1I9GA

Crystal structure of an adomet dependent methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
264
Chain Sequence
TGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN RV2118C
publication title Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 74
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1i9gA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i9gA02
3VC1A 1X1BA 3LDFA 3FUTA 1JR4A 1R8YA 1TW3A 4FSDA 5C1IA 1KR5A 3B5IA 4KRGA 3SX0A 4DQ0A 3NVKI 2PXXA 3M6UA 3R3HA 4LWPA 3PTAA 3HA7A 4RTNA 1FPQA 3LPMA 4FT4A 1YFJA 2NP7A 4BLWA 4E70A 2H11A 3HEMA 3EVCA 2P3LA 3G2QA 3TM4A 1BOOA 2JHAA 2ZZKA 1X1CA 4QDJA 5GM2A 3HCDA 5EHGA 1D2CA 3QOWA 4XUDA 1YUBA 4M37A 3KQVA 4KW7A 1IXKA 2PT6A 3DXYA 2BR3A 3HVKA 1I9GA 3P8ZA 4V0QA 3GXOA 3LBFA 2DULA 1UWVA 2YQZA 4OBWA 4HGYA 4QQNA 4DZRA 2LD4A 4ER3A 4PNEA 4MQ4A 5FWAA 3OZSA 4PYQA 4AZTA 3EMBA 4RTLA 4EMSA 2Q41A 3C3YA 1G60A 2C7OA 3R6TA 4M38A 3CGGA 3MTEA 4PIPA 2CMHA 3PS9A 1B42A 4R8SA 2ESRA 5EKXA 1ORIA 2NXCA 3A7EA 5ICFA 3M33A 1HNNA 3KPJA 3UJ7A 1YZHA 5B1SA 2ZVJA 3V8VA 4P7GA 5LQUA 3OFJA 1DL5A 1NW7A 5EEGA 2AN4A 3SSNA 3SVZA 3UJCA 1VL5A 3IEIA 4LECA 5LR6A 2Z6UA 3T7TA 3KR2A 4H0NA 5E8JA 5P8WA 1OR8A 2EJTA 2G1PA 1F38A 1XDSA 3AXTA 3GNLA 5EOVA 4GF5A 2ORED 3I53A 3FUXA 1JG3A 3DTNA 3G89A 1XTPA 2PSSA 4PYMA 3DLCA 4FP9A 3MQ2A 4X41A 2NXEA 4R05A 3CVOA 2ZULA 3LECA 3THRA 3O7WA 2ZIFA 1YZ3A 4PWYA 5K0FA 2IP2A 5E9JA 5ICEA 1FP2A 2BR4A 1L1EA 2QRVA 4WXHA 2I9KA 4YMGA 1X1DA 3GDHA 2H1RA 2PX4A 3UJ6A 5LSAA 2PX2A 2ZIGA 1XVAA 4P58A 5EVJA 3TKYA 3FYCA 5GIPE 3UBTA 1O54A 2P35A 3JWJA 4U7PB 1G38A 1AF7A 2PWPA 2ZIEA 5DTMA 1JQ3A 3EGVA 3HNRA 3JWIA 3LX6A 5GOZA 4P7KA 2NXNA 5EIFA 2Z6AA 3HCCA 4GOND 3OPNA 3MAGA 2ZBPA 4RV9A 3PX2A 2V74B 3DUWA 3SSOA 3BKWA 5E1MA 1SQFA 2GB4A 3LCCA 5HIKA 3SM3A 4E30A 4A6EA 2ZWVA 4R6XA 3TR6A 3ELUA 1SKMA 2CMGA 2OO3A 2P3OA 4HGZA 4OA5A 3FTFA 4RTSA 3GRYA 2B25A 3EGIA 3KQYA 3U81A 4CWAA 3BZBA 2ZW9A 1Q0TA 3MGGA 5JUWA 1WS6A 4C08A 5T67A 2AS0A 2XYQA 3TLJA 1WXWA 3UJAA 4BLUA 5HOQA 1QAMA 1HMYA 4Y2HA 1DUSA 3R9XB 1MHTA 2I6GA 3LBYA 2UYHA 3SXJA 3K0BA 4CKBA 1SUSA 3FRIA 1KPHA 4EK9A 5DSTA 1P1BA 2IDKA 3E7PA 2VDWA 4A6DA 5DWQA 4XCXA 1VE3A 1TW2A 5K0CA 2PGXA 4X61A 2IDJA 3M6XA 4IKPA 2FYTA 4MWZA 2WK1A 3GRUA 3K6RA 3IHTA 2GLUA 1KPIA 5FQNA 1Q0SA 4FT2A 3DR5A 3HA5A 5EG5A 2XYRA 5EMLA 2GPYA 4G56A 3G2OA 1INLA 3GRRA 1Y8CA 4HC4A 2OY0A 2ZFUA 3I9FA 1G8SA 2B2CA 1UIRA 3A25A 1I4WA 3Q7EA 5HZMA 5EZSA 2EX4A 3QOXA 3EVAA 3VYWA 4BLVA 2AOWA 5BW5A 2P8JA 2ADMA 4DKJA 2XVMA 3KQMA 5EMKA 4GOMD 1RJEA 3IV6A 1XDUA 4HTFB 4HH4A 5K0BA 2BH2A 3B89A 1DCTA 3C6KA 4ER5A 1NW8A 5ERGB 1VP9A 4RVGA 4V0RA 5H02A 3FRHA 4KIGA 5EC8A 4YUWA 3P2KA 5LQAA 3BXOA 1RI3A 2YXLA 2QM3A 3NW9A 5F2KA 5DX1A 4EKGA 2FPOA 3EVEA 1R8XA 1VBFA 4GC9A 4PINA 4C4AA 3D2LA 2HMYB 2EJUA 3TRKA 4KWCA 5K0NA 5KVAA 5F2NA 2P7IA 5DXAA 5EIWA 2HNKA 4E31A 4MTLA 1M6YA 2PX8A 5EEHA 1P39A 3TKAA 5DM4A 2OB2A 2NYUA 4QTUB 1PJZA 4BP3A 1XJ5A 1NE2A 2UZ4A 2C7RA 5FULA 3HVIA 3OE4A 2P7HA 3EVDA 3DOUA 3I5UA 3NDIA 3DH0A 4LG1A 1YFLA 2OZVA 1QANA 3C6MA 3HA3A 4BP1A 2WA2A 5DRTA 4YV1A 4OQEA 5LQRA 3DXXA 5K0GA 1I1NA 3CBGA 4BY9E 5LQJA 5KQRA 2AOTA 1M0EA 5GM1A 3FPEA 4Y30A 3I58A 3NWEA 5DSXA 1VQ1A 3RW9A 3BGVA 4C03A 3UFBA 1RI4A 5CVJA 4EVIA 3HCAA 4DF3A 10MHA 2N47A 4RVDA 3FTDA 5HFJA 2XBMA 2JHCA 4C07A 3KKZA 5K0EA 3NTVA 3ELDA 4RTJA 3P9IA 1SUIA 1VPTA 4HRAA 2QY6A 3FUWA 3NWBA 1RJFA 3BWYA 4P7FA 4QPNA 3CJQA 5K05A 3KU1A 2OB1A 5DM1A 3REOA 3EVGA 4ISCA 2AOTB 5CUQA 2VDUE 3A27A 3B3FA 3A26A 3G2MA 3FTCA 5C0OE 3G88A 4IWNA 3G5LA 3T0IA 3X0DA 1NW5A 4RTOA 2G8NA 5DM2A 3FYDA 3UA3A 4B17A 3TPZA 5EPEA 1XCLA 2O07A 3GO4A 3A7DA 4RX1A 3BUSA 5DT2A 5G02A 3AWIA 3LDGA 3Q87B 3UA4A 1L3BA 3GRVA 4OA8A 5KS2A 2IH2A 3KPUA 2IIPA 4QPPA 3SR4A 3FTEA 2NNWB 2ZZNA 1ZG3A 4KDRA 3OU7A 2PVCA 4PGGA 3CJTA 3FPHA 3A4TA 3PT9A 2IPXA 5HIIA 1G6Q1 3DMHA 1ZKDA 3OZRA 4L7VA 3GWZA 1G8AA 2GAFA 4CXMA 1SVUA 2VDVE 3FPGA 3MCZA 1ZQ9A 5E9QA 5EMMA 4RTKA 3WSTA 4YUZA 1L3CA 3C3PA 3DP7A 1V39A 1KYZA 2PXCA 4RWZA 2QRVB 2R6ZA 3GIWA 5CVDA 5D1NA 3TM5A 5ICGA 4RTQA 1R6AA 2F8LA 3UJ8A 4QDKA 5C9ZA 5DTQA 2ZSUA 2BZGA 2OKCA 2FK7A 5BP7A 1KXZA 1RJDA 2VZ9A 1ZGJA 4QTTB 3TOSA 1EJ0A 4GOLD 4E2ZA 3G5TA 4E2WA 3DMFA 2Y1XA 2O57A 3SMQA 4PYJA 4PYIA 2OPBA 5GWXA 3BWBA 5DM0A 2NP6A 2ZZMA 3EPPA 3HP7A 3P97A 1YB2A 4E32A 5EKUA 3P9NA 1KIAA 2ZBRA 3I64A 4OBXA 5M5BA 2P40A 5CIYA 3MHTA 5HEKA 3HVJA 3FUVA 3BWCA 1KPGA 3FPFA 3LL7A 2XYVA 1O9GA 1RI1A 2JJQA 3NVMB 1WZNA 2A14A 4GOOD 2VS1A 5E1BA 2C7PA 1RJGA 4E33A 4NECA 1NW3A 2O05A 2PJDA 3UWPA 4OQDA 5K03A 3NMUF 1BC5A 1L3IA 5E8RA 5IKMA 5FA5A 5DX0A 5FTWA 1JSXA 3KQTA 5LQKA 1EIZA 2AOUA 1JG1A 2YXDA 2YX1A 3M4XA 2NXJA 4PGHA 4FS8A 4CTJA 1MJFA 3EGEA 2ONZA 4IV0A 1FP1D 2ZWAA 4R8RA 2PXAA 1RI5A 5FADA 2B3TA 1KYWA 4OX9Y 1L9KA 4C06A 1NBHA 5E9WA 5FQOA 3DLIA 3EMDA 1XCJA 4PCAA 4GC5A 4JXJA 1ORHA 1R74A 1JQDA 1WG8A 3KR0A 2OBFA 4QQKA 1IY9A 2HR1A 2CKDA 3T7SA 2PLWA 2PBFA 2O0LA 5CM2Z 1PRYA 5E1OA 3RODA 3KPWA 3VSEA 2EFJA 1ZGAA 4RTPA 3M6WA 1ZHFA 4PYNA 2OXTA 4ER0A 4HG2A 1G55A 1N7JA 1BHJA 2GA9A 3PX3A 5FHQA 1RI2A 4CKCA 4K6MA 5CVUA 3UZUA 4AX8A 1FBNA 4WVLA 