5CD1A

Structure of an asymmetric tetramer of human trna m1a58 methyltransferase in a complex with sah and trna3lys
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
288
structure length
281
Chain Sequence
SFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 57
structure length 281
sequence length 288
chains with identical sequence D
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5cd1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5cd1A02
2VDWA 5EEGA 3IYLW 2PX2A 5DLYA 3V8VA 2IBSA 3LDUA 5FA8A 2E5WA 3E7PA 1QZZA 4AX8A 4C04A 5K05A 1WG8A 1AF7A 4Z2YA 5KS2A 4XUDA 5FHQA 3ELYA 4MTLA 5P8WA 1RJGA 2AZTA 1JG3A 1F38A 1X1BA 1RI3A 2ZIFA 4X63A 1O54A 3LSTA 2PBFA 4PONA 1NKVA 3AY0A 4A6EA 4QPNA 3EGVA 1M6YA 2O57A 5EG5A 3EPPA 4PYOA 7MHTA 3EMBA 2AOWA 3C3YA 1OR8A 3I64A 4PWYA 3P9CA 1U2ZA 1RJFA 3KR2A 1I9GA 2HV9A 3EGEA 3B3JA 2NXJA 3M6UA 3FYDA 3GGDA 1QANA 1T43A 3P71T 4PGGA 5CCXA 2Y1WA 1N7IA 3A7EA 3C6MA 3P2IA 1G38A 2F8LA 4PCLA 2PWPA 1G60A 1NT2A 3KQMA 4EKGA 4GEKA 1ZGJA 2H00A 2OKCA 3FUUA 4C08A 5DXJA 5IH3A 3G5TA 2IBTA 2C7QA 1SKMA 1D2CA 1HMYA 2PX8A 2P1DA 3ANXA 3A25A 3LGAA 3GU3A 3BWMA 4HG2A 5K0NA 2IFTA 1RI5A 1IXKA 3LPMA 4HTFB 3UFBA 3DH0A 1L3IA 4EMSA 3UJCA 8MHTA 4Y2HA 2G71A 2XYQA 2NXNA 3AWIA 3FZGA 4BY9E 4HRAA 4CTKA 1L3CA 2Z6UA 2EG5A 3DP7A 5E2AA 1XCLA 3ELDA 4PYIA 4FGZA 3KR9A 1FP2A 4LWPA 3SSOA 1UFKA 3B7PA 1N2XA 3OE4A 1L9KA 4E32A 3OU2A 4R6XA 2XBMA 4POOA 1N7JA 2P3LA 5JR3A 3CKKA 4GC5A 3WSTA 5KQSA 5K0BA 2B3TA 3AXSA 3QOWA 2ZIGA 4QVGA 3UJDA 3OE5A 4CXMA 1TPYA 3BWBA 2EJUA 2ZW9A 3KU1A 5EPEA 3A27A 3TM5A 2K4MA 3HVJA 5ERGB 3Q87B 3CVOA 5DXAA 4BLWA 2WA2A 1AQJA 3HA5A 2IH5A 3JWIA 1KR5A 5EC8A 3KPVA 4QTUB 3FUVA 2AOXA 5CD1A 2CWWA 3UBTA 3GXOA 4R8RA 4QDJA 1EG2A 4ER6A 1M6EX 1KPHA 3PFGA 1EQAA 1TW2A 2JG3A 2PV0A 2OY0A 3SMQA 5BP7A 3PB3A 4RVGA 1P1CA 1ZGAA 4BP1A 4DA4A 4PNEA 1ORHA 3KHKA 5MHTA 4R05A 5HFJA 4EVIA 4E70A 3LDFA 4YUYA 1JSZA 1IM8A 1YB2A 2I7CA 5F2OA 4C4AA 3NVMB 3LECA 4YUWA 3MERA 4AZVA 3VYWA 1L3BA 3PVCA 4C05A 3EVCA 3SX0A 3CC8A 4G56A 3EVAA 4FSDA 4RX1A 4L7VA 5GWXA 3VC1A 3UWPA 3RW9A 3HA7A 1ZKDA 2QYOA 4YMHA 2FK8A 1FJXA 3T7SA 4E2ZA 5LQJA 4LECA 3DXZA 1XXLA 4IV0A 2HNKA 5FADA 4E31A 1ZHFA 4GC9A 3S68A 3G88A 3GCZA 1R74A 1F3LA 3TMAA 5K01A 1XTPA 2WK1A 3HVHA 3NTVA 1UIRA 5ICFA 3SXJA 2HR1A 1PJZA 3FUWA 3K6RA 4QVKA 2BR3A 3KQWA 5U4XA 2YXLA 2R6ZA 2VS1A 2P40A 3GWZA 3U81A 5E1DA 5BW4A 4BLVA 3R0QA 2AN3A 2ZCJA 5DSTA 3FPHA 1G8AA 1P91A 2YXEA 3OU6A 5DM0A 2C7RA 4RVDA 5EZQA 3DTNA 4RTJA 4DMGA 1R8XA 1FP1D 3OZSA 5E8JA 5FCDA 4ER0A 5HIKA 2UZ4A 2YXDA 3EVZA 1EIZA 3AJDA 5GIPE 2WA1A 3KPUA 1VBFA 2OB1A 4KDCA 2YTZA 4GQBA 1XVAA 3LKDA 3BWCA 4M38A 4PINA 3BGDA 4U7PB 1G55A 4E2YA 3R9XB 4MQ4A 5EMKA 3NVKI 4PYLA 4GOOD 3LBFA 3LX6A 5GOZA 3SSMA 3EEOA 1R00A 3DMHA 5DX8A 4RTMA 3MCTA 5D1NA 2LD4A 3PX2A 3RODA 3G2PA 1KYWA 1XDSA 5FTWA 5EEHA 4PYMA 5EOVA 2FHPA 3H2BA 3HEMA 2G1PA 4FT2A 1KPGA 5HIJA 3E23A 5ICGA 2QRVA 3HP7A 3THSA 3G89A 3NW9A 3PFHA 2UYHA 5EQJB 2C7OA 2AN4A 2JH8A 5CVDA 3C0KA 1BOOA 4QQNA 4DQ0A 3G5LA 2PSSA 3KR1A 1RI4A 5GIOE 5FUBA 1NE2A 2FK7A 3UA3A 2PY6A 1NV8A 1JTFA 2XVMA 3DOUA 3O4FA 2IH4A 1MJFA 4YUVA 2ORED 1BHJA 4PIPA 1FPQA 5K0EA 5K0FA 2EX4A 2YVLA 4RTRA 3DXYA 5ICCA 4FP9A 2P3QA 5K03A 2OB2A 2VDVE 4XCXA 1O9HA 2OYRA 2JHPA 3LCUA 4M36A 2ZBRA 4Y30A 2FYTA 3UA4A 4AZSA 2AOTA 2PXAA 3T0IA 4RVHA 2BR5A 1JG2A 2OO3A 2FRXA 3GRRA 3MQ2A 4P7KA 5EIFA 4BP3A 5K8VA 2ONYA 1Q0SA 2EJTA 5E9QA 2GPYA 4B17A 1WXWA 2JHCA 3HCCA 4R6WA 4OA8A 3M6XA 1WS6A 1DUSA 5LQCA 1ORIA 1VPTA 3C6KA 4V0QA 4QPPA 3ID6C 3HTXA 4DCMA 3BT7A 4X60A 2ZWAA 3EGIA 2OBFA 4GBED 3NMUF 3M6VA 2IP2A 3K0BA 2QY6A 3LCCA 3HCEA 2GA9A 4FT4A 2PX4A 1KHHA 4E30A 2G72A 4EQZA 2CKDA 4C07A 3CGGA 3P9NA 4PGHA 1D2GA 5KQRA 2P7HA 3P97A 2PT6A 5T64A 3ERCA 2ADMA 2XYRA 1H1DA 3AXTA 1KXZA 2B78A 4QDKA 3VC2A 3TM4A 3DMGA 1ZG3A 1Y8CA 1NBHA 4GF5A 2XYVA 2CMHA 1R18A 1VL5A 2Q41A 4KIGA 2ZWVA 1VLMA 1I1NA 4RV9A 1X19A 5DX1A 5E1OA 5E9JA 4RTOA 1JQEA 4E2XA 3SSNA 1SQFA 2ZTHA 1RI2A 2V74B 3G8BA 4P7FA 3P2KA 3TQSA 4AZTA 4KIFA 2QRVB 1YZ3A 3EVFA 3REOA 5K0GA 5LQNA 3A26A 2QM3A 3JWHA 2KW5A 4DF3A 1HNNA 3LDGA 5KYGA 3DXXA 1MHTA 3PT9A 4CWAA 4GOMD 4PYNA 3EMDA 5D1HA 5LQAA 5M5BA 4FS8A 2H1RA 4CKBA 5GM1A 5HIMA 2GAFA 4RWZA 2CMGA 1X1CA 1NV9A 2ZIEA 3OZTA 4IV8A 2H11A 2ONZA 2I9KA 5FA5A 4RVFA 4QQKA 4YV1A 3MB5A 4X61A 2NYUA 1VE3A 3GRVA 3TLJA 4A6DA 5LQKA 1NW3A 3P9IA 1YFLA 5KVAA 2VZ9A 1G6Q1 2PXCA 2XVAA 5F2KA 5GINE 4BLUA 2OPBA 3G8AA 3OZRA 4PYKA 3SVZA 2AOTB 3M33A 4P58A 4C03A 4M37A 3SM3A 4CKCA 4CKEA 3HCBA 3GIWA 1TW3A 2DPMA 2PKWA 5CUQA 3KQPA 4EKIA 5DT2A 5FHRA 4PYQA 1VIDA 1X1DA 3BZBA 3TR6A 1Z3CA 3IV6A 5DTMA 2JJQA 1EAMA 3F4KA 5EMJA 