UA 3VUEA 1A5BB 4UXHA 5AW8A 3F46A 2XB6A 4XR4A 1JBQA 3DEJA 5CH3A 3UMVA 3M33A 3NRJA 4F46A 4EB8A 1KAHA 2P1DA 4RKYA 3VYRB 4Y2PA 2NPOA 3VZQA 1NVVQ 4RELA 4YRAA 2XSZA 4F21A 5EUBA 1JJIA 3D4LA 4IO1A 4B9EA 1A2BA 4HAWA 4NMWA 3H1GA 5CA0A 1P5JA 4O2AA 2VYFA 1WABA 3QLEA 4X41A 2EEZA 4XWWA 2GZ3A 3ED1A 3UCFA 1K6XA 1X9HA 1G4AE 2GNPA 1FNSA 3KR1A 3M49A 4G0PA 1G8SA 3WLRA 2AFVA 1X0VA 4B3MB 3GUUA 2CNBA 2GSDA 5JYBA 2R751 3ZBTA 2IJGX 3DDZX 3TLJA 5H3CA 1R6AA 5KDOA 4L5CA 3OQNA 3ZZUA 1G6KA 2BGIA 4B31A 4EY5A 3ESAA 4KXVA 2ZQYA 3VUFA 2VYQA 2YHSA 4MA5A 2BBTA 4LCEA 2X40A 1PN3A 2X76A 1BH2A 3B2EA 4JS0A 2PL3A 1CQJB 3AUKA 4QPCA 5EXSA 4OK3A 3GPBA 3LUJA 4LVOA 1DBPA 1LBHA 4QUHA 4N0QA 5JNLA 3UAGA 4ICIA 4MAFA 4DKJA 3UAZA 4ZCRA 3NCHA 1T24A 2JJ2D 3H5TA 3HCAA 3OBBA 5JRZA 2KQUA 3MTAA 2GVNA 1OXTA 3FGOA 2A1UA 3EA4A 2QR3A 1VDZA 2PU7A 2JAWA 1GUBA 5IBRA 1UIRA 4JI5B 1P1IA 2HGZA 3GT7A 2VDPB 3OJCA 4J0IA 2R79A 1M2KA 2YJZA 1DXQA 4NZ9A 1GVHA 1VI6A 3A1FA 4TWIA 4OQEA 4XR9A 4EY6A 4OLFA 5DTQA 1ACLA 1A1VA 5J23A 3BE6A 4PZYA 4H1TA 1AHPA 4WA7A 1AK1A 1EKXA 1JH8A 1GNVA 4RTPA 1OIVA 2VJYA 3W1EA 1E8MA 4W7HA 4LJYA 4TT3A 4EELA 4CETA 3G8AA 5ES3A 1GL3A 3VYVA 5EVJA 4PQEA 1KZHA 4EFDA 2V98A 4ABYA 1E99A 5A3RA 2H0QA 1QVWA 3E03A 1XRNA 3QA3E 1Z0KA 4NBSA 4B6QA 3K70D 1SMKA 1V1RA 4ZJPA 4EPRA 3C3MA 1Y3FE 1ZGBA 3EBLA 4BLQA 4A36A 1OLSB 2Z2IA 4JKIA 4ENVA 1Q91A 1TRKA 4ZREA 3RT7A 2PJRA 4JR1A 2IYRA 2PMCA 2F67A 3C5CA 1ACMA 3HB4X 4HD8A 4S0XA 4L4UA 3EXHC 4YN3A 2FEOA 1LQUA 1UF9A 4NBTA 4ZQIA 4RAQA 4C0HA 5M7EA 2I9PA 2NSHA 4PFKA 2B5VA 3E1SA 4D02A 1FP7A 3O8DA 4DCMA 3U60B 4ZIRA 2VLBA 1NN1A 2Z5LA 1T1JA 4BJ1A 2GEVA 1VCMA 1D2HA 4MK4A 4BECA 1J6UA 3EK2A 4NFHA 1H1LA 3KJQA 1R4ZA 1YZKA 3BCHA 1M2VA 1HKUA 5AKXA 3KKMA 2IPNA 4B2LA 3HJBA 4YJ3B 5DN9A 3FSGD 3QWZA 2EFGA 1JR2A 5ENDA 4B6FA 3RU2A 4F9EA 1G3RA 2QDXA 4K9KA 2HSDA 1Y7LA 3LQKA 3T61A 3NIWA 2BEWA 2YW9A 4DA0A 3G9QA 3ADBA 2XKKA 4TQ9A 3AERA 3FPJA 4KYUA 5E4YA 4MR7A 4QVIA 3AEYA 4DEVA 4URFA 2CL0X 1FDVA 5AUNB 3D3NA 4RTQA 