3JWHA 1X1AA 2ZCJA 4HSGA 4FR0A 3UJ9A 4FGZA 2PWYA 3B3JA 5FWDA 4PYOA 5MHTA 5BW4A 3BWMA 1KP9A 3AJDA 3SGLA 3ERCA 4KVZA 5DPMA 1EQAA 3KR1A 1EAMA 1T43A 3EEYA 4PIMA 2UYCA 2AVNA 3G2PA 5E1DA 2I7CA 4PYKA 1NT2A 5EZQA 3MB5A 4M36A 5HIMA 4E2YA 3LKZA 4Z2YA 5CCXA 4CTKA 1R00A 2G72A 2JHPA 3PFHA 3S68A 1NV8A 2UYOA 3KHKA 3NDJA 1P91A 3T7RA 5LQNA 3OU2A 1NV9A 3FPJA 1JSZA 3OCJA 4RTMA 2FCAA 3M6VA 2Y1WA 3R24A 2BM8A 4M7RA 2HWKA 5D1HA 4UOEA 2P3QA 5BXYA 1R18A 4IV8A 4MIKA 2AVDA 5GP1A 3KR9A 5EMJA 2P41A 5IH3A 3LHDA 4XUCA 3ELWA 3ELYA 3G8BA 3HVHA 5GIOE 3FUUA 1XXLA 3HCFA 2EG5A 2QYOA 4AUKA 3ER9A 2IFTA 4RYLA 3HTXA 4DM3A 3B7PA 3HCEA 5E2BA 3KQOA 4C04A 1D2GA 4FSXA 4AZWA 2ZBQA 5HIJA 2AOXA 4F85A 3P2IA 3LDUA 2IBSA 3O4FA 2VP3A 4FZVA 1VP3A 4ATNA 5U4XA 2H00A 2YVLA 5DLYA 2WA1A 5KYGA 3P2EA 3HM2A 4YMHA 4O29A 1QAQA 2JH9A 4YUVA 2YUIA 4AZVA 2BM9A 3TMAA 2AN5A 5E2AA 3LSTA 3PVCA 4X1OA 5FUBA 2FHPA 4RSRA 5T6BA 3AXSA 1JG2A 5CVVA 2ZTHA 3LGAA 1X19A 2YXEA 5T64A 3BGIA 2QE6A 3R0QA 3PB3A 1NW6A 4EKIA 2K4MA 3CC8A 2UYQA 3SSMA 4DCMA 1QYRA 3GRZA 5GINE 5K01A 3THSA 4GUAA 5KQSA 2I62A 1D2HA 2GH1A 2IGTA 5FCDA 2YTZA 3VC2A 3IYLW 4PONA 3KPYA 3F4KA 4ZTBA 5ICCA 2B9EA 5K8VA 4YUXA 1N7IA 2PKWA 1SG9A 3P9CA 3DMGA 1EJ6A 4X60A 2JH8A 5CCBA 2G70A 5HILA 1BKYA 3LCUA 3AY0A 4GEKA 3H2BA 4DCGA 3ID6C 3P9KA 3ORHA 3ME5A 2AOVA 3LKDA 4XUEA 3GJYA 1KHHA 4RVFA 3TFWA 1IM8A 4GQBA 1UFKA 3KPVA 2Z6QA 2DPMA 3BGDA 2AZTA 3E05A 3GU3A 4F84A 5K09A 1Z3CA 3EVBA 4QVKA 4POOA 4MHTA 4R6WA 4ER6A 1WY7A 1QZZA 2ZLBA 5DX8A 1NKVA 4GBED 5K0JA 1TPYA 1JG4A 5EGSA 3OZTA 5DRYA 3P71T 3UJBA 1SQGA 4ER7A 1AQIA 3G7UA 2JG3A 3O31A 3UJDA 8MHTA 5FHRA 1H1DA 2CL5A 2CWWA 2ERCA 1F3LA 2R3SA 2ONYA 4KIFA 2PV0A 3G8AA 2PY6A 1VLMA 5DXJA 3TQSA 3KQWA 3KQQA 3PFGA 4DMGA 2O06A 2FK8A 4KDCA 4P7JA 5K0LA 3BT7A 3GCZA 3L8DA 5LQCA 2P1DA 3DXZA 4DA4A 3HCBA 2PX5A 3MERA 4HTFA 1AV6A 3C0KA 5EQJB 3GGDA 3RIEA 3E8SA 3B3GA 3DULA 4QVGA 5FA8A 4PYLA 1P1CA 2YR0A 4LWOA 4YV2A 7MHTA 2PT9A 3OU6A 1EG2A 3E23A 3OFKA 5EHIA 4C05A 4AZSA 4X63A 3LCVB 1M6EX 2BR5A 3JWGA 1NBIA 4RVHA 5CVEA 2IH4A 1JQEA 3QV2A 9MHTA 3OE5A 2HV9A 2AOUB 3EVFA 1FJXA 1JTEA 4PCLA 4RTRA 2IH5A 2C7QA 1WXXA 3KQPA 1JTFA 2V7EA 4F86A 3M70A 3MTIA 2KW5A 5JR3A 2HTEA 2FRXA 1N2XA 1AQJA 4U7TB 3EEOA 4E2XA 2AN3A 2G71A 4YUYA 3PLAE 3CKKA 3KQSA 3FZGA 4EQZA 4YV0A 3MCTA 1YF3A 3EVZA 4CKEA 3CCFA 3V97A 3NJRA 5DTRA 2OYRA 5CD1A 3ER8A 1QAOA 3ANXA 1XDZA 2AR0A 3CJRA 2E5WA 1VIDA 1O9HA 1U2ZA 2B78A 2XVAA 2IBTA 2GS9A 3BKXA 5F2OA
chains in the Genus database with same CATH superfamily
1LPOA 4UBLA 4DTCA 1L7VC 3ODPA 5C1IA 3REFA 3NVKI 1NU8A 2VYFA 1HT2E 4MV9A 5JDIC 4QXOA 4Q7LA 3WOVA 3UPDA 1KJ8A 5FOWA 3N2KB 4DIKA 5L3RA 4BLWA 1P3DA 2ZRLA 4OYYA 3C5WP 1T5SA 4YTEA 5B7QA 3EVCA 2DYKA 3QZUA 4MO2A 3TTUA 2C3MA 1H2AS 2EZTA 2JHAA 1YI8A 1LPPA 3MJSA 3OZIA 4P4SB 4C4YA 3ZZNA 1TJ5A 4RDHA 1F17A 1JLLB 2I8CA 4NBWA 1OI7A 1NASA 2GR9A 4D6XA 5LIRA 3WLPA 3J81A 4QQNA 1EM8A 1Q21A 1QE5A 3FKSD 2IKSA 2VDNB 3K4PA 4LCBA 3VR1A 3OZSA 4PCUA 2M6RA 3OJXA 3CO5A 2A86A 4BQSA 3L92A 5C46F 4ZQHA 3PYMA 1ML3A 1DKRA 4I1VA 4YRFA 2ESRA 3RC7A 1U8TA 5CK5A 2O3QA 3M4JA 2BMFA 1PEYA 1A4XA 1HNNA 1OHHD 1FDWA 2XEDA 2ZAGA 4QG7A 4YO7A 5AIBA 3LQKA 4GNKA 2AN4A 3AL0C 3FYUB 5M29A 4IRMA 2D4AA 4NU8X 3UV6A 3AM5A 3B6MA 4FYIA 5AKKA 4M0KA 5FIUA 3E1SA 3FGZA 5JPIA 1TIKA 4PFJA 4U8HA 4W1RA 4M0MA 3OICA 4C0XA 3B5JA 4FN5A 4WPGA 5LC1A 1NYTA 5CEEA 2VH5R 3F2IA 1Y9DA 2WU4A 3GA5A 4IDCA 3ZHTA 1HUQA 3L49A 3ILHA 1V1MA 2WZBA 3TIWA 4WGFA 3KYCA 3TI9A 4BMZA 2QL5A 3MJ4A 1XKLA 3SR0A 3JALB 1I9CA 1YRAA 3CTMA 4IUYA 5FOXA 1G38A 3I0NA 3EC2A 5KNCD 3TZ6A 1A96A 1TUIA 1UK9A 2A6PA 5DHUA 2ZGVA 2IXBA 2EG9A 2X4DA 4IDPA 5BOVA 3HY4A 2JFOA 3PX2A 1XWIA 2ZUCA 4DWWA 3WIDA 3TSCA 2GM5A 4FGSA 4KI0A 4D99A 5JV5A 1EWYA 5KWIA 1Z35A 2PWAA 4BLOA 1YVEI 1OWNA 3ELUA 3DWIA 1XQXA 3OKFA 4MNTA 1NF8A 1PFQA 4MGKR 5I6DA 3FMIA 3JQ8A 4FFMA 2OXTA 1P7WA 1B23P 4Y2SA 2VO1A 4AP5A 3PPVA 4EJSC 1O6BA 2HSEA 5EUBA 4LFAB 1BO6A 2JIMA 4BFLA 4F45A 3JQPA 3TRFA 4B09A 1L5OA 1U6IA 3KUXA 3QTLA 1W4RA 5JYBA 1ECJA 1ZOSA 5K3OA 1P1BA 3HBAA 3I42A 2P9BA 3EFEA 3E2IA 3QENA 2COEA 3HFGA 4BQEA 2PGXA 1VDMA 1S96A 1Q83A 2FSSA 2QN2A 3IHTA 2HHHB 1AKVA 1G9SA 4KX5A 2ZXUA 1HTWA 2BFMA 1U7WA 3DR5A 3SE0A 4H2DA 3SU8A 2XYRA 4LMPA 3UHJA 4AKEA 1GTRA 3AR8A 1QBGA 3IJPA 1Y7PA 3G2OA 1E62A 3LGXA 4LGYA 2AC7A 4WKBA 4Z53A 1KERA 1QHHB 4O2AB 3PI7A 3ZCQA 3P0IA 3B5EA 4BLVA 5BW5A 3V4RA 2ADMA 3ON5A 5HQ3B 1CS0B 4TLBA 1K06A 2DFTA 3TQTA 2P9ZA 3HNPA 4YBZA 5EMKA 2WILA 4HTFB 4Z9XA 3Q0EA 4BEVA 3K0AB 2ZB7A 3TDMA 4ZT3A 3UWKA 3B89A 5CBPA 4GP9A 4JLVA 4UM5A 2ECPA 3S28A 5H02A 2PVSA 3ULKA 2C8JA 5EC8A 4A8PA 5CM8B 3UO8B 4PPGA 2DVMA 1PX0A 3D8SA 5CDSA 3DBRA 3QJ5A 2FPOA 2QB5A 3AUUA 4IMIB 1FS6A 1H8ED 5DIFA 1J8QA 1VRCA 2H5EA 3OIYA 3PHLA 1NUHA 1Q0ZA 4I4TB 4CL0A 4B3HA 4MLCA 3T52A 1V7ZA 3ANYB 3KXDA 2IIQA 3OZEA 4L0QA 4UMDA 5T7BA 1NOIA 3SYLA 4B3MB 1F51E 3P2YA 1ENYA 2EFHB 4IBOA 5EEHA 3KB6A 1BXKA 5C4IA 1W85A 3HVRA 4YP0A 3T4EA 3QA3E 1L2TA 1H8HD 2YINC 3AR6A 2PE5A 3AILA 4CV3A 3ZGLA 1GL9B 1C1YA 2YZ7A 1SC6A 4CF5A 1MO6A 4TS4A 3THOA 5U1PA 3MWYW 4MRPA 2J0UB 3QEAZ 1OMOA 4OTZA 3OEHD 