2O05A 2DULA 2PWYA 5E1BA 3G7UA 3I5UA 5BW5A 3HNRA 3FTFA 2NP7A 3FYCA 2P7IA 5FQOA 3CBGA 3FUXA 3P8ZA 4LG1A 1R8YA 5DTRA 2IPXA 4PIMA 1XDZA 3PS9A 5CVVA 1XCJA 2ZBPA 3PX3A 4RYLA 4IWNA 3B89A 4RTQA 1VQ1A 2ZVJA 1RJEA 1XJ5A 2AOUA 2N47A 2P35A 2UYQA 3BGVA 3P9KA 1EJ6A 3UJ9A 2I6GA 5LSAA 2BR4A 1X1AA 4ATNA 4KDRA 2ZBQA 3MCZA 4JXJA 5T67A 2Z6QA 3LCVB 2JHAA 2Y1XA 1BC5A 2AR0A 4OQDA 1QAQA 4ISCA 2YUIA 4MIKA 3TOSA 2B2CA 5EGSA 5DRTA 1VP3A 2P41A 5EVJA 5G02A 2VP3A 3R3HA 3DULA 5BXYA 2C7PA 2BM9A 3Q7EA 1RJDA 2YX1A 3HVKA 1QYRA 3G2MA 3UJ7A 5CM2Z 5EIWA 4R8SA 4FSXA 4DZRA 1DCTA 4DM3A 1R6AA 4HH4A 5FWDA 1INLA 3KPWA 3G2OA 5DX0A 3OCJA 1BKYA 3KQSA 3M6WA 5CCBA 4YV0A 4RTNA 5DM1A 2NP6A 1JQDA 2OXTA 4XUCA 5E9WA 3B3GA 1NW7A 4E33A 5EKXA 3QOXA 5HEKA 3ER9A 5LQUA 4QTTB 4UOEA 4EK9A 2P8JA 4RTPA 4X1OA 2ZULA 4OBXA 3DUWA 1KYZA 2BZGA 2B9EA 3UZUA 2PX5A 5E8RA 3OFJA 2IDKA 2AS0A 1WY7A 4DKJA 4XUEA 3KPYA 3ME5A 4M7RA 3MTEA 3CJQA 3CJTA 3V97A 4OX9Y 4GOND 4IKPA 1UWVA 5F2NA 2UYCA 2IDJA 2GH1A 2GLUA 3M70A 4OQEA 3GRUA 2ZZKA 3SR4A 3PTAA 2Z6AA 5CVUA 3EVBA 3MGGA 1G8SA 3HCFA 1Q0TA 3HM2A 4GOLD 3NWEA 1AQIA 4HGYA 4F85A 3FPFA 3B5IA 1NW6A 3VSEA 5HOQA 3JWJA 3LL7A 5DPMA 2NXEA 5GP1A 5CVJA 3EVGA 3NDIA 3QV2A 2G8NA 3G2QA 1KP9A 3UJBA 5LR6A 1P1BA 9MHTA 1B42A 2AOUB 4GUAA 1JTEA 3FTDA 3T7RA 3TPZA 3MAGA 1V39A 4RTLA 1YFJA 1JR4A 4RSRA 2AVNA 4MWZA 5DSXA 2B25A 1XDUA 5CVEA 5DWQA 1QAMA 5K0CA 3TFWA 1QAOA 1WZNA 3BKXA 3E05A 3FPEA 1I4WA 3GDHA 4NECA 3X0DA 4E2WA 1KPIA 3O31A 5GM2A 4ER3A 1JSXA 4O29A 2P3OA 5EHIA 2ZZNA 1O9GA 1JG4A 5K09A 3M4XA 1RI1A 3ELUA 2PXXA 2AN5A 3P2EA 4WXHA 2PJDA 3HVIA 2FPOA 3UJAA 4YMGA 3BWYA 4DCGA 3CCFA 3MHTA 5K0JA 5EZSA 3KKZA 4H0NA 1SVUA 3C3PA 5ICEA 2EFJA 3GJYA 5DM4A 5FQNA 4X41A 1JG1A 1JQ3A 1EJ0A 4KW7A 5T6BA 4ER7A 2IH2A 3KR0A 5EKUA 3FPGA 1IY9A 4PCAA 4U7TB 5K0LA 1M0EA 4KVZA 3R6TA 1SUIA 2BH2A 1PRYA 3NWBA 1FBNA 3OPNA 1SUSA 4FR0A 2PVCA 2OZVA 3NDJA 4RTSA 2BM8A 2GB4A 5DM2A 2YR0A 3GRYA 2ERCA 2GS9A 3OFKA 5EHGA 2YQZA 5FULA 3BXOA 4KWCA 1KIAA 1NW8A 2AVDA 2JH9A 3NJRA 4OA5A 5H02A 3GRZA 3EEYA 1NBIA 5B1SA 2VDUE 3HA3A 5CIYA 3KQQA 1DL5A 3FRHA 5E1MA 4YV2A 3FUTA 4KRGA 4ZTBA 3TKAA 2A14A 4AUKA 4HGZA 2ZLBA 3LKZA 3I9FA 4WVLA 3LHDA 3JWGA 3E8SA 3D2LA 3FPJA 4LWOA 5IKMA 4YUZA 2IIPA 3EVDA 5C9ZA 5JUWA 3LBYA 4FZVA 2FCAA 2NNWB 3DMFA 5DTQA 1AV6A 2ZSUA 3EVEA 3KQOA 2CL5A 5LQRA 3UJ6A 2O06A 3KQYA 4HSGA 1ZQ9A 4P7GA 4PYJA 1SQGA 2HMYB 1L1EA 1SG9A 3PLAE 2ZFUA 4YUXA 2QE6A 2V7EA 1YUBA 2I62A 3L8DA 5HZMA 3HCAA 5EMLA 3FTEA 4AZWA 2PT9A 2ESRA 1VP9A 3B3FA 4F84A 2HWKA 3MTIA 3THRA 1YZHA 3FTCA 2R3SA 3IHTA 1NW5A 3HCDA 3DLCA 5C0OE 3TKYA 10MHA 1P39A 3BGIA 3KPJA 2NXCA 4F86A 2HTEA 2O07A 2ZZMA 4HTFA 3A7DA 3OU7A 3O7WA 2PLWA 4HC4A 4P7JA 3RIEA 2G70A 3TRKA 2PGXA 5E2BA 4K6MA 3DLIA 3GNLA 5HILA 5C1IA 3I58A 3I53A 3BUSA 3KQVA 3BKWA 5DRYA 3A4TA 5EMMA 3CJRA 3KQTA 4CTJA 1WXXA 3ER8A 4RTKA 1D2HA 4ER5A 4C06A 2AOVA 3GO4A 3R24A 3IEIA 4MHTA 1YF3A 4OBWA 5FWAA 3SGLA 3ORHA 3T7TA 2IGTA 5HIIA 2UYOA 3UJ8A 3ELWA 2O0LA 3DR5A 4V0RA 3FRIA
chains in the Genus database with same CATH superfamily
4A03A 3KE9A 3BMOA 1N57A 3L4SO 5B7QA 4MQFA 4RANA 1LPOA 1QV7A 3MWDA 2BTQA 1W5FA 3ZIUA 3PIDA 1L1FA 3Q8KA 1WG8A 5E7QA 4MVJA 3BE5A 5P8WA 1FTSA 4HFNA 1G2PA 2HDWA 2ZRDA 3Q9UA 2AEFA 2RDMA 4A6EA 5DNCA 9LDBA 2FF5A 1M2KA 2B36A 1UINA 2YWGA 4Q16A 1S2LA 1WTAA 1DUIA 1ZLXA 2LV8A 4N0MA 3P9PA 1WOYA 2Q2OA 2WNIA 3V1LA 2WD7A 3FDZB 4ZGBA 3OA0A 5BSUA 2YZKA 1BD3A 3R0IA 3H99A 2V6GA 1EFAA 3MUNA 4IM7A 4JP2A 1XD2B 5ARBA 1XVVA 1E9AA 3DC7A 4V1CA 1ULSA 2GYUA 1G66A 2R5NA 3GVIA 2EW2A 3S40A 4GECA 4DRXB 1OX6A 1P7YA 2FWIA 4DSAA 4ZDIA 4CEJB 1WPGA 3ANXA 3LGAA 3NC0C 3PHGA 4Q7EA 5K0NA 2JJ1A 1KYQA 5DHFA 3B7WA 3V1NA 1CS4C 1VKOA 4C3UA 1M6HA 2GBCA 3LLMA 4HB3A 3KOZA 1G291 5JXJA 2D0IA 1OC2A 2ZTUA 3ZCSA 4B6OA 4EA7A 1Q91A 1F4VA 3D5TA 2FETA 4MWSA 1SC9A 1JQLB 1U8CB 4NYIR 3RYFB 3DJFA 3KDPA 1M2FA 4YLYA 3CM0A 1SUDA 1CIJA 1C9YA 1NPDA 1PJ8A 4J2OA 4M9XA 4YPOA 1U3CA 1XNJA 5HM8A 1WB6A 4IVQA 4D0NA 4JBIA 1H85A 4DA9A 1V48A 3K9GA 1M75A 5BNFA 3X43A 5HG0A 2DFLA 2G1KA 4MQFB 1PCXA 1UCFA 1GNLA 3I61A 3MWDB 5CVTA 4BLWA 2A5GA 1HDEA 2G40A 2O2IA 4LTMA 5HCIA 3T3EA 3UMSA 2CXUA 2HLPA 4D8VA 1H42A 2BDTA 3FF4A 1RBMA 2H31A 3HSKA 3LLCA 4M6WA 3W5SA 4JS0A 1ZONA 4B5LA 4ER6A 1ABBA 3UXEA 2A5JA 3MJFA 2JI7A 4NMXB 2PBRA 4JBYA 3UMCA 1ESCA 2TS1A 5IANA 3AZPA 2AEMA 1WL8A 3QKTA 1O94D 4BOYA 4BZQA 5BWCA 3KJZA 4YUYA 2OFOA 3BFVA 3PRJA 4FGSA 1CQWA 1WULS 2PRIA 4M9CA 3JTMA 4IX1A 2WD7B 3H8SA 1A2QA 3L77A 5F2OA 3TPCA 3ZDFA 2QP9X 1IZ7A 2E89A 4J7UA 1H69A 3FZNA 2UAGA 2WF8A 3KK0A 3WQQA 1RCUA 3DBRB 4RX1A 1ZD1A 1H5NA 4UULA 2QVXX 4FHFA 1BCRA 1ZKDA 2X7JA 2V1XA 2W0SA 1XDGA 2BCJQ 