4D57A 1IY9A 4RSRA 5LU9A 1IATA 1N0HA 3JYNA 3VZDA 4LHWA 5CJPA 4G8BA 4FB5A 1RQ2A 3L3BA 4L5AA 5KYYA 5FWYA 2KBEA 3OURA 4J49A 2PIAA 4FNMA 3IAM6 3LUKA 4WOJA 4C6SA 3A4TA 4RM3A 3WNQA 4DQXA 1OXSC 2H1LA 2Q1UA 5KU7A 1KFJB 3UGQA 3EIEA 1GGFA 2V3VA 2IDZA 4E13A 2R5NA 2RJOA 1YKSA 3IT0A 1QIFA 4B43A 2EP8A 4HFJA 3BWCA 1AZSC 4LXUA 4BHTA 2NV2B 2ZR8A 3ZBUA 3DW3X 3N8IA 3CM0A 5IXYA 4KPGA 1O1YA 1VBMA 1KJWA 4AQYB 3LKDA 3FGZA 1C5KA 1EUCB 2NN3C 1K8XB 1RC0A 2PL9A 3GD5A 4MS1B 2Q1WA 2XHZA 4OHMA 5IDVA 4AUMA 4CW7A 4EHIA 3W2FA 1DAFA 2AVNA 3WO1A 1YACA 3D64A 2GCPA 2FF5A 3Q0EA 4OFBA 2JAOA 2NO0A 4ZVTA 1GNTA 3D6NB 4HNSA 4K9OA 3WYEA 1VRVA 3QVLA 1SVKA 3S27A 3RM3A 4QU0A 1JEEA 1BU5A 2BZGA 3GA7A 2Z9DA 5B1YA 1SAYA 4BMCA 3WLEA 1NBIA 3FLAA 3UG7A 4AX4A 4W4TA 5IT4A 2O07A 1EVKA 1PKXA 4OUKX 4LOKA 2WPNA 1CUSA 1LS6A 4JVOA 2PGAA 1R3DA 5J2UB 3EZXA 2BFMA 3MSXA 4PR0A 3D6TB 4IWYA 4V0SA 1I2CA 3KDSE 5C1IA 4LMPA 1YUBA 6AT1A 4BBZA 4J0HA 3NLLA 4PAOA 5HDQA 2BGMA 2H5EA 2DPXA 3LX5A 3LY9A 4LVCA 3FNHA 3QI2A 5JCPA 2OLJA 3Q8WA 1GARA 5AHRA 1OU4A 2OV3A 2PEYA 2W2LD 2XUAA 3DF7A 3U37A 4ZYTA 1EVJA 3NPAA 1JBEA 3K8QA 4Z4QA 2LP4Y 5JAPA 2ANCA 3BFVA 4JWTA 1GZDA 5ADUS 1PE0A 1AMNA 1RYDA 2B3DA 3I9NA 4WRRA 2V6GA 1VRWA 4YCJA 1RRVA 2CHFA 1JR3D 1LC3A 2YRWA 3KPUA 5DIZA 1G3UA 2EG9A 3S2EA 3QNUA 4CR7A 4EI2A 5IKOA 2XCSB 4HGNA 2VQ3A 2VJQA 3GQVA 9LDBA 5JANA 1OT3A 2WU3A 1JVBA 3FM9A 3MRSA 3OPMA 5TPWB 3WGLA 3U16A 2VF7A 4PWYA 3CQ9A 4ZZ1A 3AI3A 1L7RA 3E22A 1C7FA 4J6FA 4FCTA 1GL7A 5J43A 3LX8A 1L1RA 4E1AA 3EVAA 3L6CA 1JEAA 2FRXA 2GPJA 4MUAA 2CUKA 3BWMA 2ZIWB 1P8AA 5DBHX 3STXA 4GKVA 3O4JA 1A9PA 4M9ZA 4QM6A 1LK7A 1VPEA 1AQIA 5C34B 3SHVA 5DGTA 3O26A 4PNHA 3KYDB 3A1CA 4LECA 1L1EA 1QIEA 4DF3A 3QF4B 2K7FA 4HTFA 1IWPB 3EXEB 4R98A 2RHRA 2DBVO 5KSZA 2VJKA 1SM4A 3DLAA 4KE8A 3OC0A 2AOUA 3Q11A 2O9JA 3TOVA 3EF0A 5AT1A 2KS6A 2YJ6A 4OAOA 4TVKA 4E30A 5C5IA 2I2BA 2ZBPA 1LWOA 1G7RA 1M6EX 1KO7A 4RLHA 1UP4A 3IB3A 3T95A 4CNQA 4IFIA 3MQFA 1KEKA 3F1LA 1HYHA 1OE0A 1PTKA 2A9RA 