3A1EA 1YFLA 1ACJA 4WBNA 1UBUS 2P9YA 1M2OB 2FUKA 4HT3B 4Z4QA 4BXOB 1BFKA 4KPGA 4FINA 3BWVA 5K0GA 5MGBA 2FSFA 2OVFA 2CNOA 4BY9E 4NG4A 2Q3JA 5GM1A 3D3WB 3KYJB 1XTQA 2HO4A 1XC7A 2BRUC 1U8EA 2JAWA 1I1OA 4O4LA 2F8MA 2CUTA 1Q11A 3Q5GA 1Y89A 1T8WA 2P91A 3C5HA 4F4IA 2ZM5A 2N42A 4P1ZA 2Z30A 3T1NA 5GTDA 4WXRA 1VMDA 2FPPA 1E4OA 2VJDA 4KJZA 3QFTA 5AVWA 4W5QA 1VL8A 5BNFA 2EDCA 5GQSA 1PSWA 3U39A 5CXUA 3D8BA 1GZ5A 3UK0A 4AMVA 4EA6A 5F2EA 2FWRA 2DKOA 3V8RA 1YK0A 4DV0B 4PANA 3ZWPA 3WWYA 4EHBA 3WGLA 3ZDEA 1QOPB 3CJQA 2IYEA 2V3VA 2NMVA 3BF8A 4PLFA 3EXFB 3AU9A 4I19A 4XYMA 1RZRA 1Z12A 4RIEA 2UUOA 2FQ1A 1E2BA 2C9CA 3T0IA 4HFJA 4Y6RA 4DJJA 3O74A 4QZVA 1KMIY 3JXEA 2ZCUA 4AF6A 1Z5OA 5BQFA 1UOQA 2Z09A 4WXPA 4BAUA 3H05A 3IERA 4B17A 3H65A 1DVRA 1Q7TA 2MSCB 3ADBA 1SCNE 1BSVA 1TYEB 1NNEA 3SPXA 1U5CA 3H4TA 3LDGA 4CV0A 3GRVA 3OOEA 3NYWA 4M49A 1E6KA 1KYVA 1UDWA 1F4VA 1KC1A 3C8ZA 3QKRB 4LV8B 2XMRA 1BQ3A 1XWFA 2PUJA 5A0TA 4JB0A 2HF8A 1UJMA 3EQ2A 3IBYA 3GEGA 3IQIX 4X3OA 4D9GA 4OFZA 2IRWA 3ZVKA 2GAFA 4UU8A 1L3CA 1I14A 3AM3A 4A91A 3PWZA 4M9ZA 1M7HA 1B41A 2QRVB 1E59A 2A9KA 3AZOA 3T35A 3FH0A 1FUYB 5EWJB 3GLHB 1K3UB 2X4LA 3RYFA 4ZN6A 4QVIA 4LXGA 5CR9A 3URKA 3K2QA 2OORA 4PBTA 4XCVA 2ZROA 3GJ3A 2YOHA 3T7AA 4J7CA 2QVLA 3A2NA 3GJ7A 4M2LA 3FR8A 4I9FA 4KXLA 3QA9A 3ZJTA 4M7OA 5KJ6A 4WI1A 1GTSA 3PFKA 4EJMA 3DMFA 2Y1XA 3E81A 1NN0A 1FQKA 1RQLA 1XZIA 2A4KA 2BEVA 2R6GA 5I3CA 5LD2B 2P75A 1V9SA 1F2DA 1ICEA 2EERA 3QEJA 1DUIA 1UWCA 5F1PA 3T3DA 5JVDA 1Z4QA 2GTHA 4CGYA 2I80A 5T41A 3H8VA 3JW8A 5CIYA 3PQ6A 4PZAA 1OFGA 1DAOA 1S4MA 2OBNA 1Q6YA 4G4IA 5JARA 4L7QA 3S70A 4FHFA 5CEFA 2P77A 4LX0A 4EA9A 1XRSB 2ZS7A 4N39A 1N0VC 3EVTA 3ONWA 5G4KA 4EBFA 4ZHQB 3D59A 3F5DA 4AZ3B 1ZUWA 2H1LA 2NZ8A 2XKBA 1PQUA 2QLJA 1CJKC 3SIXA 4ZDIA 1KJNA 5I7VA 1MJFA 5B58T 3TKLA 1JN0A 1FXSA 1GGFA 3RVDA 2DEUA 4NCXA 1PK8A 3IILA 3KT3A 1NOKA 2A59A 3KLOA 1KIMA 4P5PA 4X54A 5GV7A 3WK5A 4A27A 3ZDDA 1I6WA 1NBHA 2HFJA 2NV2B 5E9WA 4CMKA 5ICSA 2BI8A 3K71B 4WCFB 2MM2A 2FUCA 3L40A 2A78A 3S2EA 5AM3A 3W2GA 4JC5A 3TVDA 1XMIA 2I71A 1CE8B 2FA9A 3CLVA 1GCOA 3NBFA 2O3UA 3PDCA 4MUEA 2JC3A 4YA6A 4ZQFA 4BFZA 4JI4B 2GYWA 3KPWA 4RXMA 4OMDA 1U8UA 2Q5QA 3B48A 4J8PA 3JQFC 3IJEB 2WI8A 1KFJB 3DDWA 4N6GA 1OWPA 4CM9A 4CV1A 3N1UA 1KYYA 4LQLA 4TT3A 1WP4A 1EXDA 1QTIA 2O8FA 2OCPA 1BS9A 3H11A 5EESA 3JR3A 4BOYA 2HOQA 4HDRB 2VDJA 3LDHA 3I1JA 4ZQCB 1NF9A 1HY3A 3FROA 2WC1A 3UJ9A 1E58A 3IURA 5JU6A 2Y3IA 2GA8A 1ODIA 4LSMA 3WGUA 2I2AA 3D8RA 1KP9A 2GJSA 3O92A 1VG9B 4KVZA 1IPFA 1E61A 3FFBA 3RJ9A 3O8QB 3MQ4A 2QDXA 1B16A 1WLSA 2PUTA 3PXBA 4C7MA 1RLIA 9ABPA 5BSEA 2EHDA 4LVUA 3ICEA 1AN9A 3G0OA 3HY6A 4EA8A 1R00A 3GVIA 5CHEA 1NNSA 3T5BA 3NDJA 5DYIA 5FTMA 1N8SA 1WDWB 3L7LA 3MBOA 4QOIA 3TUIC 3X1DA 4CIDA 4NYJQ 4COKA 2IT1A 5DHPA 1JSZA 4J3JA 3KQNA 1AA9A 2F3TA 3GEBA 4QXRA 5A6VA 3VFDA 3AKEA 1TTHA 1QUEA 1YULA 2XQFA 2NTNA 3NC1C 4PWZA 3KR9A 4U6QA 1EVLA 2JFHA 3FJ1A 1LTHR 1T5IA 1A0OA 3ORQA 4OXIA 4KE9A 4YV7A 5GIOE 4OK6A 2QRLA 1KAEA 2A1IA 2OP0A 1BMFA 5CA1A 2EKPA 3WLKX 2WSLA 3DJFA 5EIHA 2B8WA 1E4EA 4MUIA 1DOAA 3NONA 3H2JA 4B7XA 3OD1A 1RCTE 1Y42X 2IBSA 2QX6A 4GOJA 2OV2A 3E5MA 3WYGA 2GZHA 5U4XA 3OT1B 1PP4A 3QWZA 4EX7A 2PTHA 1QAQA 2WT4A 4JX8A 2E37A 3OY7A 2IEZA 5DI3B 3SNKA 1WCIB 3E9CA 1FPMA 4XE5A 3ZC3A 1RRPA 2ZUSA 1XVVA 1USIA 2XCOA 2IY8A 4FKZA 4UXHA 3RC3A 3TMAA 3TF5A 3CVXA 3RS9A 1RM4A 4QNRA 2W6NA 1TK9A 2FHPA 3P0RA 1B1AA 2PM8A 3BB1A 3S1AB 3UAXA 4XM0A 4S1OA 1UKZA 1MIOB 4DUGD 2YXEA 5T64A 2G80A 3SKXA 4ZEMA 3IKTA 3PB3A 1NW6A 1KO5A 3PL1A 3IVAA 2HV8A 2UYQA 4MA4A 4MUMA 4MYTA 1MC8A 2DE0X 4E5PA 4JNKA 3B1ZA 4HDAA 1JQLB 3K73O 1W29A 4QRIA 3GQBA 4IIBA 4D42A 3BCUA 4F8EA 1ODTC 2I4TA 2Q0XA 3KVYA 5DP1A 2HIGA 2WF8A 3FI0A 2N9UA 3VPCA 9GPBA 1S7CA 1K92A 1IONA 1DEXA 1VZ3A 4OXKA 1SN7A 4J91A 4Z7OB 3Q88A 3BDAA 4A7PA 4DR6B 1GPWB 2ZRKA 1J7JA 4DR3B 3TCNA 4TGLA 5U9CA 3VR5D 1YONA 3GU3A 3HP1A 3DFZA 3DT8A 4NYJR 4HH0A 4RPCA 5A7GA 4CF4A 3G5UA 3UW1A 5DLPA 4L75A 1VCIA 1XD2B 4YAWA 5BSUA 4EY5A 2GBFA 2ATXA 1U7PA 5JNUA 2C0QA 4PQGA 2PA0A 4AW9A 4INJA 4Q3EA 3S2UA 3DVRX 4W1PA 5FUWA 3VR6H 2XKJE 2RGXA 4Y9UA 1NSTA 4QC2A 1PJ2A 3Q5DA 1OI3A 4PF1A 1L7BA 1ZFNA 5DV9A 5DSZA 5EGNA 2LW7A 2Q2OA 2CXPA 1HT0A 3PFWO 1TKRA 3FOFC 2YVUA 3KVOA 4GGPA 2AF4C 4GXTA 4HRXA 4WGGA 4Z6KA 2Z2XA 5FF9A 2G1KA 5LWQA 2F4NA 2B4AA 1Z38A 4OU5A 2J59A 2UZAA 2PUCA 2CL6X 5EJFA 1GSOA 1YD7A 3PDHA 4ZAYA 1YUNA 3CUVA 2W2PA 4AZSA 4QDUA 1YCFA 2CCKA 2EP8A 1EXNA 3M3PA 2PPLA 4C78A 1ORVA 2XZPA 3WWEA 5F5XA 4DLNA 2APJA 1RP7A 4MW9A 4KWHA 4R7TA 4ZVQA 1BEEA 3VJLA 3UUWA 4RTRA 4MW5A 3CINA 2C7QA 4IYJA 4M0CA 2R86A 2FEKA 4F86A 4FMBB 2CEAA 3QC8A 3GVHA 2VJOA 1Z2CA 2GJAA 4B2YA 4L9WA 2H65A 1FX0A 3CUKA 2AN3A 1RMYA 3KKOA 4RMIA 3SOPA 4O3MA 3HK2A 2IU4A 1JH9A 2O8DA 1YB5A 4CKEA 3TTYA 2PSDA 3COVA 4O8ZA 4AKIA 3IEUA 1PEKE 1IN5A 4QGHA 3BFXA 3ANXA 4ZAWA 5AKLA 5JSHA 2E5WA 2JRCA 4XWYA 4HFMA 2B78A 5TPWB 1KRXA 1UOOA 1M8KA 2VH2A 3MJFA 4NH0A 1VA5A 2FQQA 2YHIB 3H1FA 4DDHA 3EGDA 3BKXA 2OM2A 3RUAA 1K0FA 1ZOOA 2BHLA 1A7AA 1MV5A 1YWGO 1R8YA 4R1UA 4EW1A 5A5VA 5DNYB 1YZUA 3QX3A 1OYYA 1V5WA 2LR0A 1BCSA 