4Q12A 4JC8A 5FBWB 4ALNA 4TQUS 4ILEA 1REQB 1OASA 2W98A 3OEHA 3TGLA 3QLUC 4GC9A 4FYJA 1FDRA 3VNRA 3G88A 4GNRA 1JB9A 1RXEA 1E7MA 4BFUA 3CLRD 1QHNA 4MUAA 2IV7A 1THTA 2B8EA 2QL9A 3FUWA 1R10A 4N8DA 1HYBA 1RBYA 1C8KA 1ULBA 2R96A 4NV0A 4QVKA 4YIKA 3JVDA 4F5WA 2W90A 1CQJA 2BR3A 4EIWA 2FEWB 3SDBA 1C8LA 4OK3A 5CRIA 2OQVA 2JVKA 3CVXA 1SXJC 1P17A 3QH4A 4Z7NB 5FWYA 3PQCA 1XROA 5H68A 3PXCX 2HDOA 4B82A 2C07A 3GAAA 4OU5A 2ZG6A 4BMZA 1OAAA 3HACA 5KYNA 3ZWAA 3ML1A 1UM9A 1VJ1A 1QCDA 2ZB4A 3E5HA 2B61A 4RVDA 1C80A 1FNCA 4D4IA 1QGYA 1R8XA 5G1PA 4G41A 5IM4A 1HYGA 1DFGA 4FNAA 1U3FA 5IDWA 3QXSA 4UQOA 3PGKA 1RAHA 3NH6A 1LB1B 1A4RA 1EIZA 1FX1A 2GDZA 3HZZA 1ML3A 4ENSA 2H4HA 2Q29A 4WOKA 5LDGA 3MJTA 1G5FA 2YYSA 2QPTA 3W5HA 4S1WA 4ZAGA 4CG1A 4BVEA 5KJ6A 3BWCA 1G9SA 2HJVA 4E11A 4YCMA 1JJIA 2NGRA 3AFNA 4RKQA 3Q7QA 4O2AF 1NFQA 4JJEA 3RLIA 2DSTA 3U3MA 3LX6A 3NVKI 5JZMA 2R4UA 1ADYA 3V2GA 4CM8B 1LV8A 1HQYE 3DNFA 2F7SA 1QWSA 1X87A 1MOPA 3PX2A 2W6ZA 2JLRA 3A6LA 5EPPA 1XDSA 1Z0IA 2WHRA 3PPXA 4Y9UA 1PNTA 4WQMA 4YJGA 1OXXK 3U3RA 1JAZA 3G2HA 3F67A 3DKVA 4FNMA 1E92A 3QLUA 4YJDA 4DWWA 5A4DA 2D0PB 1LBIA 1M7BA 2PKEA 5ALIA 3N0VA 1Q3KA 3E9QA 2QUBA 4K9NA 1U8AA 2ZM6B 1BCRB 1F2TB 1U7WA 1HFEL 4IEFB 3WQHA 2SKEA 5A62A 1Z62A 2Z56A 1Z6YA 2GD0A 2VQSA 3QELB 3KHTA 4FFBB 2V59A 4FMDF 1DIRA 2IQIA 1I7QB 3VU0A 2ZSBA 1UP4A 5FBKA 3HZHA 2IV2X 5JZOA 4FD3A 2QJFA 1SXJA 4JKIA 3R5TA 4WUTA 2PSFA 4U63A 2EP5A 2NQ8A 4WE3A 2J0QA 3WRXC 4OI4A 2ORIA 3C43A 4YNBA 4LF9B 1O2DA 3G79A 1VSBA 4AKTA 3MELA 1R37A 2OB2A 3LS2A 2Y1KA 2PWBA 3CNQS 1ADBA 3OWHA 4Z86A 2FYTA 3W04A 4RESA 1DOZA 5FWYB 4HN4B 2EBHX 4IXNA 3T0IA 2IBTA 3D4LA 4P7KA 1P6UA 1VCNA 5E9QA 1BXZA 3FNEA 3TJMA 3QX3A 1Q1AA 2XT6A 4H7DA 1GDHA 3IS3A 3ZCRA 1HLDA 3NBKA 3F7MA 4I5FA 2HPZA 4NG5A 1UM9B 4D9FA 3ZI4A 4DZTA 4AMVA 2F90A 2W2LA 5LQCA 5THXA 1BKDR 3UJPA 4RXTA 3V55A 3ID6C 2I6QA 4RL6A 4F21A 5BN5A 5JAMA 3W3AD 3ZDAA 3OJLA 1V47A 4GBED 5DGDA 2HHLA 5JHGB 4QM6A 1Z73A 1C7IA 1A1SA 1FTWA 1NF9A 1TMYA 2FXIA 1E18A 3GC6A 3FLMA 1D2NA 4L6CA 4EMUA 1G98A 4LSZA 4EBFA 5KCZA 1FU4A 3D3JA 2PT6A 3L4BC 2JNWA 1IH8A 3ASZA 1T13A 4AO6A 1T9AA 1DDGA 3NUQA 2D1SA 2C5SA 1Y8QB 3DMGA 4ZTZB 2P2NA 2XBLA 5HKKA 2J6HA 2WTEA 3BULA 1ZSNA 2TMKA 3KYCB 2EKPA 4IIJA 1LF5A 4YJGB 4M7OA 4DSOA 4HNSA 4P7FA 5GY7A 3Q85A 4KQGA 5CLIA 3PNLA 2CN1A 3BTVA 3GEEA 5KNLA 1RKUA 1UMDA 1WP9A 3PT9A 3WRXA 1DIAA 2J9YB 3NM5A 1D9ZA 3C70A 4BE9A 2IVFA 2PS9A 1KQPA 4FS8A 5KOJA 5LIRA 3DD1A 3L06A 2HDNB 2VUIB 1KTIA 1J6UA 3CPHA 1YR7A 2F3PA 3QVLA 1Z18A 1DJNA 4CCSA 5K2OA 1R6TA 1R0BA 3SDZA 1R3UA 4MPTA 2Q62A 4D99A 1E98A 2EYUA 4IHJF 4UZSA 3WGMA 2ID9A 3W77A 3ILHA 3AR9A 3CUWA 1DCTA 3O0DA 4KPYA 2ZDQA 4X62B 1U9JA 3B5JA 4LSMA 3WIEA 3GFSA 4LRWA 1O87A 1EKXA 1RW4A 3NIFB 2D0DA 1TUGA 4YBZA 4C7VA 3LI2A 4N4AA 3IVMA 1PX2A 2NSLA 4TLLB 4Q9HA 4G84A 3T38A 1G8KA 1L5OA 2IYTA 3BWVA 3HL4A 2DG2A 4NAVA 1DEXA 4QPJC 1JKJB 1Z8FA 4XSVA 4E94A 5BN5B 3MTDA 1RZUA 2XUOA 3UWKA 1Q44A 3L4BA 2ZJ8A 4TV9A 1QORA 7MDHA 5FQOA 1ZVQA 5TEVA 4D3FA 1T8SA 2VEDA 3LYHA 1XDZA 3CTMA 5EXDA 3A1VA 1Q0RA 3TNLA 3UHFA 2C04A 1M2JA 5A2GA 1DOHA 1KA9H 2FG7C 4BO7A 2GRAA 1UJBA 2N47A 2Y77A 3EFBA 4TUYA 3TLXA 3UGQA 2DLNA 2BUBA 2JPDA 2MYPA 4A8TA 2BR4A 4IF6A 2NV6A 3KJNA 3O8RA 1T0UA 2R79A 5DULA 4L6IA 3WLNA 1CDEA 3GZ4A 4OOEA 3FJ1A 1B14A 3I2HA 3OKAA 3BIFA 4EL0A 3T1YB 2AKYA 2JKZA 4WLUA 1W4BA 4MVWA 1EK1A 2JAUA 1Z2PX 3RSLA 1NX9A 5AUQA 5FO0A 4L75A 3F46A 2R6CA 1KS2A 1OXTA 1BGXT 4LOHA 1T25A 4YGXB 4AC9A 3OTQA 2WJZB 3IP8A 4J03A 2B4KA 3C14C 4DV2B 3JQPA 3P9RA 2QI9C 5KOJB 3FPAA 2VNJA 1PLKA 1T1IA 5JAQA 1GAEO 4F4CA 2C4NA 1SUAA 1XB2A 5F64A 3FD8A 4C78A 3QOYA 2Y1EA 2YXBA 4JLPA 1ENPA 2GVZC 1HRKA 2Z57A 2YCLA 4E13A 2B1IA 3BFPA 2ZYUX 2VPWA 1NVUQ 4K9OA 1OYOA 1YRYE 4MJXA 3PRHA 4UM7A 1F12A 4KYUA 3PFWO 2HIGA 4HS4A 4QQRA 4KUEA 1CDZA 3C7KA 4XSGA 2GEKA 5ARCA 1L5KA 3ZWXA 5JAOA 4FZRA 1G20A 2GFAA 5JSUA 3CJTA 3L7AA 5L6LB 3I9LA 3W06A 4WCVA 2CXHA 4TSFA 2D54A 5KYYA 4PHCA 3IFSA 1J7JA 2O50A 4TV9B 4GGMX 1KEKA 4XOUA 2MSLA 1ZJ6A 2OV2A 3FPFA 3NYQA 2JAXA 3UUFA 5HOQA 4D96A 4FJ2A 3GFQA 3ZJYA 4DCVA 1NHWA 1RIFA 4DQVA 1HX7A 1VCHA 3T15A 3PIIA 1M8GA 3QF4A 3UJBA 2AD5A 2X15A 4TUYB 4S35A 2CSXA 2OCIA 4G97A 3ESDA 4FOSA 2PH1A 3ROKA 3K1JA 3VR3D 2XHEA 4FKMA 1EXMA 4WA7A 3MGBA 4MI3A 4ZK2A 2H18A 2PMWB 2FVYA 2QE7A 1YAJA 2L82A 3Q6MA 2HB6A 1IPFA 4QFCA 5CH3A 4O5AA 1DVRA 1LI7A 2OXEA 3ET4A 5K0CA 3U61B 1MJNA 3E05A 2WHQA 1K3TA 4K6OA 2UXCB 3BMNA 2Z8YM 6AT1A 2EX1A 2PX6A 3LT5A 4ZDKA 1WZCA 1PFYA 4LJLA 5K09A 2ZR9A 3M4XA 3ELUA 4ZAXA 1LK0A 5EIBC 5BSVA 5EZ5A 5SICE 3UV3A 3W5CA 4DDMA 3JWPA 2C7BA 3VKFA 4TMXA 2FQWA 4UTXA 2FPGB 1K6IA 3DZ8A 1JLHA 1G63A 3NIGB 4NKRA 