3QBTA 2C20A 2MHCA 4LMBA 1NTOA 4PNEA 2AKAB 5LNK1 2W6ZA 4IV0A 8OHMA 4PYRA 2XNHA 1UKCA 4MV4A 3MAJA 2HU2A 1FX0B 4TXMA 3ZY2A 3MCUA 3MGKA 1NZDA 2H0RA 4KAFA 4RULA 3SS9X 1MJNA 4ZD6A 5T4FA 4RK6A 4LOJA 5G0UA 3B6KA 4IG9A 1Y8QB 3LCMA 3K9WA 5ITSA 1US8A 2B34A 4WD3A 3SQLA 3C45A 3U44B 1FYVA 4GE3A 5DV9A 1CU1A 3MRXA 4KXFB 4LSWA 1C8KA 3G2KA 3PI6A 4Y2SA 2IP1A 1SVOA 1AU9A 4FFBA 5CDUA 4MLCA 3F6SA 5EJ4A 1P31A 1QJ4A 5EEHA 4GF5A 2QROA 5CLLA 2E87A 4Y3UA 1J0EA 4WK4B 5JECA 2NOAA 5CAEB 4D9GA 3F3SA 1I3CA 2ERXA 3K96A 1L9KA 3B3JA 4TN1A 2J67A 1MTZA 3V5NA 2VTDA 4QPJC 3EIWA 1J24A 3DM5A 3E5RA 1Q1AA 3FDIA 3I2JA 1S96A 3OOWA 2HY7A 3KUDA 4KGDA 1W52X 3RI3A 4TVBA 1KAOA 3F3YA 5ARDA 3TZEA 4CTOA 1SG0A 2Q50A 1CY1A 4RVOA 5DN6D 1PJBA 4QFCA 2Y8EA 4EJMA 5BNWA 5JE8A 1UFRA 3WYNA 5K8JB 1GTZA 1BVYF 3KUCA 3NMUF 5DCLA 1W49A 1YGYA 1OYOA 1SCBA 1U1DA 2YQZA 1J9EA 1MX9A 2ZS8A 3BERA 3CCCA 3ETDA 3LYLA 3QEMA 4R8LA 4V0QA 5AI6A 3I73A 5IXJA 3BGWA 3GRKA 2IZOA 1CRQA 1K08A 1SEVA 4RA9B 1JEDA 5B1DA 2FX3A 1KAGA 2JZNA 2BJHA 5HGJA 5AQ1A 4TLCA 4BWYA 5KQMA 2WZBA 3ND9A 4IQ0A 3RS2A 3WG9A 1N34B 4GKBA 4XM2A 1GTRA 2R66A 2ZYTX 3SM3A 3VR4D 1H6CA 4D3SA 4OGLA 1QKJA 2WPDA 1ONSA 1IXZA 4JJ6A 3EG9B 4ZDJA 2MR5A 2ZTSA 4RDIA 1WCWA 3GCDA 4HUQA 2R7MA 3ZK7A 3AFOA 4E2XA 4Q7LA 1NQUA 1HNNA 4MICA 1RCUA 2OD2A 3R6WA 3SXPA 3A37A 2ZUTA 2HEIA 2VUHB 3KKOA 4ZQGA 2HMTA 2AN4A 2CUZA 2G06A 1FVFA 2AOVA 2PBZA 4MYSA 1N2SA 3F6EX 4IJUA 5DVZA 4Y2VA 1NMZA 4A6XA 3ZV5A 1RHUA 4F7DA 1HEYA 2QX9A 5DE3A 5CDYA 2QTNA 3T9EA 1BMTA 1STOA 1EE2A 2J7KA 4HX5A 4MI6A 2BEVB 3RUIA 3QU7A 3CB4A 4OH7A 4NR0A 3GAZA 4OJNA 4OJMX 4Q7KA 4L4XA 5ALHA 4P7JA 1T1RA 1T4DA 2ZSIA 3K0EA 5IM4F 2CYBA 2PGJA 3FJYA 4JI8B 1NVFA 2PYIA 1YB7A 1IK4A 2OHXA 3QP9A 4DLSA 1DPFA 1NDHA 3EB9A 1NJ5A 5TT1A 4FGKA 3RS5A 4I14A 4YP9A 4FZ3A 1A4XA 1RIIA 2VUSA 4FNGA 5C3MA 1ADBA 3WFJA 4EMTA 3PXAA 4TKVB 2YTZA 3TUJC 3KBOA 5F3DA 1SD2A 4HFRA 1U28A 4F6LA 3F6PA 3O6VA 3WYAA 4TQUS 5C46F 4BYGA 2WFZA 4OXNA 1ZLYA 2DKFA 2JFGA 2FGKA 2YYSA 3EAGA