1QX3A 1Z73A 2P11A 2PNFA 2J3IA 1OX4B 3IGFA 3R20A 4J43A 4Y2GA 4YAFA 3ZH2A 3G0BA 4UBKA 3RRBA 4HV4A 7AT1A 1U2EA 4PN7A 3TLGA 5GADl 1VL0A 3VM6A 8ADHA 1XD9A 1DEHA 2NO0A 2XUPA 3N3AC 2I3ZA 3ZW8A 2DFVA 1SKUA 1CD5A 5D6OA 3U60B 4B34A 1Y9EA 4ZICA 3QOWA 1THTA 2C9ZA 2FOLA 1QGZA 2HRRA 2RHRA 4PTYA 1KEEB 1I7DA 4YDHB 4Z0PA 1P5HA 3CE9A 2WV7A 5A1TA 2O2SA 4ZAXA 1A72A 4AZTA 4BWVA 3RJZA 2C61A 3U16A 2I4IA 3ZVLA 4PIPA 5FP0A 1EUCB 2XQKA 3MTEA 1ZITA 3PS9A 4ZAVA 1Z6GA 3M1YA 4K9MA 1IJFA 1ZK0A 3MXTA 2B82A 5ITSA 2RBGA 4UTRA 3U61B 2XNCA 2XB2A 2BKEA 4LY3A 4Q7KA 3C45A 2WLSA 3F0TA 4QYMA 3RS4A 2EYQA 5EEGA 4UVIA 3RPEA 3SVZA 4OJNA 3GUCA 4FGUA 2ZRCA 3IMFA 3LG2A 5P8WA 1E9RA 1YOBA 1JGTA 4FFBB 1DC8A 1BMQA 2HRZA 2W2VA 4FNOA 3GNLA 4MJLA 3T34A 4AJ9A 2P1RA 3B6ZA 4L5JA 3LLCA 1Q16A 2NU9A 4MKZA 4D26A 1DS6A 1DRUA 4RA6B 1V0JA 3L8HA 5AKIA 3WGGA 1U5AA 1FYDA 3KLBA 1R9NA 1N78A 2Q2QA 1E3JA 2H1CA 4P3OA 4US1R 1CPYA 1JQJC 4NV3A 5BYBA 2JGLA 3UJ6A 2BD0A 2J30A 1P1KA 2BKXA 3CPEA 2BFEB 1JEQB 1RAIA 1UODA 1TVMA 2QE7D 2IPOA 3JZDA 1KAQA 4LJ8A 3T61A 2PWPA 4WBNF 2J9GA 3EGWA 2GUWA 3TZCA 1KQ3A 4BUCA 4DLXA 4LOHA 4A8HA 4RULA 2NXNA 2OXFA 1CJTC 1C41A 1OASA 1U1CA 2WD7B 2ZBPA 3AW9A 2C59A 3C14C 3DDCA 3FE2A 4UQPA 4CIBA 5J4KA 4W5NA 3DNPA 2NZUG 4NZYA 1MO2A 4O4LF 1RYEA 3IHWA 3LM8A 4KQ1A 1F9EA 2FR1A 1VZ2A 3FTFA 2JJYA 3DFUA 4WAUA 5UKDA 4QATA 1CR1A 3EGIA 3WKAA 4HADA 5T3UA 3RRYA 3F4BA 1IHOA 1T3SA 1IZ7A 1FUEA 1K1EA 1TPZA 4X1KA 1RHKA 3MUEA 3NM5A 4KV7A 4XGQA 2FZGA 3PIDA 4K2AA 4RFLA 2HBRA 2YN4A 1WV1A 3BGWA 4PRLA 4EF4A 3TZKA 3HWWA 2ID4A 2C5EA 3I0ZA 3JWEA 2P62A 4XIJA 5DBGA 1W8DA 2W2LD 4AC9A 3L0BA 4E22A 1NVUQ 2GJ8A 1FDVA 4RANA 4A92A 4UDXX 3UQZA 1W5FA 4JT4A 3E53A 1A5TA 2P9HA 4FDAA 4A6DA 5HZGA 1SUAA 2JIZA 2R6CA 3DO8A 3FWNA 2J5KA 4X1YA 3K9QO 3LW7A 3GRUA 3NTQA 4TM8A 3HO8A 1SHJA 2OD9A 2GD0A 5ER6A 1Y6FA 1EK6A 4QT0A 2GPYA 3SHVA 3MMNA 4F60A 2PRKA 5IBCA 5DE3A 1P7CA 1QDLB 3E3MA 1I4WA 1WKBA 1NDQA 1GNQA 1RJWA 3DE4X 2GFQA 1NBOA 1SG0A 1TRKA 1YE5A 1AQLA 2PR7A 3S40A 2NWQA 4UUMA 3TL6A 1PFKA 2CGEA 2FG6C 1C9YA 1L8QA 3EY4A 3A3YA 4QU8A 4REMA 4F6RA 2WB2A 3U7QB 5C3UA 2TMGA 3RBXA 2IS6A 2WP8J 2SECE 2CBGA 4X45A 2XJ4A 3QUSA 3S44A 1NY5A 4J29A 5HDQA 4L0MA 5E6UA 4TYYA 2ES4A 1JFVA 4EZEA 3L7BA 3SXUB 3BG5A 1PWZA 3TBFA 1Q19A 3NASA 4RCZA 1GPYA 4CU5A 2DUNA 3F3YA 4FSHA 4YMTA 1EJBA 2HQRA 2B8NA 4LJ5A 4HYQA 4OIMA 2WLTA 4RZ3A 5TQVA 3UWSA 1W4LA 4A82A 7REQB 3RRNA 4Q3LA 2C5GA 3SX2A 2XVZA 3MBIA 4ZYUA 1FSZA 2AFRA 4YT4A 1KJIA 4OJQA 1AKYA 4ITRC 2ZSEA 4C0AC 5IMSA 2I78A 3L01A 3ICQB 3M4ZA 1PFGA 5GAJA 3K9GA 1NI4B 2HQSA 5SV2A 1S9DA 3I5UA 4BC1A 1GSAA 4BMDA 4CG3A 5KREA 1QP7A 1NJ1A 4P9NA 1L5HA 4WN9B 1ECBA 4FIZA 3QLTA 1VJ0A 1SXJC 3EIQA 3BTUA 1Z7WA 1FB5A 2YZ2A 1HRKA 3F8WA 3LXXA 3MS4A 4C0HA 3ZQUA 4FLEA 4RPKA 2W6JA 3INTA 1OXMA 2XV1A 3B6IA 4YRAA 1RQGA 1XZLA 4MI6A 1MABB 1QIJA 2H7YA 2LCFA 4EWLA 1XQWA 3BGVA 2CFOA 4HS9A 4JGGA 4V3BA 4A03A 5K0SA 3DFKA 2CHFA 3DP9A 1CEXA 4IYRA 3JU3A 4N01A 4H7HA 4JL6A 4EPVA 1P62B 1HT3A 3BRSA 4E12A 3HXOA 1EPUA 3V3KA 3G9ZA 1XCOA 3JQGB 3ZGYA 1HG1A 3I73A 3LGSA 2XE4A 3VDNB 3IODA 4O4JB 4KAJA 3W06A 2BHSA 3AR9A 4D9KA 2ZWIA 4K1LA 1QDNA 3N2EA 3NBQA 2D5CA 1KMNA 2OUIA 2QD3A 5IDWA 4K86A 1A7UA 5CFNA 2A2ZA 5CNJA 2PO5A 2KM1A 3SQMA 1E2LA 4L3WA 4MVJI 4NYIQ 3DVQX 1TIPA 1H9BA 1PZNA 3STHA 1TZKA 1MZVA 5AVRA 2GI4A 4OL0A 5D3QA 5DDIP 1DWQA 4YQEA 4RY0A 2A0YA 3V2HA 1FVXA 4ZVUA 1UMCA 1JT2A 2ZBGA 1RKVA 1G17A 1H6CA 1RKXA 2BFPA 3GLTA 4J16A 4O1MA 4TWIA 4ZOEA 1HZZA 4HZGA 5H7XA 1WDLA 5BQOA 4YXWA 2I7XA 1ZESA 3KPUA 1XFAA 4ENVA 4ZZ0A 4C4XA 1P2SA 5AM5A 1QIFA 1OY1A 3MINB 4Q9KA 3ZKWB 2ZJYA 4NHEA 1Z8NA 4MUJA 1NHWA 4IFEA 4JI6B 4TOIA 4V1CB 2AKEA 5HIIA 3NWPA 3WC4A 3VO1A 2VDVE 4BPBA 3EAGA 4NDNE 1WB6A 2YWJA 1GFWA 1I3OA 2AW5A 5LBUA 4EYGA 4BV2A 2BDUA 3KLMX 3GJRA 3SYMA 1U9JA 1N6NA 2KJQA 3I1IA 1O6FA 1JPNA 1U7TA 3ITKA 4JHXA 4JY7A 4KQXA 5SYMA 1I6LA 3OURA 4QDKA 1DP4A 1UBEA 1K27A 2RGNA 2FK7A 2V7QD 1DQNA 4G1UC 5HE8A 4CDRA 4FN4A 4GOLD 1ZM7A 2QW0X 3TG2A 3CZPA 3UAOA 4Q7JB 5CA1F 2JHFA 2W4QA 3GMDA 1BH6A 3THXB 3OJOA 4B4VA 2YJGA 4N4AA 1KH1A 2ZZMA 5LXTB 1N0IA 2H06A 4E32A 1TA4A 3LA6A 3T5TA 1X70A 2ZIAA 2TSYB 1P5ZB 3I30X 1PR9A 1RXVA 2AG0A 2ONJA 4L07A 3UUEA 2H2WA 2QMUA 2QV7A 1IM5A 2AZXA 3PENA 1GTMA 2UAGA 2CK3A 2HHAA 4DRXA 4PLHA 4XWWA 3HKCB 4RGQA 2C7PA 1ZDMA 4GXRA 4HH3C 4JLPA 3FJOA 2O05A 3HBLA 3T5GA 4S2UA 1HXHA 2Y0DA 1WMAA 1UDAA 4XARA 3MUNA 4LN1A 2VHUA 3KQTA 5CJ2A 5CURA 3UAGA 4BO5A 3OOWA 2ZRIA 2NAPA 1FP1D 3G68A 3WI7A 4AJIA 2FU5C 4NMWA 1FDRA 1FMCA 1W47A 2F9FA 1G1AA 3L5OA 1DXHA 4K0RA 3RI3A 3ZU5A 3SVLA 3EOZA 2PCLA 4KI7A 4Q4LA 4QYIB 2O14A 5E9AA 4GX1A 1Y7TA 3SD7A 2EKLA 1JQDA 4GXNA 1EE9A 4ZCPA 1VHQA 2PLWA 1RADA 1XYYA 4KHZA 3O47A 5I4KA 4QHSA 3UPTA 2IIBA 2V7XA 5E6SA 5JCJD 1OBFO 1HSOA 4JLUA 3UANA 3VYVA 1CERA 4NZNA 2H31A 2CSUA 1S8FA 2LBPA 2XBLA 5F9MA 4HGNA 1DCMA 1G55A 3E3LA 2GN6A 2B61A 1TEVA 2GVZC 2YRFA 3KSDO 4MHSA 3D54D 1Q20A 2CLDX 3LY7A 3E4DA 5AH0A 1BRMA 1YQGA 1FBNA 1FSSA 4EY6A 3CRVA 1KI9A 4GMFA 4WV3A 5K8JB 3WY9A 1KP3A 3C85A 5SZJA 2R6R1 4IS3A 1HBJA 3GR6A 3WQRA 2CF5A 3KHUA 4DLRA 1JIKA 2DY0A 2QJWA 5GPBA 