1HNXB 1ETHA 3ZJ5A 4IEIA 2WWHA 3D6UA 1TK9A 1UMBB 2NXWA 4JVSB 2VDWB 5E3JA 3H1TA 4FTWA 4BGVA 4BQIA 1UQTA 4XJTA 3IAM1 5JOQA 1M0EA 4YACA 4K6GA 5K3DA 1QDNA 4C0LA 3CCCA 2OP0A 4L07A 1LVUA 2G9ZA 2X0FA 1JJAA 1UPBA 4G0VA 3TLYA 4QFDA 1RLUA 2IYLD 3AM5A 3ZDZB 3CLUC 4ITVA 3SQDA 5DM2A 3TBKA 3LC7O 4W5QA 3X44A 5DGCA 1E69A 5THKA 5AIBA 5JFOA 1AM4D 1B43A 1ZC1A 1MUUA 1Z4MA 1JHXA 2IYVA 2O6HA 3N3AC 2FTKE 4KWCA 1W9HA 2OSBA 4EG1A 4WN9A 5DVZA 3TQQA 2NQ2C 1BN6A 3ESXA 1CVRA 3OKFA 3PBKA 5H59A 4F2HA 2XKKA 4DR3B 1L6IA 4UDYX 1T3HA 4YV2A 1T9BA 3FUTA 3N74A 3K70B 3KSDO 4Q9DA 3U0BA 4O4LF 1DCKA 1DBIA 4IAOA 4ISBA 3E8SA 4CCAA 5BRAA 1PWEA 1K7SN 2AR9A 4ZT5A 4CGYA 4MB6A 4DREA 2ECFA 3E0XA 3RRFA 4BLPA 3O95A 4ZAFA 1KETA 2OZLB 2JDIA 2RC6A 5A5DA 3GLGA 1JDNA 1PYGA 2I4NA 4RNDB 16PKA 3ETHA 4BV3A 3KZNA 3PDJA 3QU4A 1J5EB 4TN5A 4GSKA 2HMYB 3LBHA 4F5ZA 2JFYA 1SVKA 4UOQA 4TQGA 2ZWOA 1YZNA 1X8KA 2MYUA 2P4QA 3F9IA 5CT5A 5J2TF 3BMNB 4V3CA 1I30A 4ZO4A 1TIPA 1WPRA 1VXRA 3EUFA 4ZZ1A 1KEWA 2Q6KA 1E79A 4J4BA 2OBBA 4JX8A 2ESRA 5BO5A 3S5JA 3T3PB 1HTWA 5HRUA 1PR6A 4UHJA 4NPCA 2FEXA 2ZJ2A 1QPGA 2O52A 2YINC 3LHFA 3MTAA 5F2EA 3UK0A 3VMMA 2QM7A 1XXHB 3JS5A 4PLCA 1B93A 1D09A 2VATA 4HC4A 3ORFA 3GIDA 1UJ6A 3IQFA 4O02B 1J06A 3S0JA 4Q7QA 4RF2A 3WYNA 4CL2A 2VT7A 5J5CA 1ECLA 3P96A 4E5SA 3BMQA 2N75A 2RKBA 4W8HA 3F6PA 2ECPA 3ASUA 3R24A 2FI1A 4E3WA 3IP5A 2ZRJA 1RE0A 3AINA 1IPEA 1PZEA 3L1JA 2ODPA 3G49A 2C3PA 4HDKA 3SHFA 5KYGA 3NP7A 1E32A 1DARA 4PG6A 4OH7A 1TB4A 4QYWA 2IYQA 4TTPA 1G2IA 4PGMA 2ZSJA 1DC6A 4HAIA 4OBEA 5JWOA 1K89A 4FWIB 4US1R 1Y3BE 4BKRA 1IONA 5AT1A 4KQ6A 4X92A 1AF7A 1LS6A 4F71A 5IPFA 1WPXA 3BPSA 4O2RA 3W2GA 3KSMA 1QIKA 3WLHA 1LPMA 4R2LA 4CIDA 4D4JA 3C98A 5FPQA 4YONB 4QICA 4OB6A 1O54A 3LX4A 3HFSA 3EH1A 3LSTA 2PBFA 2V7GA 4I08A 3FYTA 3JYLA 4PONA 3PEFA 4WJZA 4D92A 2GJ4A 5EG5A 1FEZA 3IODA 1E9SA 4TRRA 4OCZA 3IUEA 3I64A 3OQIA 1IG3A 1UF9A 1XTJA 2O2CA 2YV4A 2B4QA 3HZOA 4CETA 2C03A 3H5OA 2HV9A 3IAS6 1VL6A 3H9JA 4X1YB 4EY7A 3CB4A 3H3FA 3E9YA 4RGVA 5EMNA 1JHUA 3OZGA 1LSSA 4PCLA 4QWWA 5FTMA 1A98A 1NT2A 1H2EA 3A6KA 4DQKA 4G1VA 4FHDA 1QIJA 1D9XA 4ZVTA 1KKUA 4JOSA 3GQBA 3GLFA 4XA8A 3MWJA 4B6PA 4V0LA 2H3EA 4DKXA 4ZYTA 4HWSA 4TRMA 4QRDA 3T4PA 5ALXA 1L4FA 4G86A 4MI9A 2X58A 3QUQA 4URUR 3DOEA 5CIQA 3PGJA 4RGYA 3QUCA 4B7AA 2IY7A 3H2SA 1H6BA 1IM2A 4PFQA 1JSLA 2FH5B 3AR8A 1HKUA 5TGZA 3DNMA 4PYIA 2E6KA 3SSOA 4BCBA 3KZCA 3BDAA 5I3CA 2PXHA 2RBEA 4Y2RA 1H0SA 4IHQA 1MU0A 4ALIA 1PLLA 1EXDA 1SM4A 2B5VA 2P3LA 3NIDB 5IKXA 3M5DA 4GC5A 3CTPA 2QF7A 3GJQA 3NUZA 4GM0A 2B3TA 4BNVA 1R0KA 1SR8A 3AXSA 4MR8B 4N3AA 3UJDA 3P9XA 5CX1B 4F8YA 3I9KA 1JU9A 3H6HA 3E2PA 3IT0A 3QLTA 4YY3B 2Y68A 5ALTA 1AG9A 2WA2A 4CDMA 4IL5A 3WZLA 3HPQA 1BHSA 1OLXB 3AHCA 2I76A 3U3JA 5CD1A 4NE9A 1K6XA 4AMYA 4LZWA 3UFXA 4FWBA 2C20A 4O8ZA 5FPTA 4N48A 1CEXA 3QBTA 4WSOA 3DAFA 2WKQA 1N1GA 4QOSA 1G41A 2H07A 2YVKA 1V7ZA 4PBTA 1UPTA 3V2IA 1KERA 1JVBA 3IQEA 3BMCB 2Z2ZA 3BMXA 3KHKA 3OQIB 3CSSA 3KZOA 1JDBC 3G13A 5TQ2B 2XQIA 3AYXB 3I8SA 3QA3E 3NANA 5K6TA 1PDOA 2GT1A 1C29B 2GJSA 3TIVA 1HYEA 1NP7A 2QYTA 4RENA 2ANCA 3EXHC 4AJJA 4C05A 1WP4A 1W0KA 2DYKA 4X90A 1L4HA 3GQBB 3GLFB 1GL3A 3UATA 1XJ0A 3GRAA 1W94A 4WK6A 1HK7A 2BLLA 4IG4A 4LHWA 5LXTF 1Q92A 1TVKA 3FNHA 4UQLA 1VJGA 3G2JA 1YZYA 3AUFA 3THYA 2XCLA 1T2AA 4YC7A 4TKVA 3KEMA 4DA6A 4ZYLA 5TMDA 4XDZA 1BXGA 5G3YA 3MM4A 4EELA 1I94B 2WJGA 2GHTA 3I34X 3JPYA 3SFTA 3L0DA 1XHFA 3UJ3X 4DLLA 2DKOA 1IJEA 1W34A 2QA5A 4Z9XA 5K3FA 1ATIA 2C98A 3N6XA 4AJ4A 4TXNA 1GTMA 3ADPA 3ZTYA 2VWPA 1RLIA 4UVDA 3IULA 1BXRA 3FMPB 3QHQA 1L1QA 2VS1A 4KLRA 1RRPA 3I9OA 5E1DA 4ALMA 1GAJA 2FLWA 5MN5A 5CDFA 3DLBA 2J09A 1A9PA 4NZMA 1LY1A 4CZ2A 1TVMA 3G1WA 1VL8A 1F1BA 3RQSA 1Y5NA 2QQ5A 2EARA 3G2IA 2J0EA 2WM8A 5B6CA 4NU5A 4RORA 5AMXA 1WMAA 1PR4A 2VVTA 3TTTA 4FLEA 2A1UA 5DTIA 5DV9A 3SBXA 4RD0A 2DHRA 4Z9BA 1ZPDA 3B2NA 5E95A 5G0VA 4CG0A 4D9BA 4EHNA 3O5AA 2UZ4A 2Q27A 4RABA 5KVSA 2ZI6A 3MZ0A 3N87A 5AXDA 2MM0A 4G3XA 4KNVA 3T4XA 2IZ5A 1F51E 4FOPA 1R1DA 4MQ4A 5FTJA 1A2BA 1MGOA 5GOZA 1EBUA 3EXHA 3IQZA 1W87A 1Z08A 2E2WA 4JL6A 5EXTA 4RZQA 4FM9A 3UMBA 1ZW6A 1XPOA 3H16A 3MUOA 5KKCA 2FRDC 1V8BA 2W71A 1M66A 4LNUB 2PRSA 1F8YA 1BDJA 3QI2A 4OEHA 5EMHA 4ZT7A 5FBZA 1KRXA 1N0VC 1I3LA 4E0BA 4DG9A 2QLFA 1KWKA 2VQEB 2OBXA 1XO1A 2WIGA 4DLAA 1MAHA 2WJVA 1KJNA 1S01A 3DL4A 1D6SA 4L5YA 2OGSA 4GH5A 1JU4A 3KR1A 4ND3A 4D82A 1S2DA 2VYNA 1GZ6A 3I8OA 5ALVA 5GADl 3THYB 2PAAA 2YHUA 3DOUA 4AY2A 1PKEA 2BV3A 4L57A 4TKVB 4JBGA 2ORED 2QUAA 4CKEB 3I9MA 5A5EA 5I8PA 2HKIA 1WZIA 1Y37A 4M46A 3KOOA 4M8NE 2FXVA 5BWOA 1ZLYA 3ROQA 3TLEA 4DLWA 3K0KA 5K3FB 1NF8A 1QYWA 4Q7MB 1N9KA 3LXRA 1MZPA 