3KR1A 1T43A 1OLUA 4Y1RB 2UYCA 3PFNA 3M6LA 4JU8A 4GZ6A 4L22A 4U2KA 4UOQA 2XT9A 4CBVA 4DGQA 2C42A 4EHKA 4ENTA 1I01A 1NT2A 4UZSA 3HHEA 1JAZA 2JZNA 3GI1A 5BV1A 5IVPA 2UYOA 1F2UB 4X6UA 3FHOA 2LPMA 1IY1A 3DVAA 2II6A 2PTGA 4H7KA 5KTTA 2C5AA 3IR7A 1PSDA 5TC4A 2W4IA 4LXUA 3AZQA 2C2MA 1ZHHA 3L1JA 4RLQA 1XRMA 2IZ5A 2JEYA 1V6AA 1A4RA 2FR8C 2WJAA 2Y1FA 4JELA 1DJLA 4XUCA 2PPVA 1U4NA 3R7LA 1PR2A 4PYRA 1BKDR 5HQJA 1I2CA 4U2DA 3ZIAD 3MWKA 2IYXA 3ANNA 1Y4ZA 2XDPA 4C04A 4FSXA 4GKAA 4F85A 5J47A 3LUAA 2PWZA 1OC4A 2CBZA 2CVOA 4B32A 3I6IA 2C03A 4EI7A 3HBFA 3IMGA 4KMOA 5DF1A 5FR1A 1U8AA 1HA3A 4S0XA 3SZRA 3UTCA 4YCMA 4AU1A 4JWTA 4NZOA 4FX5A 1NX6A 3CH7A 1P3Y1 3AUSA 3EXHA 1IZ9A 2WB4A 4CTNA 1N2OA 1HNXB 2EKBA 2FMHA 4L74A 2AMFA 1QGYA 3ET5A 4TRNA 4H3KB 3V6MA 1CQIB 2BVNA 4WEQA 2PSEA 3V34A 2PUHA 3WLNA 5IANA 3VTZA 1JWBB 4O6VA 4BVBA 1D1QA 2GF2A 4FFVA 4EHIA 3THSA 3TTVA 3A3OA 1ZS9A 2XCUA 2BFNA 2IGTA 1KMHB 4I9NA 1QPZA 2CLOB 1Q1EA 2BEUA 1UXIA 1Z83A 2QENA 3GRPA 1O95C 3L7DA 3JVVA 4IY1A 4XQGA 1GPKA 3U7FB 1TM7E 5EQFA 2NUTA 1D9XA 3PCXA 1IAVA 4HDQB 3QU5A 1FRVA 1K6JA 1R3DA 2OE2A 3PE6A 3ZDRA 4XIYA 2WV9A 4O02B 4URVR 1TJNA 4DCGA 3VNSA 1UQUA 3VJKA 4RCYA 3RNOA 5I9LA 3AVWA 2AFHB 1A27A 1SCUB 4KREA 3PEWA 4RVFA 2XAAA 3TFWA 1TGYA 3DNFA 3F98A 3TVTA 4NI5A 4QO7A 1Z82A 2A1UA 2I03A 2DUUA 2J7PA 4QASA 4RD4A 1KEVA 4MARA 4FUQA 4ALMA 4ZJZA 1XLVA 3H3JA 1E6EA 4HQ0A 3PNQA 1KI1A 1TPYA 2JFYA 2NT3A 4HKTA 2C3PA 4CR8A 3SJBA 1C3LA 4DFDA 2NPOA 5DRYA 2JG3A 3R40A 2ZRJA 3U0VA 2F3SA 3EK2A 1EHYA 1EK0A 1JEOA 3WBJA 1MGOA 2JEOA 1J97A 3MRTA 4N5LA 1LBQA 1TKAA 2ONYA 4PRZA 4IIYA 4R01A 1BU8A 3WADA 4E03A 1PZMA 1L5MA 4BQRA 5A9SB 1FFXA 2PY6A 5CT4A 1VLMA 1IZZA 2J46A 2O19A 1CZKA 3AUYA 1DDGA 3PFGA 3ZNQA 3WHIA 3C4VA 1W52X 5K0LA 3BQMB 1AUPA 2X6RA 3IQWA 2Z0MA 1IMJA 1R6BX 1RYNA 3LRXA 4JSRA 1I3LA 1NJGA 4RJIA 1Z0UA 4L1KA 3LZCA 4ZC1A 1ZPDA 1ILEA 3OZVA 3I9V6 2OGWA 4W1QA 3OF3A 1RXEA 2GOYA 4KXUA 3IKVA 1TAUA 3I2GA 4X63A 2GHRA 3S0JA 2D2XA 4FYYA 1QRUA 1UBNA 1PCXA 3M81A 5CVEA 1B0AA 2POQX 5ELLA 3RU2A 2WWVD 1EWKA 3AKDA 1NQOA 4HYEA 2RB5A 3EASA 4B0PA 4C2TA 3PNPA 2IH5A 3OHPA 4QE3A 4DA7A 4PVCA 2I4NA 3W79A 4BN0A 3UWMA 1MRSA 3EEOA 3HJNA 2V7WA 5T4BA 3BMOB 3ZKWA 421PA 4YONB 2VXYA 3SC3A 3L07A 1KAMA 4ZO8A 4ODIA 2V6GA 4YV0A 1W2GA 4LOIA 1RKUA 3MLBA 4V0MA 1DEAA 1E79A 1DG9A 1T3LA 1KVSA 3NO4A 5CX4A 3UENA 1ZSNA 1LWOA 4BEJA 5G0UA 1UJ6A 2FPRA 3DW3X 4D82A 4INAA 2O2JA 4WASA 2IYVA 5JSUA 1SQ6A 5DCYA 2BDEA 2Z98A 3UG6A 1H4SA 4L4ZA 3VKHA 3T5MA 1XCGB 3HV2A 3LQFA 4BWYA 3HCRA 4Q9AA 5L8VA 4I4CA 2AD5A 1RM3A 4RQUA 1JLMA 2OCXA 3QKSA 4JI0B 2Q3MA 3KAPA 3WV4A 4BAGA 3T3PB 4ESVA 1JB1A 4HATA 4LWPA 4R54A 1V5FA 2OC4A 4RPHA 1SOAA 1DX9A 3M6FA 2VQEB 1PJ4A 3HFJA 3WGIA 3VZBA 3ANMA 1SELA 3C39A 2ZIXA 3G2QA 3NR2A 5KX5B 2D7DA 1QU3A 5FTJA 2QTWB 5EHGA 2ZJ4A 1WLFA 4I6EA 4C7VA 2RHBA 1BWRA 1U0BB 1XTJA 3KQVA 1IXKA 2YXNA 1I9GA 1VJGA 2O4UX 2YXBA 3TW0A 1GYRA 5KVVA 2H5LA 4HAOA 4TN1A 1X8LA 4R1LA 1MRNA 5FWAA 4TT8A 2R44A 3DOCA 3N6XA 1OHHA 4UEJA 4FWBA 4JV5B 1R4ZA 3QTTA 3LUGA 3H2GA 3OF5A 3CGGA 3TYXA 4G1CA 5BY2A 2Q07A 2Q9BA 3C8UA 3QNMA 4L6AA 4BMCA 3A7EA 3CUUA 3MWDB 1JA0A 4LRQA 1X3LA 2L17A 1U1IA 2ZVJA 3V8VA 2FF5A 4CYMA 3OFJA 4RMJA 2UZ0A 4K88A 1VL5A 3UCEA 1EI9A 3P9YA 5DHAA 1OR8A 1NW9B 2Z2ZA 3FWPA 2VQ3A 3GFPA 4II7A 1JG3A 1GSHA 2WUEA 3EY9A 5HRAA 1Z28A 3DE2X 4GMXA 1G7SA 2ADFA 2JGKA 3TTXA 3DHEA 1X7WB 2H16A 4JR1A 4OPMA 4YJHB 3EUWA 5ELXA 3FCSB 4YGYA 5FPKA 1DWOA 2R8BA 1HQDA 4LXQA 3DQPA 2YCBA 1HF3A 1JZSA 2EL9A 3IHKA 5L3QB 4U9UA 1GKLA 3MTDA 4EJ2A 5FEUA 4S05A 1GU1A 5JD6A 2G9QA 2ZIEA 3TFQA 2Q3CA 3LX6A 1ABEA 2GK7A 4UPEA 1KQPA 2YV2A 2GCOB 3T06B 3ZE2B 3FVVA 4BLSA 1D7OA 4MX8A 1HE2A 5EKSA 3UB4A 4F0JA 3INYA 3C16C 4JJ8A 3AONB 3SZMA 3FIJA 3ROZA 2GVDC 3NX4A 3ER6A 4GW3A 4CFYA 5SZIA 3DHWC 3T6KA 3VI3B 5CGZA 2FZCA 1HYQA 2A9VA 2R7NA 3BD8A 1NJSA 2ZW9A 2EIXA 2EV9A 2QIOA 1KI6A 4B3DA 5D51S 2PD6A 4MICA 3UJAA 4D6PA 2D1YA 4CQJA 2BM0A 1DRWA 3DL2A 2B0CA 4J49A 1U2TA 2VJCA 3I8SA 3IAUA 4YP6A 3DV2A 2YZNA 3IAHA 1NUUA 1ORDA 3GAMA 1DKQA 5C31A 5A62A 1KSHA 5DTJA 4BO3A 4XWTA 3C6ZA 3UHOA 3ED1A 2ZYIA 4EGJA 3RAFC 1WLYA 3GY0A 1NMYA 5IJ9A 2Q8QA 1H5NA 3R3UA 4D0NA 1F1JA 1C3VA 4WESA 3OQNA 1Y3AA 1H94A 5DTIA 3DL4A 4OP1A 5IARA 1Q0SA 1J00A 1EWQA 1UMDA 1KFCB 4RMHA 4QUIA 2IU0A 1T8SA 4GPD1 3S4YA 2Q0SA 2Q27A 1OZAA 1G41A 2OY0A 3IBGA 5F21A 5LQSA 1D0IA 3A25A 1JR3E 1U7ZA 3HS3A 4PAQA 3CLTD 1IUOA 1RIIA 3N8IA 2KY9A 1NWHA 2ODTX 4M1KA 3SFZA 1Z0SA 4V0KA 1VCHA 5AVVA 1JDBB 4HH4A 5A4IS 1JQ5A 1X7YB 3JZFA 3FSRA 2ZU6A 2I2XB 1ZN2A 3Q2IA 4JBNA 1GUYA 1WD7A 2YWFA 4YAGA 2QR2A 3IE0A 3TN7A 1X80B 3VR0A 3ZTYA 4FCWA 1E8MA 3P1JA 1FTQA 1P1HA 1JDPA 4HI0E 2ZYVX 3MK31 1EVZA 4GC9A 1UQTA 4QUAA 4R2MA 1TL7C 2SKEA 4A8TA 2CJWB 2QUHA 3MSCA 1EQUA 3WGYA 3QQ7A 1J2EA 1THMA 5EHQA 1H8HA 1RR6A 1NQWA 1K8QA 1X7ZA 3HZOA 1SK9A 2XAUA 1XQ9A 5EMNA 1YZKA 2C94A 1ZGGA 4Z4FA 4G37A 3FB4A 2B30A 2R6HA 4RHXA 3UICA 1PVOA 1E64A 4TUYA 4AZ0B 1K68A 5TVKA 1XL1A 1E4VA 1BXGB 5KTOA 2K5UA 1XJ5A 3ZWDA 2HQ1A 4LHZA 3OPYB 2XDQA 5FULA 2X7XA 4ML3A 2J31A 1UBJS 2FWNA 3O4RA 5TS3A 2LDXA 1SKAA 1XTVA 2QLBA 4KE7A 2FMTA 