1P0PA 1HZJA 1BXRB 1ESMA 1U0RA 1KZ6A 1JHAA 4B80A 4W5RA 2PXAA 4HFJA 5BY2A 4L8GA 1CUHA 2ZSHA 2VA8A 3C4JA 4G2NA 4B17A 2I99A 2IYWA 2I1VB 2I4OA 3KOUA 3HCCA 3QMVA 5JYEA 4QASA 2E4YA 4H9GA 4E4RA 1IHUA 1Y9AA 5JLJA 4I1UA 2A1UB 3PA8A 5DYIA 4KO1S 4L4YA 3FOEC 1I2AA 2QR2A 3OCWA 3F2VA 4G1EB 1G4HA 4GGOA 4PAQA 4UBLA 1YJXA 1LEHA 5FLEX 4HRVA 3SS8A 3VTFA 2HGSA 3I12A 3DM5A 5JS8A 2CV0A 1SUBA 2HZBA 3L46A 2VHJA 2B8NA 1OVMA 3NHUA 1PP4A 5J5VA 3P97A 4LQCA 1QRSA 2FRDA 3HY4A 2ATVA 4OK5A 4UD2A 2QIPA 3A70A 3AEUA 1DUVG 1DJQA 2ZYRA 3EWSA 4JGBA 3S27A 3EXHB 4X20B 4BE7B 5JCZA 2UXDB 1F9AA 3A3NA 4DYVA 1Y8CA 4I5DA 1P2FA 2VDNB 2XLCA 4ENQA 2Q41A 1YK0A 4D74A 1S4MA 4WXYB 3EZNA 4RM2A 1RXVA 2J67A 3O74A 2V74B 4MUIA 3GFGA 4MA0A 1N6KA 3A3KA 4PYRA 4Q3DA 3L7NA 4B7UA 5E4JA 4YP9A 4MNTA 2R11A 2FOXA 3WNZA 1K7EB 5CFOA 3SEQA 1UKBA 1AF4A 4P34A 5IUKC 3MJCA 3HN2A 4X7PA 3PUXA 1FFSA 3IERA 3PFBA 2BZSA 3B2EA 4M55A 3VZPA 4EHJA 3I5XA 4OX9B 2QS9A 4UVEA 2GBGA 1BROA 3LLUA 4NE2A 4JLOA 2ONZA 1I4DD 3JYQA 1GPBA 2WUGA 3SPXA 3SX2A 1IBSA 1VI6A 4HFRA 4CMJA 3GT3A 1OXVA 4L6AA 1WABA 3RKRA 2WTUA 2QK4A 4X84A 3LFTA 1DFHA 4U2CA 4C03A 2BP7A 2JFOA 3O4IA 2PANA 2GCGA 1KAEA 3KC2A 3TW6A 1Y4AE 2WR8A 3MXTA 2IYZA 3QNWA 2FPIA 4NCKA 3DFZA 4C3ZA 4H1TA 3CX7A 2RIRA 4AWBA 5E1BA 1YGPA 4ZKEA 1PEYA 3ZE9A 2WJ4A 1KE1A 1UDCA 3IDQA 1ISMA 2BPOA 4G8BA 1ATZA 1XZPA 521PA 4BNLA 4Y2GA 1UQRA 1C1HA 1V45E 5F73A 3CBGA 2NUAB 2CEAA 3ZD9A 1FFXA 3RAFC 2AEJA 2YWJA 4ENRA 3UAOA 1BYIA 4RYLA 3NB0A 4YMVA 2PZAA 3J81A 4CMHA 3GFFA 3DLHA 4BWYA 1KZ9A 4HOYA 3T9EA 1IQRA 4IOMA 1UC4B 5COBA 1KH2A 2X1LA 1LSOA 5AW8A 2YIVX 1TJNA 2QQEA 4R7GA 4W5NA 3UAGA 2JHAA 3MCVA 4UAGA 4C89A 4ZXFA 4MR9B 2NVWA 1TTHA 1RYHA 1UBNA 2RHGB 5E6RB 2RK3A 3TW0A 4JJ4A 5KHLB 1DEAA 1EHCA 1U4NA 2P41A 2ALJA 2PT5A 2WT9A 4I66A 1D4AA 5JO0A 4QYSA 3VH3A 2J7KA 4Q05A 4R1SA 4WKCA 2BGGA 5IT5A 2VQ3A 1M2WA 4KBYA 4IILA 4QATA 4X24A 5GZ3A 5DM70 3TGWA 4B32A 1INLA 1T24A 4AKGA 2J3JA 2ZT6A 3LSYA 1L5QA 1KDRA 5KAMA 4F2WA 1YQTA 2LDBA 4OLAA 2EP7A 3H7IA 3EZ6A 2MSEB 3CYFA 3IIMA 2OXTA 2MMCA 3B3GA 5BV7A 1BE8A 3GK3A 1FUKA 4N5LA 2XVZA 1NWCA 3MINA 4M7WA 2YNMC 1ZUNA 4S04A 1IXRC 5KOYA 4ITRC 1DBWA 1P1FA 1YR9A 2J7PA 5C4MA 3UZUA 2PX5A 2ZYTX 3AVQA 3OFJA 4MB0A 2FR1A 4YR9A 2H1VA 3IDAA 4IIDA 3WAKA 5C80A 2FPIB 1JYFA 1NDHA 4AG3A 1E4VA 4G1BA 5M29A 4MVCA 2IDJA 3M34A 2YMPA 1N2EA 4ZOLF 3PTAA 4PTLA 1JFLA 3SKYA 1G59A 4R16A 2GUWA 5FO1A 2NU8A 4BQRA 4OJNA 1N6NA 2CVFA 1E3EA 4NRDA 1JG6A 4GMFA 4EY4A 5F9FA 3C6XA 3QE3A 3A1WA 2O2SA 5DYGA 3DZCA 3OLWA 1FS6A 4DHWA 4HQLA 2IZ0A 3QQ5A 3OZBA 1XKTA 2O7SA 3AP3A 1CHDA 2KBEA 2ZYDA 3TECE 5L3VA 2CXRA 3USCS 3T3OA 4RTLA 1FYXA 1VLVA 4N0DA 2Y4OA 3COZA 4F8EA 3DEHA 5LYYA 2VJQA 1T5OA 5CLGA 5CVEA 1Q7TA 4IZIA 2FZGA 1IOWA 3NDPA 3JQCA 4JI8B 2IX9A 4R9UC 3RWMB 5FTKA 4JOBA 3B20A 1V5FA 1KMNA 5CBPA 4DJAA 2AK2A 1O9GA 4XYBA 5KJCA 2JGDA 4Y0NA 2MSKA 1SBIA 3PQEA 3KVNA 3P2EA 5JAHA 5HDBB 3D2BA 4HQFA 5D3ZA 2W9XA 4CBVA 1AJEA 2HJHA 4BAZA 2C99A 4GL2A 1PFKA 2YNMA 3GMSA 5J59A 5KPJA 1QE5A 2WAOA 5HF9A 1P77A 4Z0HO 1WMSA 2C4WA 3WZ2A 3HJAA 4KW7A 5A0FA 4JFRA 3QRWA 1FVFA 1U0SY 4NBSA 4V0NA 2JIQA 3SS9X 2REOA 3KQNA 1E3WA 2JW5A 3DP9A 5JZBA 1ZUNB 1FBNA 4IVPA 1MFZA 4B6GA 2YJNA 4AQDA 2OZVA 3RK1A 5TRTA 3PXGA 4RTSA 4Z4GA 1UBJS 3A05A 4IBOA 3Q0IA 4O2LA 1OHHD 1I24A 4YCBA 5DHAA 6REQB 1CJMA 1ISFA 1ZXLA 3BHIA 4LJ8A 4OJYA 1FJHA 1ZI8A 4H3KB 5AR1A 2AVDA 1VJTA 2B83A 2DCUA 1H0RA 1UIMA 1XZBA 3EWNA 1AZLA 3ZDRA 1XHEA 3EHDA 3L1IA 4KL8S 4OJKA 3ABIA 3OG9A 4FEEA 4P0PB 1X94A 4AUKA 1YJ8A 2QXYA 3BL8A 5FKJA 4PAGA 2XQGA 3WLMA 4JR1A 1RQGA 1L6RA 1AXGA 1ECJA 4MPRA 1P1RA 3U7HB 2OBYA 3O3NB 4WASA 4YCAA 1R2QA 2ZAMA 4OAOA 1NN1A 1U0NA 2BZ0A 5KIAA 1T91A 1M2NA 3AF2A 4JJFA 4RBNA 2WG0A 1KJIA 4LOLA 3BSSA 5BW6B 2ZUCA 2M1ZA 5IT0A 1ZOPA 3Q41A 3REQA 1Z63A 1LWNA 2OLKA 3PR1A 4Q01A 5B58T 5FBVB 2YC4C 2FWJA 4BNIA 2IYAA 1NR5A 2X9GA 3L41A 2IEGA 3LHKA 4RMNA 3V2UA 2BKUA 1DKOA 2I62A 2XW6A 4PAMA 5CBPB 2EBFX 3L79A 3NTLA 1NAIA 3TEMA 3R3XA 4E7PA 5J2UA 4LVUA 1NQUA 2JGDB 4FDLA 5H0IA 1QGAA 1WUJS 1E2NA 3RC7A 4EUEA 1PS0A 1J09A 2Z5VA 4N5HX 4E21A 3FOFC 1S8OA 3QZUA 3KPJA 2JKVA 3PENA 3O6VA 1JIJA 3BA6A 4EYGA 1NBMD 1XRRA 4MYTA 5TVKA 2A9OA 4FYXA 2UZ1A 1QVVA 4IFBA 3AUAA 3QLJA 2WYIA 1NONA 1P5RA 1LLUA 4BTEA 4EHFA 5B7PA 2FMFA 2ZVPX 1B8VA 2ZB3A 3BUSA 1E3WB 1CR4A 3CJRA 3KQTA 1UBEA 1E5XA 2NZJA 4K2HA 4ND7A 2QZPA 3DKPA 5ECWA 3T7TA 3ORHA 3HWX1 3BQ9A 1M5RA 4WK4B 4BJ1A 1Z07A 1RLTA 3GRPA 3OO1A 1GPUA 4V0KA 1P3JA 3DR5A 2G6TA 4ZVRA 4RDCA 3TJZA 4BTVA 4UTNA 4HQRA 1JDVA 1L5VA 2FSGA 3F5QA 4BIMA 1XZLA 3LDUA 1N2OA 5GZ6A 3VHQA 3VR6D 4UFPA 3KYJB 3WV5A 1HGXA 2AZ4A 4G9GA 3IBTA 2D3TA 1U2SA 4FMCB 3DCNA 4PC3A 4F38A 2XUQA 1L5HB 1MH9A 1RI3A 3ZJTA 1VJ0A 2HA7A 4QXRA 4X63A 3ZHSA 2WJYA 4B1FA 5IYZA 4C0QC 1ZA2A 5DISB 3JQFC 3VPDA 1HLGA 3CVUA 2G1JA 1IIBA 4FWTA 3ED1A 3SZUA 2XDQB 4PWYA 3WGGA 1U2ZA 4OGWA 3AKZA 2FOLA 4N40A 4CN8A 2Y9MB 2DT8A 2XTZA 3DE3X 3IP3A 3Q7PA 4HTAA 4RV4A 1F7UA 5EUBA 4RHXA 4WLVA 4X66B 2XT0A 2DPXA 2NYRA 2F8LA 2PL5A 2Q4BA 5GV7A 1DRUA 2PWAA 2P9CA 3F6CA 1CEEA 3TUZC 5CEFA 1NOJA 5JT1A 5J2UB 4ZC1A 1D2CA 2R66A 1PQ4A 2PX8A 4JLJA 4EYSA 5SY9A 1AK2A 4M0EA 2XYPA 4MS4A 1TZJA 3ZG6A 1Z45A 3B36A 4IP0A 1QB8A 3L9XA 4YRNA 2YDYA 2RARA 3FY4A 3HXLA 3D8SA 5J4HA 3GZTB 3HDYA 3LY8A 1C9DB 4FX5A 2QDKA 2DPHA 4NV1A 5FIUA 1E63A 2UZ1B 3UJCA 1IY2A 3WKEA 4YJ3F 1MQAA 1J2RA 5C8YB 4G1FA 2JGIA 3DLPX 2CZQA 5DI9A 1E2DA 2C4MA 3ELDA 4JLNA 1PR9A 3H5LA 4U2DA 2ZB8A 1BD4A 5ISMA 1S2MA 4D57A 2AN1A 5DOZA 1W5AA 1M1NB 4POOA 1N7JA 3LD9A 4WLEA 1TKBA 4K8OA 2Q19X 4Q3LA 5ULLA 4DILA 1FVHA 5K0BA 4BGDA 3QOWA 1VHQA 2ZIGA 3N2YA 1G21E 3TLGA 1EP3B 3BWBA 4M8IA 4W1RA 4OHZA 2QTTA 2DFNA 4R9VA 4KIJA 3KL2A 5I4CA 2DERA 5AI6A 2VH1A 3CEHA 1X86B 1IQPA 2Z2XA 3JQFA 5B4VA 1PO7A 1A50B 2QV0A 4R8RA 1EX6A 1HORA 1T9ZA 1HTTA 2ZYSA 1A4XA 4LCBA 3A1UA 1GUBA 5IYZB 1AUQA 1Z15A 2P69A 1E2PA 3AEZA 2WQ7A 3OF2A 1DO8A 4KOEC 1KFJB 2AI2A 2HSZA 1O4VA 2WSLA 2FW9A 3ODPA 2X42A 4YA6A 3ZUPA 2YYZA 5KTMA 2WF6A 3ODGA 4YUWA 1HTBA 3C6YA 3OQ1A 4LBZA 4TPKA 4AZVA 5EXSA 3WOVA 1KMMA 3KJFA 2YW9A 4FYWA 2PMDA 4KXFB 2BKXA 5KYUA 3CC8A 3C87A 3MIZA 1EXNA 1EVEA 1Q15A 1W5BA 2DAPA 2AE2A 4L7VA 3UWPA 2EJVA 3H5RA 3OPYB 4NYMQ 4PHTA 1SCNE 3LJKA 1B0AA 4CMKA 3CIFA 1GO2A 1P6QA 4OXYA 3ZYCA 4A8JC 1G8HA 5CT6A 1R4NA 1WD5A 4JEMA 3GEBA 4ZEOA 3S68A 3ZZUA 1KWGA 4EZEA 5A5FA 1SU7A 2OCAA 1TQ2A 1XKQA 1KH1A 4NZYA 3SEZA 3UB2A 3VPCA 4M9ZA 2OK7A 3OLXA 4H27A 1UOEA 3AH8A 1L8AA 4J7XA 1H9AA 5EJIA 3WNDA 1AHPA 2R6ZA 3ZLTA 2O8FB 1XRJA 4HCJA 4RF3A 4D8XA 4KPGA 5AQEA 4CM5A 1KRWA 3TIFA 1USWA 2XCUA 3VKVA 1AXEA 5KX5F 4GR4A 2ZCJA 5L7TA 2O2DA 4KBGA 4J7CA 3CR7A 2OFFA 1JVNA 1IAVA 3WGZA 5I51A 4YCNA 3FZQA 3R6WA 3F1KA 2VK2A 1RAFA 3SHVA 3SJUA 2IRWA 1H1LA 1L7OA 2P2GA 5KKAA 4RPIA 1OYVA 3OZUA 4P0TA 2O7VA 3K72B 2J4DA 2G82A 2V9ZA 3TE6A 3AP2A 3J7TA 3Q5GA 5FEMA 5FEUA 5DNWA 1Z25A 4L5AA 1QKKA 3AJDA 1QHSA 3GN2A 3QMMA 4QPDA 2OD7A 2FUCA 1M6NA 4OSEA 3IV7A 4QXOA 1RRCA 3EXFA 4QX6A 2IHVA 3MWFA 4PYLA 1QG4A 5L53A 1R00A 2QW0X 3Q98A 4CKYA 1O96A 4UBOA 3INGA 2CDRA 1TIBA 1WF3A 1XWIA 2CDAA 5D1NA 4C2BA 1TM4E 1I7PA 3RODA 1CBUA 1N2CA 3DAOA 4OG2A 5D87A 4JI1B 3PQDA 3QM1A 2QMYA 1YXMA 2QRHA 4QLAA 1QF6A 2XUAA 1PT6A 4PYMA 2BGUA 1K98A 2J46A 2YBEA 1DE0A 3AHFA 2WE8A 4S24A 4A8JA 5KYUB 4GM1A 2I6FA 3FGZA 5ICGA 4G4GA 5U1PA 2QUZA 3VZQA 2Z8XA 4NF2A 4F7DA 4LMAA 1XIVA 1LBTA 1NVTA 3M83A 4K8RB 3ZH2A 4ZI3A 3U09A 4INAA 5IJ9A 2A7XA 3G5LA 2FQQA 4YAFA 3TK1A 3COVA 3A2NA 4MV5A 3SLGA 3OAAD 3VVMA 1U1EA 5GAJA 2VJKA 3DTVD 4BATA 1E2UA 1VIAA 2Y0CA 3AF4A 3PDIB 1ES9A 3AF3A 1QIFA 2AW3A 3UUWA 5EJAA 3WFIA 1PNOA 1OU4A 2P5YA 5M04A 3Q8LA 3PHCA 1KQFA 5F77A 2QRMA 1C3OA 2YY5A 3WDSA 3R3ZA 5AVVA 4B3BA 1QTRA 5ICCA 4UC0A 1DQNA 1Y6ZA 4Y6PA 5FI1B 3VBEA 3ZKWB 3MMNA 3SFZA 4JENA 4LN1A 4OGGA 4ZU6X 4CR6A 4KR3A 5AVWA 3B38A 2XODA 4AZSA 3JXEA 5HK8A 2WY2D 1FXWA 1J7KA 1OIXA 5CH5A 4D0GA 2DWOA 2VAXA 3LVBA 3VH1A 1DIHA 3K0AA 1YIDA 1W4CA 4HNTA 3IAAA 1WS6A 4Y9RA 2PJHB 5CA0F 1HE8B 4KQ1A 1FFWA 4QGAA 2H4YA 3UMGA 3STWA 3C39A 3WRVA 2RH5A 2YXNA 1Z83A 4PFSA 3HCEA 4Q3OA 3I2IA 2OTCA 3HO6A 4ZYWA 3ANNA 1DADA 2Q18X 3IP9A 2CFCA 3PWTA 5KYTA 1I1OA 3I1YA 1AGNA 2JC3A 5T64A 4N54A 4ND1A 2QD5A 2YUJA 1JEDA 4F4IA 3R20A 5EJ4A 3H0CA 4LE0A 5DK4A 4BUJA 1HDGO 1J24A 1O96B 1U7XA 1YC2A 2QPAA 3T7DA 5EJ6A 2Q6OA 5EZYF 1GDTA 1R9NA 2W2QA 1KO4A 2XYVA 4KIGA 3EPJA 1N2CB 3I2KA 4IDBA 1TJ3A 5E9JA 3HO1A 2FEOA 2P90A 4W1PA 3OIGA 2G3YA 3TAUA 3SSNA 1GPLA 1MBZA 1SQFA 3IGFA 4INPA 4JJ7A 2VUSA 4A8JB 5CFLA 1KRHA 5HYVA 2EKLA 3KUKA 3EX7C 2PH5A 4BHTA 2ZRCA 3VC7A 5CFNA 1I2BA 4IXMA 3NYIA 2V6BA 4CIBA 4QU8A 2GZHA 1RP1A 3PXBA 2PL9A 3DMNA 5HIMA 3U13A 4QDZA 1QRTA 2XMCA 1WA5A 4E5VA 2AZDA 1G8JA 2GTPA 1BVHA 3BD9A 4O59O 3JQAA 2IV3A 2QXUA 2WSBA 4FDAA 4ZFNA 4CL8A 1C3OB 1NW4A 5P21A 1UP6A 1J07A 5ALHA 4O4HA 1E7QA 2PQ2A 2WP0A 2ZI3A 1BQEA 1RAEA 2QNRA 3ICCA 4REQA 5GVSA 2GM9A 5I5GA 1ZY2A 3KLNA 5F2KA 3U56A 2RHRA 2WIDA 3AUSA 4KSBA 4Q9KA 3M33A 3OVMA 1N92A 1JHRA 4RKYA 1OA1A 1N5DA 1ZMTA 3A0UA 3PPVA 4M83A 2MIIA 2XD4A 1B6SA 2V7WA 3K0AB 1ISJA 1A2KC 1JE0A 3RVOA 3H4VA 1CW2B 1WJGA 5LWHA 4RSHA 1ZL0A 4RY2A 3FKSD 1AQYA 2PWYA 1CJTC 2Y67A 3EQZA 3DEFA 3EZ7A 3Q5EA 5A4FS 1WZ2A 3HP4A 4CMBA 4LYFA 1VZ3A 1VKHA 2BDEA 2HZ7A 2CLHB 1Z28A 5KJ1A 5IVDA 6GPBA 1L7QA 1TYEB 4NYJQ 4Y9SA 1SQSA 5DTJA 4MW6A 1BGVA 1KVUA 1FBTA 1K7YA 1P1KA 3QG1A 3SQWA 1YR1A 4C4XA 