4QUGA 2YWHA 3C3WA 1UC9A 3K32A 2ZUTA 4DCUA 2VZEA 3ABOB 3B9QA 3TLBA 1AVTA 4M9XA 2QRQA 4N54A 4DILA 3O82A 4FTWA 3T7KA 2DAPA 4HMPA 3B9RA 2GFIA 2G28A 1NJFA 4H1TA 4TMVA 5KQRA 4JUDX 1C3XA 5ALYA 2C92A 4PQEA 2QZ4A 3I58A 4DYHA 4L8FA 5J1TB 4WKPA 1M6WA 4TYNA 4KFSA 3PR3A 4N7JA 3GLGE 2B4YA 3K09C 10MHA 1PFUA 5BYKA 4EG4A 1UKBA 1I7PA 1QG6A 1G8YA 2GRUA 3F6CA 5DHQA 1CUIA 4JLKA 1KR2A 3GAFA 1Y3FE 2NZWA 2NM0A 3JZIA 4X92A 4JI5B 1ZSVA 3RBVA 3NRJA 1M2JA 3HJHA 4DYVA 3DFIA 3GEEA 5LZ8A 2EFDB 1EM8B 4AY3A 1M33A 1Z2OX 2RC6A 4D57A 2HK7A 4F6LA 3TGWA 3WRXA 3ZXSA 2F62A 5J2UA 4YCDA 2H1OA 2XT0A 4R2WA 4HTAA 1U0NA 5C8DA 3DZHA 2JFZA 1XDGA 3FCYA 1C1XA 1O0SA 1PKEA 5ISMA 2H4YA 3H87A 5TLSA 4XEHA 1X1TA 1XAIA 2C3UA 2HI0A 3I3OA 3G79A 1EFCA 5TMEA 1NMXA 1Y63A 4NBLA 4XGIA 3COPA 5AHRA 4EHDA 3JD4A 3KLNA 4UEOA 2Z4TA 4YP5A 4PO9A 3X2SA 1UADA 2HJ9A 4QPPA 1NNLA 3K6JA 3ZXUB 2ILTA 4AURA 2A3NA 4LRUA 4M0DA 4RHTA 2RDMA 3LQQA 2DB3A 2ACWA 4NYMR 2VYNA 2C96A 2ZSHA 3GLGA 5KTNA 2Q1UA 3RVBA 4QSHA 1SVUA 4BYGA 4RPGA 3LC2O 1ZCZA 2Q5HA 1ZOPA 1Y1TA 2AV6A 1QYIA 3L05A 4H4DA 1CZOA 2YJZA 3DKIA 4R84A 5DBIA 5ERYA 3ZN2A 3K3PA 4EFNA 2R6ZA 4N6OA 1V1MB 3GIWA 1NVWQ 3R5FA 3KYCB 3EOAI 2NYVA 2H3HA 3NAGA 1PL8A 4L57A 3RGGA 4DDMA 2BZGA 2JDID 2AWOA 2JVJA 1B00A 1DJQA 1ZIPA 4Q1AA 5DB4A 1XA4A 2ZVDA 1XO1A 3RIXA 4AG3A 4EO4A 4KLRA 4EHFA 2YWRA 4DCTA 1UPXA 3E8XA 4IZOA 5AKZA 1Q7BA 2F1JA 3O75A 3G0CA 3S3TA 4DBVO 3GH3A 1C8BA 4IJ6A 1ZX1A 1HYHA 1G6KA 1WMDA 2AQIA 2Q3LA 3PQFA 4J90A 3RWBA 2PXHA 4ARBA 3JX9A 1QHNA 2XD4A 4YQFA 5FB3A 4HAWA 4HXYA 3AKCA 2B94A 3HP4A 1A9YA 4CM8A 1XTTA 3QUBA 1DJOA 3WLSA 2X13A 3PQ3A 3ROGA 4XJVA 3TS1A 3JQ8B 4MKIA 1J2YA 1E8NA 2FY8A 3KB1A 4PW0A 5H81A 3WL5A 2VR1A 2BF4A 1WZNA 4GOOD 4WSOA 3GJ0A 1H2RS 1KDZA 1V8OA 2OG2A 3LYHA 3DEJA 1SBTA 2G25A 3IUNA 4OQDA 4C9BA 5E8RA 3GPLA 1MOQA 1I2BA 1Y8QA 4QICA 5DBHX 4MW6A 1K6XA 2AOUA 4TVKA 1EFRD 3ZS8A 1FYFA 2LIPA 2NXJA 4TMKA 5LYYA 3HM9A 4U2CA 3EGEA 3A6JA 2GERA 3IP9A 1OT3A 1P9LA 2C04A 1RI5A 2WSMA 2B3TA 1PQ4A 2DC1A 2JFPA 3HR4A 1V2GA 2QAGC 2DFKB 2H6EA 4XD2A 3MLEA 3NIDB 1HE5A 3KNZA 3FVWA 3EZYA 3DLTA 2GF0A 1R74A 4JJEA 5FA6A 5A7HA 4JI8B 1Z4PX 2CKDA 3TRJA 1Y6ZA 4BFCA 4CETA 4IH4A 3EH1A 4RKQA 3EZ7A 5E1OA 4P5DA 4BKQA 2FUG1 4YRDA 1UOEA 2NW6A 3OPMA 3Q3GE 4FX2A 4OQXA 2I7TA 1QSGA 2P6OA 3DPUA 5IX8A 1EXVA 3OX1A 5DFAA 4BFTA 3OTGA 1AKTA 2G0TA 3OKPA 4MKGA 3PX3A 5DJ5A 4C5CA 1P4RA 1RQ2A 1E2QA 2WVHA 3K96A 5FJJA 3WQHA 5CBPB 3I8OA 1AV7A 3ZE8A 2ZAMA 4KYIB 3JAWA 4YROA 4IGAA 4DABA 3ONFA 2CY0A 4NG5A 4G0PA 3I5YA 4D92A 1YS4A 3QQ8A 2F1OA 3K8ZA 2V7PA 4AY4A 4EJ6A 3DBRB 1AZSC 2O8CA 2CMKA 1G291 2V0NA 3Q6NA 2C84A 5MHTA 1QTQA 1W48A 2CNKA 1M76A 4LYGA 4URYR 3CCCA 4DBLE 3AVUA 3AG6A 3I34X 3X3HA 2CFSA 5JTUA 3LNCA 3G2PA 3IV7A 4B3CA 1VB3A 5ES4B 2H1VA 2X15A 2RI6A 4YRKA 4B43A 2QNBA 2BJVA 2Q50A 3LHSA 4C4RA 4LJLA 5AKXA 2AF3C 2GN0A 3RJMA 2JAUA 1GGEA 1W85B 1N5IA 1E9FA 2WJGA 2XT6A 3DDNA 1YVDA 4RK6A 4MUKA 4EAAA 2ZRQA 1KU0A 2XYPA 4Z4CA 4AS2A 4UOEA 1FFYA 2Q9UA 2P3QA 3BCRA 3AYXB 1WD5A 3KX2A 4FMDF 1N0HA 3O95A 4GPAA 1Q15A 3AEQA 3OX2A 4U8GA 3NTLA 3ZLUA 4FB5A 3R9KA 4WBNB 2LUOA 1QGOA 2ZQZA 3DT9A 3R3WA 2OR3A 3M83A 3CKLA 1CTQA 3KYBA 4G81A 4EKEA 3IP1A 3H8WA 4DBLC 4LKOA 3NDBB 2JIDA 5FI0B 4N9WA 3P9SA 4L5IA 2W6QA 4ZXPA 4O4LB 3QITA 2VP3A 3FWYA 4XX0B 1ECPA 4GM1A 4RFVA 1TM2A 2CDAA 5DLYA 2ATVA 4KWEA 1V3VA 2OEPA 2YHAA 2HSJA 3AEYA 1U0GA 1XP8A 3ZCSA 3KZVA 1G98A 5CNKA 1UJ2A 4G36A 4LIPD 1R0YA 3MUFA 1DX4A 1W44A 2NO4A 1DT3A 2E1RA 3WDKA 3ZWMA 4L4XA 4RSRA 3Q1LA 1I2ZA 1FVHA 4DADA 4F1JA 6Q21A 1UXOA 4V02A 1H6DA 1K63A 4RFSB 4G8JA 4JBGA 4F4JA 3LUCA 3VO8A 3PITA 1PS9A 2GAIA 1QYRA 2BH9A 1D2HA 2W2KA 1KNXA 4PM4A 5AXDA 1WEHA 1W0JD 4P33A 3L0CA 2KSQA 4PONA 1M83A 1SCJA 1U63A 2OHVA 1A5BB 3BH0A 5K8IA 2HGSA 4N0PA 3U5ZB 2P6UA 3N87A 4DLYA 2HJSA 4KRFA 1KY4A 3R0IA 2CXTA 1EJ6A 5C18A 4KXYA 4ZJPA 5AVJA 1D9ZA 3D64A 3IAS6 3FDFA 4KC0A 4LYJA 2H5JA 1ST3A 3D2AA 4LYHA 1YXMA 5HJ2A 4MGEA 3D8NA 3DOHA 4R7GA 3OBIA 1W8IA 3CRZA 3QHQA 4D8XA 3N7TA 1OVMA 2Z6QA 1X94A 2XWBF 3BAZA 1A8IA 2G17A 3BDIA 3S29A 5JNVA 1OQAA 3A1VA 3FMPB 3GHHA 5A4JA 1C1HA 2NSYA 1K7CA 4BU1A 2QAIA 5AJVB 5K0JA 1NUSA 4C76A 3B6EA 1WXGA 1JVNA 4MUXA 2HDWA 5EZYA 5EQDA 3RYFB 5EGSA 1U0LA 5B6CA 3B51X 4UTXA 3UFXA 3W8DA 3R6WA 4D0LB 1DADA 3G8DA 1BYUA 1CUDA 1Z5VA 3NNNA 3NEAA 5BVGA 1GM5A 3DFFA 2ZTSA 2VRNA 2HK6A 4GL4A 4HLQB 4KQIA 4H18A 3VMFA 3I76A 4KIFA 4DHEA 4RQAA 2GK4A 2G06A 2BEVB 2O3RA 2NU8B 4US2R 3UN1A 1B0UA 1UJ5A 5JVDB 2VAPA 4XAQA 3YASA 2RAFA 1G19A 4ZVNA 4BRUA 4ZGBA 1L1QA 3MERA 2I2BA 4GI1A 4UREA 2IV2X 3UT5A 1L5SA 1P0CA 3CSSA 5FA8A 1P1CA 5LPNA 4EHLA 5EHIA 3H5AA 4PSAA 2WT8A 1B4DA 1QHSA 3W5UA 5B3LA 2VTBA 3MTBA 2J8ZA 1J22A 2V65A 2X3UA 3BB4A 2DQ4A 3E7FA 1I7LA 4H6XA 4YFVA 5TVGA 1L1RA 2H7XA 1IEWA 1JMYA 1ORRA 1RTKA 2FFBA 2Z43A 5K45A 1C1DA 4Z3KA 4PV7A 2VG8A 3Q0IA 4PCLA 1IOVA 1GKUB 1CVIA 3H18A 1QYCA 2GZSA 3RIHA 9ATCA 5PNTA 1X1EA 3F71A 3MJTA 2M98A 3PNMA 1WEKA 2TRSB 2X8BA 1N5OX 2EEZA 5LP6C 3BJIC 3ZLTA 4ZK2A 1KBQA 2QWXA 2QTGA 2Q8NA 2RHTA 3HDGA 4BBZA 2H8GA 3GGOA 1QKIA 3NJRA 4Q9IA 2OYRA 1YHZA 2VHYA 5JO9A 4C6TA 1DJPA 2B99A 1PVDA 1Y80A 3G59A 1I1QB 2AR0A 2CNLA 1ECLA 5BO5A 3WYCA 2BMDA 2RKBA 3LY9A 4G5XA 3KKLA 3KTDA 5HKLA 3CLSD 2VL7A 2NG1A 3OP4A 4Y1FA 5HJ7A 4ETWA 2O8FB 3H11B 5CFLA 4H1VA 3HO6A 3AR5A 3ZDYB 1CY0A 3ZQJA 4CT4B 3JRWA 3ZGNA 2I2FA 2IY9A 1PLJA 1K4MA 1OXSC 1Q0HA 2OECA 1ND5A 2P90A 4UC0A 5G0SA 1G9XA 2GNOA 1JIXA 3CMMA 1GNPA 1N9ZA 1T26A 3VDRA 1DBRA 3NH9A 1H4QA 2EFCB 1MPTA 1K88A 4JP2A 1EH5A 1AGYA 1A8SA 2C7GA 3JRXA 4RH3A 2HU7A 5I7EA 2YV3A 4QQ8A 2GPTA 2FKAA 4XUDA 1Z2NX 5CCDA 1XU7A 4ERXA 3WLEA 2BLLA 1P75A 1GD1O 2Y8EA 4PPQA 1HNWB 3WL7A 1VSTA 2DULA 3ECCA 1MJNA 4OQYA 1Z74A 1W1UA 1IRIA 3G2LA 1IQUA 2VNSA 2VTKA 4COOA 1XZKA 4J6FA 1FFEA 4ADSG 4BC0A 3AG5A 5GOTA 5G0TA 2C8VA 2BKUA 4KK3A 3M33A 4RA9A 1YZHA 2GEFA 4J4HA 2Q29A 2GXSA 3VR4D 1YS2X 3QFFA 4LECA 2OHFA 4JIGA 5CA1B 2NUPA 3AWDA 4GD3Q 4CKXA 1T8RA 3IUJA 2AX3A 1L7AA 3R0ZA 1YNOA 2REQA 5J63A 4MV6A 2ODAA 3BXHA 1QRSA 4JSYA 2COKA 4D5GA 2PSSA 1FDIA 1LGYA 1ZA2A 2JJ1D 3DKVA 3JAKA 4EEXA 5LDHA 3ASVA 3R8FA 3LTEA 2PGIA 4HBGA 2Z56A 2F9LA 2FG7C 5E4YA 1YZ3A 2G9RA 3UQYS 4TUYF 3RWOA 4CE6A 1T0HB 1XZQA 1KO7A 2QE7A 3AZPA 3FX2A 3DJYA 3MLAA 4MUAA 4QYXA 4MJXA 4DDKA 2I9KA 3K7EA 2W8BA 1X1DA 3T3HA 4BNZA 4LF9B 4M54A 1BMDA 1T0JB 2O4CA 3QWIA 3O21A 1PL0A 4EH1A 1UPCA 3L4BA 1T36A 2AB0A 1KETA 4PLGA 4W1SA 4TWJA 3J81k 3PBKA 1VIAA 1EA5A 3GJ4A 4XPZA 3MWEA 1C29B 4MVJE 4GOND 1BHSA 2AEFA 2Z8YA 4ZT7A 3RFCA 1JS1X 3C87A 2A5DA 4IVPA 2O48X 2GHQA 1B15A 4QJ4A 1TCBA 1GT91 4BX8A 2IS4A 5HIKA 4LQ4A 4FFDA 2JBHA 4D9CA 4A6EA 4B4WA 1JBKA 3GQBB 4R6XA 4E30A 3OVMA 1H9AA 2OO3A 1GCAA 1JRLA 1ORWA 1EVJA 1RAGA 2QVCA 2YS6A 4EDFA 1TM1E 2F4VB 1G3IA 3R7NA 4PTLA 5JUWA 4X0EA 4BCCA 1CDOA 5CX1A 3F5QA 5T67A 2X9QA 3W4KA 3AJ8A 1UBOS 2R62A 1MC4A 3NTUA 2G5CA 1NZJA 1Z08A 1TQ6A 1YRQA 3QHAA 4KQ6A 3UT6A 4AJNA 1V43A 2I6GA 1IQPA 4A6PA 2Z83A 2E0IA 4MS1A 1HURA 1O1YA 1KPHA 1QFZA 3OLYA 1PV2A 1Z5UA 5J2UF 3E7PA 2VDWA 3QUQA 4NF2A 5AT1A 3TSWA 2JANA 1C7RA 1VG8A 5J4YA 5H9VA 3M6XA 1N9GA 1O5OA 3AL2A 3KJFA 4KRYA 4TRMA 2ZIVB 5FXMA 3ZE0B 1AE1A 1YJXA 2NACA 4MVJA 2JI6A 3ZXYA 3PFCA 3UMSA 1Y8CA 1WB5A 4H31A 2FP4A 2ZFUA 3R7AA 3OQOA 1DAEA 1NYQA 3IVXA 3GOQA 4TKLA 3R3VA 5JBQA 1UZMA 2GD2A 5KPDA 4M86A 1WBJB 1XDWA 3CLUD 5KU1A 2NO6A 3L8GA 1VA4A 3VAZA 3IEXA 4FCVA 4ER5A 3LC7O 1PWYE 2B5WA 3QSGA 1CQPA 1ZGBA 3WP0A 1TZMA 3ORSA 3TZQA 4J03A 4N7MA 4C0SA 1PUJA 1E3IA 1R6DA 4JP3A 3ISTA 2DWQA 1D2RA 2IUEA 4H16A 4EENA 4IO0A 4BN4A 2VRWA 3VR2D 4YYEA 4CMEC 1XHLA 2EJUA 1DKLA 3V5NA 3CA8A 3BGSA 1RYFA 1KZ7B 1YJ8A 4V39A 1ELOA 2MT9A 4ZCTA 5ALOA 5DXAA 5J4LA 5BN4A 1J24A 3B6JA 1FX0B 1DEKA 5JAMA 1BFDA 3O2NA 2O8DB 4LAFA 4KSCA 2EZUA 3W3AH 3NI2A 1ESNA 1NE2A 2JFVA 3IAS1 4FHZA 2I7VA 4RACA 2Q5CA 1T9KA 2JGAA 3OJCA 1C3OA 3DOUA 3UKOA 3N8NA 3QI7A 2D1QA 3SIWA 1QIDA 4KAFA 2GNAA 2CL0X 2VDLB 1JR2A 1V45E 1NNI1 3EGDB 1P0QA 3X2FA 2IXEA 1ZUNA 1I1NA 2A88A 2ZSAA 4JCCA 1C4OA 3VAYA 1M0SA 3VRHA 1BCSB 5LQJA 2AOTA 1XP5A 2O6LA 3L6UA 13PKA 1NRIA 3TB6A 3UVEA 3RW9A 1E1LA 3IE2A 4PSKA 3TLGB 4EVIA 1G8MA 1K89A 1KK3A 1X6VA 2I4RA 2NZVG 3AV0B 3NOOA 4DF3A 3KSBC 4K6GA 2J9FA 1U8XX 5LFAA 5I7FA 2CJYA 1QQ6A 1ZGZA 5K0EA 5B64A 1PGOA 1R10A 5EQTA 3HABA 1F5NA 1W73A 5F5LA 4GRAA 5JS2A 3CURA 1E9DA 2P9TA 4KITB 2W58A 1VE7A 3REOA 5CLFA 3QYPA 1CRLA 3HEAA 3Q3EA 3NKVA 1RXCA 2CZCA 3G2MA 4BCDA 3QPUA 4YCSA 3JTEA 5IASA 5FD8A 5JFGA 4K0KB 5FORA 1IK4A 2ZT7A 1NW5A 5BUSA 5IRCD 1G4HA 3BSSA 2DQKA 2G8NA 4NQRA 4P80A 1LZLA 1QJ4A 3UA3A 1YIAA 2DFLA 3PQCA 4IQ4A 2WWRA 1E7WA 4I1IA 4ZCLA 5I8WA 1H05A 2UVQA 3HBNA 5DT2A 4R5HA 1NC3A 1PNVA 1C5KA 3U31A 1DG1G 3TK1A 3DZJA 2Z6VA 3JQDA 2ZYSA 3QU2A 4J75A 3N2LA 2CLMB 1XALA 4I2VA 2NU9B 3U9TA 1X86B 3IA2A 4L7VA 4CVNA 4OQ4A 3ZK7A 1YS6A 3OJEA 1XZBA 3C3AA 3MC1A 3PC2A 2CFIA 1Y7IA 1P1FA 3HN6A 4H4EA 4AWXA 1XK6A 2MU1A 4QQRA 2B37A 3JQ9A 3OMLA 3R0XA 4GXQA 3RDPA 1T5TA 3WFZA 4PZYA 5KQMA 1LLDA 1EZZA 4AIIA 4PSVA 4O2LA 4UTNA 1K2VN 1XA0A 5CYGA 4FGKA 5DHFA 3KO8A 4HQNA 3TTSA 3HHPA 4GOKA 5L6LB 2B69A 4A23A 1BFUA 2XGMA 2QYSA 4XGKA 4DC0A 4G9GA 1S01A 2WU1A 4IOKA 2JD2A 2J3EA 5B2ZA 4TQGA 3QX7A 4K3UA 2AMVA 3L43A 4BEWA 4IIJA 4PYJA 3TCXB 2P4SA 4OGLA 4L9AA 1E1MA 3PEUA 4LOAA 4RD3A 3WGKA 3PHGA 1Q1QA 2H52A 4OBXA 3VVCA 1PIWA 2ARKA 3RB8A 2H85A 2HGZA 4MZDA 1K3TA 2QM7A 4G5YA 4RDCA 1E1DA 5ALFA 1KPGA 2WD8A 1UT8A 1ZRMA 3I05A 3OFVA 4UCXA 4P3KA 3TQQA 1AK9A 2Z1MA 3EA0A 1HDRA 4LZJA 3PHBE 1M34E 1XTUA 5AXBA 2ZP1A 1GNVA 1DWPA 3U3MA 3NMUF 5FI3A 4B1FA 2N3ZA 2PKYX 1R88A 1HQKA 1LBHA 1X87A 3A6FA 1JZTA 3OCXA 3UB2A 1UXHA 2WABA 4FS8A 3TCKA 3P9QA 3WZLA 2BY4A 4NFSA 2GEUA 3I1YA 4X1YB 3F6RA 4KFRA 5BT9A 5TEWA 1W49A 2OOKA 1UJ4A 3GROA 5ALGA 1PJAA 3DQZA 4GYKA 2W71A 4UJ3A 4WKGA 1I24A 3ISVA 4JLWA 3KR0A 5IFLA 3N05A 4PQRA 2VP5A 2G88A 2YOGA 3QPBA 4WLUA 2QMEA 1G8HA 4AECA 2I5PO 1KEUA 2WKRA 3Q4GA 5CM2Z 3RODA 1WA5A 4CNQA 2VBFA 2O2IA 2EFJA 4R9RA 3OM8A 4G4GA 2ZSFA 1QE3A 1GPNA 1AKUA 4L9SA 4M9RA 1CIPA 5JJIA 4LK2A 5T5QA 3SX4A 3NAMA 3KWFA 1N7JA 4JJ4A 4JD5A 5KI6A 2R5FA 4B33A 4F6RB 3U62A 5EZ5A 1JIJA 4DMMA 1DV2A 5A6SA 4OI2A 2W0SA 2OLJA 5HM6A 2HUNA 1Y82A 1Z8DA 3O4GA 2GX6A 3TB4A 3AB7A 1PDOA 1G5FA 3R9IA 5E6UB 2FMUA 2G9VA 2ZPUA 4R81A 5A7FA 1UBLS 3A05A 1GRNA 