3QVTA 4GPBA 3ZYZA 2POQX 2FUG6 3FVTA 1T0BA 3CE9A 4V0OA 4D0LB 2Y1XA 1BC5A 2AR0A 3E9MA 2FX5A 4II2A 4TOIA 4B83A 2PGJA 2RIPA 2JGRA 2C7PA 2BM9A 1ZO8A 3JQGA 1Y4UA 3EFHA 1BNCA 1SG6A 2PR7A 3AZOA 4YI5A 1T8PA 4L3VA 3ZWPA 4EF4A 5CM2Z 5EIWA 3ZEIA 1B1AA 4BZPA 1JX6A 2B8TA 3IAFA 3HY3A 4Q7JB 4QDTA 4DM3A 5C35A 1TYAE 5TIIA 5IBCA 1K06A 1QP4A 3WAGA 3C8DA 3A9RA 3OTIA 5CIWA 4ARAA 3ETNA 5CCBA 1HE4A 1IBRA 4HB2A 3T8YA 3JAMA 3FHOA 3SIPA 2AFRA 1Y6FA 3AHEA 4CQLA 4XUCA 3H9EO 3C97A 1KBOA 4OM8A 4JAVC 1LXCA 3KLPX 3LTEA 3OIFA 5EINA 1IUOA 3SFVA 2P8JA 3WLLA 1DXHA 3L7MA 2PG3A 1F7VA 3JD1A 5G0UA 5AJYA 3KSAC 1E2GA 3SN6A 2BZGA 1Q22A 3R7LA 4DBZA 2CZCA 3N53A 2AS0A 4MWOA 2F1JA 1QYCA 3QFSA 1QZXA 1N6LA 3FOBA 3MTEA 4N5IX 3QU2A 4PR0A 3UB4A 5LP6F 4B3SB 3N2KB 2VKTA 1DHTA 1W88A 2YV5A 2GSWA 3OPYI 4PSAA 3GRUA 4IGIA 2GKGA 3FWYA 2C61A 3TIIA 4F4UA 4OQYA 1M9NA 2ZYHA 3I8XA 1NW6A 3F97A 1LLFA 4JODA 3RPEA 3BQMB 4J49A 4NICA 3AR2A 4YK7A 5DIFA 2WZBA 5WRFA 3NAQA 1VTKA 5IDQA 2J3HA 2EQAA 4FLFA 4UNSA 4AKEA 1MRSA 1J2UA 3IKMB 4W1QA 3BN3A 5IH7A 1YR6A 3MPOA 1Q83A 3V1YA 1QF9A 2ACWA 2B7CA 2OKGA 2RHTA 4LDQA 5G1OA 4ZI5A 3V8RA 1ZR4A 4B3XA 4J3FA 1FLVA 3I9V1 2DFTA 1BDBA 4TWJA 2P9QA 2XTNA 3D8RA 4KVAA 1E3IA 2GXQA 1W19A 4ER3A 4IO0A 4Q15A 1K68A 3FAKA 3JQGB 4Q3NA 1MX9A 3PQFA 1IUKA 3KTOA 3IP7A 4YMGA 4MOWA 3AVVA 2XYHA 4B76A 4YXFA 4DWVA 3LT0A 2I4RA 2XB2A 4XGKA 2OBLA 3B52X 4AM8A 5K0JA 2E0IA 2HIMA 4AF6A 3VO9A 1MNQA 4G36A 5ES4B 5LOVF 1UFRA 4KMMA 1XVUA 2GJAA 4J91A 3AL0C 1GRNA 2IH2A 1KDVA 2GPTA 3KR0A 4ETNA 4GG1A 3IAHA 2G7ZA 3E8XA 4OGKA 5K0LA 3S2ZA 2ATCA 3VZDA 1LDBA 5EPUA 5YASA 2Q5JA 3HMKA 3W2FA 1SB8A 2QTHA 4JN6B 1WVIA 3TLCA 1GA1A 3SC2A 3KLMX 2PVPA 4WJLA 1CV2A 1DNPA 1MXHA 3RTDA 3L49A 3RAGA 2GM4A 2EFHB 4R5HA 5IC4A 4GPIB 1E1KA 4QXQA 2PZ8A 4X9XA 1UEJA 2O2YA 1UDXA 4EG7A 3OFKA 1DDOA 3PU6A 1YMQA 1ELOA 4OHCA 4R1OA 1N3BA 3P20A 3HJFA 3O9ZA 1UOOA 4Z4HA 2I4TA 2XOKA 1PJAA 3R6LA 4P08A 5L51A 2R47A 2VPTA 3PCRB 4OIMA 2HBRA 4UW9A 3WDLA 4KVFA 3TD9A 1CY1A 4HGZA 5JJIA 1X7DA 1NXVA 4WVLA 3DEZA 5KDLA 1X80A 1AVTA 2LPMA 3FB4A 3VNVA 1S3GA 3PDWA 4KO4S 4WZAE 2HLDD 3F90A 4CKZA 1GKKA 1MABA 1ZEMA 1XMIA 2JGNA 4HLUA 4PLWA 2O14A 5FB3A 5IN5A 3E18A 3LQYA 4UZFA 3ZHQA 4JBLA 4H4DA 2YJZA 3K0HA 3MRVA 3CG4A 3NNSA 3LWNA 5KNBH 3N6VA 3H1PA 4OKSA 1JKFA 4PXSA 2QG6A 1W8IA 4HDQB 2PFSA 3VR2A 1PGPA 5A5GA 1VPVA 3CLTD 1OE0A 4X7BA 1YUBA 3C5WP 3DHYA 1L5ZA 3LW8A 1MO5A 1GL7A 4I8DA 1WU7A 4OAPA 4O2BF 4X5OA 1PZMA 4TT8A 1D04A 1W7AA 1E9EA 2CDCA 7REQB 1KR2A 2HBQA 2WWRA 1FW8A 4BKPA 3MT9A 1K9SA 4L50A 3QI7A 4H4CA 3H8VA 2O07A 2B6HA 2H7VA 3H8JA 4GYYA 1DAOA 1Q21A 2FQ1A 4KQWA 2DPLA 4MV6A 3O1HB 1XRSB 1XZNA 2JBWA 1H2FA 1E9RA 2GRJA 1GQSA 2D6FA 3EHEA 5JC1A 2O54A 1HH4A 4JLUA 2ZR8A 5C1IA 1XD8A 3Q6IA 2IIVA 3ZK7A 5DRYA 3WWYA 1MD9A 3T5BA 3HI6A 5ENDA 3DL2A 4WVFA 4ER5A 3S7TA 1NJ5A 1E1QD 1XL1A 3FX2A 3OE7A 3SC2B 5J4YA 3WLQA 5EYPA 4D46A 1ZD2P 2HV8A 4B3RB 2ZRMA 2G7MC 3F5SA 3A9SA 2PFGA 4I5GA 1YR8A 3L7CA 5BT9A 3PFNA 5LC1A 1YJAA 4PPYA 3ZQ6A 3V4PB 1CUXA 1WMFA 2PX2A 1KKLA 5KQPA 4AY3A 3OSUA 3DT6A 5FA8A 2XXBA 4YXWD 4MJLA 2JLVA 1GPH1 5IWAB 1QO0D 2SNIE 3HRKA 3MTJA 2WQZA 4HPXB 4I6JA 1BMDA 1E6LA 2W2MA 3RKSA 3I6ZA 3AHJA 5IVHA 1ZAYA 1FNMA 2HC9A 4IW3B 3ROZA 2EKBA 4UD6A 3H9CA 1EGMB 4FONA 5IJZA 2G0NA 3RRNA 1JECA 3GLUA 4V38A 3GZJA 3FG9A 3HLTA 5B53A 3BIWA 3CEPB 3I9NA 1RYBA 4BFLA 3MJ4A 4MIEA 4HT3B 1PNQA 2EG9A 1YIAA 4G5XA 1Z5GA 2R1VA 2NO9A 1WCWA 4H4EA 1XDWA 2CNWA 1T0HB 1X7XB 2BF4A 3LQ2A 4XVUA 5EHZA 3W9BA 4OU4A 2CD9A 4MZDA 2Z8YA 5HVNA 2YZ7A 2DTEA 1VECA 2QRJA 3BRCA 3IE2A 4I6EA 3STVA 4WV3A 4L74A 1Q0ZA 5CCXA 2D8AA 2VC2B 4QRIA 4RD1A 4TRJA 5G53C 2O8BA 3WMEA 3QV1A 1ZN8A 1ODSA 2GF7A 4LZPA 2OKCA 2QQFA 2WPNA 3BJEA 4GU5A 3NHRA 4KN9S 2E9SA 1X1TA 5GJVC 4R69A 4JP1A 2AC7A 3L7BA 2C7QA 3D4BA 4Z9FA 4EB8A 3QKUA 5AM1A 3RS7A 3W9YA 5AXBA 3GU3A 3WNQA 2VA9A 2I4IA 3CVYA 4HG2A 4JBNA 1ZM9A 1IXKA 4O2AB 4BMSA 4FBLA 1COZA 2EC5A 2I3ZA 2WIKA 5BPFA 5IAGA 3KAJA 4ZHQF 2RHMA 5D6YA 3UKJA 5A6VA 2JIRA 4ND2A 2FZWA 5GVRA 2R4TA 3OE4A 1RWPA 2X4LA 4IH4A 3SYLA 2BI7A 3CCBA 1MC5A 5EYPB 1J0DA 5HE8A 3CKKA 4J0IA 3WSTA 3OLZA 1GU7A 4LDAA 4LF7B 2Z4RA 1Z4QA 5KPDA 3ONEA 1UMKA 2Q2WA 3BFJA 3B8EA 4FMDB 3HYNA 4H0CA 4MQLA 3HVJA 3WB2A 2Z9DA 4LC1A 1MEEA 1ORVA 3EDRA 4OXNA 1WUKS 4QOIA 4AKIA 3KJIA 3N0XA 4RCZA 1P2BA 1VLZA 4J2HA 5ALDA 4RPJA 3OOEA 1CRPA 3RVSA 1JBEA 1M6EX 3WLIA 1AO0A 1SZDA 3EC1A 3NWOA 1OZFA 1RC1A 4FPXA 1W44A 1EZZA 3SMQA 4YDHB 3V33A 1PTJC 1CDOA 5JNRA 1CTQA 1VHJA 2R1VB 3UJHA 3UW3A 5MHTA 1J8YF 1WLYA 2BFAA 4XVCA 1RAGA 4RHTA 3B1FA 2AEEA 1XJCA 1JXAA 2O8NA 3O4GA 4FFNA 4MKGA 4C76A 4J0QA 2AKEA 1L3BA 1QGUB 2AD1A 3KWJA 2G04A 3E5NA 8ABPA 2FFBA 3G0GA 