2RGUA 3PHIA 3P2MA 2JGIA 4XYBA 5HA5A 4HVAA 4LJ6A 3PK0A 5I4CA 1EUDA 3I2IA 1FA9A 4QUEA 4E1VA 3NBKA 5T57A 1QQ5A 2HK9A 2O7RA 3QY9A 3ZV4A 2A94A 4TTVA 2WIAA 4BRSA 3PFHA 1UWKA 3AR2A 5AHWA 3SC6A 1DBWA 3T3OA 3KHKA 3N8DA 2J0QA 2XKKA 1AK2A 1KZGB 1TYZA 3QV1A 3DT6A 2F1RA 4KGZA 3G3EA 3UBMA 3IUQA 3NXSA 4Q47A 2AVDA 3EARA 1FTWA 3QPDA 3HYSA 4UHBA 4KR9A 2P41A 4IILA 2VP9A 4LK3A 1G59A 2WHXA 1L5HB 2VP2A 2QLMA 1G3UA 2G83A 4JSTA 4MP6A 4TPKA 5KOHA 3C43A 1EK5A 2VHXA 3W2IA 2I6TA 3BF7A 4BE7B 5B36A 4RDXA 1O94C 1YI0A 2G9UA 3IAXA 3L4SO 3O83A 3LUFA 1J25A 3SF0A 1XRNA 5FAKA 1JV2B 3GBSA 3P2IA 3E2PA 1L5ZA 4HVTA 1O89A 1XR3A 4RF2A 5E3JA 1OBOA 1GNRA 2VP6A 3IT1A 3EBOA 4I5DA 1N3YA 1XG5A 4YMHA 3D6VA 1KAOA 1WOMA 1F9AA 1W4ZA 4AM8A 3KC2A 4NJEB 3DAYA 2MM0A 3EBPA 3CZ4A 5E2AA 3RTCA 2X9VA 1FP7A 3IKLA 4TSFD 3K70C 1WX1A 1G21E 1E2DA 3FCUB 5K0ZA 4IUCS 2AZDA 3K8QA 2IQIA 4ENSA 2RARA 3R0QA 1TM4E 3D6TB 3PQEA 4EKIA 3KOOA 4AO6A 4LHVA 3UHFA 1CY2A 1NMZA 2EW8A 3RS5A 2NPFA 2JFXA 2QUJA 2I62A 5EAIA 3VO2A 1CQZA 4LJ7A 4F4UA 1L5NA 2DERA 5ICCA 2GSWA 1CF9A 3NHRA 2X58A 5B4VA 5AXCA 1UMCB 1T0IA 1I94B 1PR4A 3AVQA 4JQCA 4ZYTA 1J1UA 2O3SA 4RADA 1HR0B 2L42A 2QT9A 1J90A 4LW8A 4UBMA 1PW7A 2V8BA 3TAXA 4UM9B 2BIFA 4I50F 1BU5A 2BFBA 2EGUA 4LPSA 2DT8A 4BMNA 1R6VA 2HA4A 1IRXA 3TNFA 4WE3A 4JGBA 4QDZA 5EXSA 3I61A 1O2DA 4QGSA 5AICA 5EJ4A 1N1DA 2ETVA 3IJ5A 3R9XA 2DPMA 4QU9A 4HFRA 2L18A 4P3NA 2CJXA 2R8PA 3X1MA 5KKAA 1ID8A 1MXFA 1RMQA 1E0JA 3GFFA 2WNSA 4KVFA 1W36D 3FAZA 4ICIA 5I9NA 3K0CC 1G21A 2IITA 1P1RA 5DHRA 3OZTA 4Q6BA 4U7WA 1GZSA 2AJBA 2V4MA 3PPIA 1ARZA 1UBCA 4GVXA 4K26A 3UXMA 3ZZTA 1PNOA 1ECGA 1XZMA 2CL5A 3HCOA 4EGFA 1L7PA 3CISA 4IDDA 5A71A 2B4TO 4YRPA 2AXNA 3WGJA 1EFTA 5DXJA 1N5LA 5LBIA 3N39C 4NEQA 2Z58A 4UHJA 4GRDA 4LPKA 3MT7A 4TWBA 4XIGS 3VC3A 5ALJA 3RQIA 2VOEA 5BN3A 3A28A 2GDJA 5TMPA 1W5AA 3A1CA 1GVNB 5GVSA 4IDAA 1PJLA 2BAGA 4DNOA 2QRMA 3NB0A 4B79A 4DRXB 2PL1A 3H2KA 3IRUA 1GITA 3PPWA 2ID8A 3IB6A 4Y8VA 4H7EA 4BV3A 5I48A 4S04A 3TD2A 2XW6A 3GFGA 5AM0A 2GPJA 5EYPA 3UT0A 2JK1A 3QU7A 1FXUA 3V9AA 4U1RA 4AJJA 2J9ZB 1CXZA 1PNTA 2ECKA 3EMVA 1NXVA 1KYQA 1SIBE 1GQOA 1X1RA 4LBVA 1C0EA 3EJ6A 5HQTA 4E2XA 1T1EA 1MEOA 4BO0A 3VYTB 3PKJA 1MDFA 5LB2A 3PKZA 3CKKA 1S2DA 5LLSA 1J5EB 1P9OA 1JI3A 3ZU2A 2W43A 2QXTA 2ZYRA 1W6RA 2PRSA 4ESHA 2Q3BA 3CW2A 4RORA 5E6SB 5KTMA 1ZIOA 4MB2A 2SICE 2VWQA 2XB6A 3OLWA 1MBZA 4UHEA 4DTIA 2ZJ1A 4XW2A 1TRHA 3LI2A 4OJKA 2BELA 3LT2A 3BK2A 4GRIA 2MYTA 1LU9A 1YO6A 3LDFA 3SYRA 3GPCA 2RSLA 1KR5A 2YVAA 4X1IA 5ALVA 3VPXA 4LFCB 3L7AA 4ZEOA 3ZYCA 1AUQA 3NETA 3QVJA 3PTAA 5FLKA 3H1AA 2QJTA 2PAAA 2AEEA 2C4TA 2RJ3A 4Z9AA 1J21A 2GYUA 2HC9A 3FGOA 4J0JA 1XFDA 4JS0A 5BN5A 4WLFA 2QG9A 3WNDA 2IHYA 4HDOB 1OLUB 4HLNA 4A8JA 2TECE 3PTLA 4MVJF 3A6GA 4XD7D 2O2EA 2PKQP 3K1TA 1GG5A 2V9CA 5FBRB 2GJKA 4LCEA 2WFLA 4CF7A 2R6FA 3P8ZA 4PHGA 4TTAA 1N36B 4LF7B 1ONPA 2XMCA 3S7TA 4AULA 1QH1B 3DVAB 4MQ4A 4LBZA 2P5UA 4DCOA 3QWHA 3FLEA 1NMSA 1V1JA 2ZATA 3HQ4O 4GPTA 1T5DX 3DLPX 1RW4A 2OGSA 2VJPA 4M38A 4MPPA 1IPEA 4DNFA 4GECA 1TQHA 2E48A 2HYDA 2JAHA 3G2HA 1NX9A 1CZRA 1OW3B 2AI2A 4J0EA 4NE2A 4TKZA 2HREA 2GYVA 2OO5A 2WVJA 3H4VA 2Q9AA 2Y9PB 5IM4A 3RQSA 2QVXX 1L4GA 1JIUA 3O1JC 1Y98A 3RANA 1WPGA 5CDFE 5ITZA 1Q92A 3HWX1 4KL8S 4IS2A 1FXWA 1F38A 3TINA 1BG6A 2KLBA 1YR6A 3I53A 3N2ZB 5IC5A 5K6AC 4POAA 4KAAA 4FP9A 3ZNNA 2FDCA 2YIJA 5E6RA 2ISQA 3OG9A 4ESEA 4EGSA 2QROA 2YWDA 2OHJA 3OZ7A 1U0SY 4PNPA 3AHGA 1KTIA 1N3LA 2VJLA 3EXHB 4OOFA 4WDRA 1TQ2A 3S2YA 4C89A 3UMFA 1G5IA 4E21A 4CIVA 4D1YA 4R40A 1RQPA 2NVOA 4OREX 4I2NA 1QM5A 5TRTA 2R7AA 3NFYA 2IP4A 2QR5A 3OEED 1SVNA 4LV5B 1VRWA 5JZVA 2A1TS 1GRVA 4LWZA 2YFQA 4QNNA 2RKOA 4B74A 2Z6AA 4YEDA 4LMRA 4XOIA 3TRIA 1B0PA 5BPHA 4GM4A 2C2ZA 4Q34A 3QJYA 5KNCH 4Q18A 4F06A 1XZHA 4OIFA 2BEUB 1D2MA 3LCCA 4JITA 3UMBA 1IN4A 3E5RA 4LBYA 4Q37A 4WH0A 3TE7A 3V33A 4MVXA 5AMXA 2CMGA 2NUTB 1QH9A 3A04A 3QE3A 5CDFA 3W8RA 3WQQA 4RTPA 3ABRB 1NAHA 4CWAA 1CUXA 1ESMA 4Z0HO 3V4ZA 5CVTA 1T9GR 5LUAA 1JJ7A 1D0SA 1SEVA 3B1FA 1KA9H 3DTYA 5JQGF 3FNHA 4JYZA 2CUNA 1QAMA 4IHQA 3ZY5A 5I9TA 2A1UB 1Z25A 3T7JA 1XI2A 4QOGA 2IDKA 3UHAA 4OAPA 1WDKA 4HNVA 1BRTA 2FJUA 3DMDA 4XB2A 3T0FA 1XMOB 2WUFA 1JAYA 1PQWA 1DKOA 2MMCA 3MMPA 2IYFA 5IZCC 4P0TA 5EG5A 3FPSA 2NSLA 2X4GA 4DS3A 5AUQA 1QYWA 2CD7A 3R8XA 3IT0A 3PXEA 1CZHA 1FFXB 4NMMA 1W0KD 3Q7EA 4O1HA 5AW8A 1L5FA 2EX4A 1OXKB 2CKMA 3E61A 2AOWA 3EVAA 3SHOA 1WE2A 3ONNA 3ZV6A 3N0XA 1NI5A 1NVMB 4OXRA 4D9EA 2Z1NA 4EUEA 2B3DA 2F43A 1T9AA 3W8NA 5B1EA 3QXHA 1E6CA 1AKWA 1NMEA 2XB9A 4UEQA 3DWFA 2WY2D 4C4SA 5AJUA 4ENPA 3AINA 2W90A 3V4LA 4HNQA 5DNUA 1P7PA 3KJGA 8OHMA 1NXTA 4WBXC 3KZCA 5TQ2A 4D0RA 3ONVA 1MR3F 4JYAB 1DFGA 3AHDA 2R00C 3JV7A 3N0TA 4MJ3A 3FY4A 4L8GA 2YHSA 3U37A 4LQDA 2Q1XA 2JARA 2GJ4A 4BMPB 4KACA 1UPBA 1C9KA 3ROXA 2UUBB 3IAAA 4LHYA 2QF7A 2R8YA 3R3ZA 4M98A 5IC4A 2I76A 3CVYA 4IIJF 1FNSA 1Z45A 3S8MA 2PX8A 5FFFA 1V25A 2BEJA 1ESCA 1WR8A 3RSHA 4LDRA 4J7AA 5TY0A 3OIFA 3HADA 4PZUA 4X7BA 4JEIA 5HS6A 2FE4A 3PC8C 4B73A 5P21A 4E5UA 3Q3HA 1FRQA 3Q85A 1NFFA 3B78A 5KNBA 2Z95A 4BTLA 4ZI7A 3TQCA 3WFJA 1SVKA 2GWHA