4M88A 1JQBA 2H7YA 2YJ3A 4M4SA 3WYAA 5FLKA 1G19A 2XWBF 3IT2A 3N2GB 3K4QA 1OXKB 4YMHA 1LJ8A 2FK8A 2VSQA 4D4LA 4E2ZA 2JV2A 4COOA 2C4VA 3R74A 5JZVA 3OLVA 2WPDD 3LUPA 2A5DA 5FORA 2ZUEA 1QE3A 5MN6A 1AZSC 4TYPA 3QPUA 3RJ5A 4MGKR 3GT4A 5HZKA 2WYUA 1ADCA 2XKBA 5C3MA 1L5MA 1NLYA 1E4EA 1VBMA 4HAZA 4JVLA 5E4FA 4DABA 2ODQA 3KQWA 1TAGA 2CWDA 1D2AA 5AOBA 2IT1A 1YCHA 3MUEA 3SQMA 2PEZA 3GWZA 5JSZA 3C5HA 4L0QA 4YMUA 3H5VA 3HXPA 3OE1A 4UNRA 2O3RA 3HJRA 2BIFA 2HUNA 3QKSB 4PZLA 3VPHA 1QVZA 5KNDD 3KQKA 4RJIA 3C3AA 3PDCA 4AIIA 4MV4A 3GUVA 1FP1D 2J31A 2Y27A 4UQPA 4FB5A 1PTJA 2HEGA 2R7AA 3OZCA 2E18A 1QOQB 1L7DA 2WJIA 3ZHRA 6NULA 5JC8A 3U3ZA 3KQUA 2VNAA 4DL9A 2ZS7A 1XTUA 3LQFA 3LHSA 1KFEB 4IHJB 4NP6A 1WBBA 1QDLB 1G3QA 2ATIA 3HKEA 3F3YA 2F3SA 3A32A 2H4FA 2AMLA 5DCUA 1XZCA 2PJUA 3FWZA 1BWSA 4KV9A 5FI0B 3KEOA 5EJ8A 2LD4A 3KXDA 1BHQ1 2FSSA 2HT6A 4KYVA 1TYCA 4UE3S 2FMKA 3A1EA 1PV2A 4OTZA 4UEOA 1CFJA 2C57A 3LQRA 3RU7A 1KPGA 4DLNA 1S6YA 2Q8QA 3OX1A 4FHZA 2BBWA 2WOOA 5JMOA 3FWPA 1OU0A 2GK7A 3MQFA 4L08A 4ZZ2A 2NPFA 1I01A 1RRFA 3EASA 3JYHA 3I09A 1Y7LA 2EGHA 1QUEA 2A9VA 1V8FA 3QGMA 3K73O 1QIGA 4ZGWA 1PGNA 2RK4A 3G9UA 4R2WA 3CO0S 3LGXA 4HDSB 1C4OA 2JGFA 4R41A 1UBKS 1U8UA 4PIPA 2ON6A 1C7FA 5LJIA 1IXSB 1RCFA 4PG7A 1W2HA 5F98A 5K0SA 4JT4A 2I4MA 4DIUA 5LDDC 2BGTA 4KE8A 4KO3S 1TU4A 3KKPA 4YP7A 1XFDA 2QX8A 3UA4A 5B1EA 5A3JA 1T0JB 3GRRA 2M2IA 3TTXA 5ESWA 2HXSA 2WWGA 1V7PC 2V54A 4M60A 4EKEA 1J8FA 5H3HA 1Y82A 1XDDA 2YHSA 1OFUX 2HU2A 3UJNA 3SC6A 1GOTA 1V71A 5ECGC 3ZCTA 2GZMA 4PG4A 5LKRA 2X6RA 3BFKA 2PGLA 4X0EA 2QY6A 2MM2A 4KLCA 4F3KA 4F9TA 4ZO6A 1OB5A 1OQAA 3PHBE 2LNDA 1QG2A 3P9NA 4MIOA 4F6RB 5IP5A 5AKKA 1AGXA 2G07A 3OOYA 5GQSA 2WG2A 2VYVA 3HKEB 3LCJA 2R8EA 2Q46A 2OHGA 2IYOA 4YGYA 1N1DA 3VPSA 5AW6A 1R18A 5E1OA 3VYVA 3JCZA 2X2PA 2ZWVA 3G85A 1JKIA 1G18A 2OWEA 2YWEA 4KAFA 4RDIA 3VPGA 4KI7A 1QB7A 4QEKA 3RVBA 4RKEA 4AJLA 3V1MA 4EHDA 2C3OA 3AHGA 4R2JA 4CW7A 3TQSA 1M83A 3FYSA 1H8HA 3VPFA 1WX1A 2XRFA 1SUFA 4E7OA 2F1RA 3EVFA 1TLTA 3GARA 1E0SA 2QMQA 4GVLA 3G9QA 3QBEA 4OJMX 4TKLA 1ZHHA 1JPVA 2VXOA 3HABA 1VLLA 4JH0A 1Z5PA 5F52A 3RASA 4BO5A 1NBWB 1V9LA 5LQAA 4AAYA 1JEEA 3RHSA 4O4LA 1XRLA 3BL6A 1YCGA 4BJ5A 4TMWA 4JNCA 1Q5PA 2EKZA 3AOEC 1YVRA 2D74A 2JJMA 3F1LA 4A0RA 4JHXA 4RE6A 4YEDA 4CLHA 1FZTA 3F5MA 1IYZA 3IHKA 3MB5A 2VWHA 2NACA 3EVNA 3O8DA 2AUMA 4JZYA 3ZQKA 3FR7A 3TVTA 1I3NA 3ICOA 3ZVRA 4AMZA 2NT4A 2X5XA 2XVAA 1ZCBA 4UU8A 5FNVF 4PYKA 4Q9LA 2DB3A 3GA5A 1H22A 4P58A 5FPSA 3SM3A 2VK8A 3EK2A 5DHPA 3GIWA 3RC8A 1C5KA 3MRSA 2PZEA 3K9QO 2JATA 3O4VA 1O3YA 3O8LA 3T54A 2FZLA 1C3LA 2M9MA 2DY0A 3H1EA 5F4ZA 5JS2A 3DF9A 1EAMA 3CY6A 3KRTA 1UANA 3GDOA 4TRNA 2PKCA 3TZQA 3U4HA 1QE0A 2GERA 2IQ5A 3G7UA 3KYDA 3PGVA 3PUVA 3WLFA 2F3RA 4F9FA 4NXNB 3JALB 1WR8A 4LBYA 2F9FA 4QGHA 3JAWA 4WBNA 5J9FA 3VSCA 5DHRA 4BS9A 4QHTA 3WL6A 1CZLA 4G2TA 2D4HA 3B89A 2WVAA 3QENA 3TOVA 4HNUA 4KAXA 1XJ5A 4ZREA 4F04A 1BTOA 3R5SA 3ROGA 3ZV6A 1Z0ZA 3FVWA 3LW7A 4CJXA 1XCBA 1Y48E 1NSYA 1UZAA 2GRUA 4KDRA 4DUPA 2GEJA 3AGQA 5ALFA 1JP7A 2GWRA 2OLEA 4FR5A 1MCZA 2EDAA 3GAFA 4NBNA 4C7XA 1EDDA 1F4PA 3HWWA 3L40A 3OTWA 1R6BX 4RGBA 3FNIA 3UWOA 1MORA 3OD1A 4Q37A 4Z7OB 2PT7A 1XTVA 2ASEA 4RJJA 4UUPA 4XQEA 2RFLA 3AOEA 3BFXA 2XGOA 4A0QA 4DR4B 1QYRA 4HF7A 4U9HS 1TXGA 1ND5A 1ZH2A 4WOJA 1LBHA 4K5QA 3LG2A 3OI7A 2FZCA 4O4LB 1RKBA 3S1AA 4QZVA 1USUA 4EY6A 1KY4A 3FZEA 1UEXC 1XD9A 3UWMA 3Q8XB 2NP6A 3VGJA 3BXEA 4DV0B 3QFFA 4QFBA 2CXQA 1WBDA 1J99A 1NW7A 2FGKA 4BNKA 3W4IA 2GGSA 5AKHA 4UOEA 1U80A 4EK9A 1QOZA 3FSGD 2AN9A 4N03A 4UFNA 4DLBA 2NPIA 1P7CA 4RM3A 4MAAA 1Q1EA 1V4BA 4EOGA 1Z6XA 3UXYA 5J2TB 2AI3A 2DUJA 5CW2A 1CJSA 1COWD 1XAJA 2OGWA 4A36A 3AU8A 1ZI9A 3IUSA 4PG5A 4M7RA 1EFUA 5ITVA 1XEWX 4GMGA 3V97A 5B37A 5F2NA 4HS9A 4OX9Y 2ZCVA 2P62A 1U0JA 1AO3A 3K1YA 4GZ6A 3W5IA 5IKOA 3MGGA 2ZI7A 2VJMA 4NBTA 4BNGA 1Q0TA 2Z83A 3HLYA 3NQ41 3NWEA 1D07A 1ESDA 1VE6A 2QM8A 3JAWB 1SUPA 1AUOA 13PKA 1EWQA 5DPMA 1JVSA 2QORA 2DBZA 4N82A 3ORYA 5LMZA 1YASA 5HRCA 4IOLA 2BCEA 4RA6A 4UEQA 3L07A 3CVWA 4X6UA 1CQIA 1PDWA 3JZMA 1DAEA 9MHTA 1OLSB 3ZLVA 3QQPA 1GDDA 2WZCA 4NEHB 1A2OA 2V9CA 3BOSA 4ROSA 4IIYA 2XNDD 5DSXA 1NUTA 2I5PO 3OQPA 5EKDA 4D7AA 1Z2AA 3B9PA 3OT1B 3Q72A 3OC6A 4AX4A 3GRKA 3ENNA 3L8YA 5FD8A 2XGGA 5C3UA 3MT0A 5GM2A 4I1PA 1R5NA 2P9EA 4GVXA 1NQOA 1ZCFA 3S4YA 2HT1A 5AVQA 2AZXA 3HVIA 2B0JA 3IIKA 4UVHA 1DXOA 4WXPA 4Y2YA 3MHTA 5K3EA 2J5XA 2QTRA 4PCVA 3KD3A 5JCPA 3T3NA 3QNMA 4EGJA 1JIVA 1LD3A 2EFJA 1E9FA 2TMGA 3GJYA 3H84A 4G5RA 5T6BA 5I8WA 1U6IA 3SHTA 4PO3X 3D7RA 1YQQA 3ETDA 4PBRA 3N39C 4JLVA 4G85A 2AA3A 3I0MA 3NTOA 2R8XA 4CI9A 1CF2O 2XRMA 4BX2A 1UBHS 2WM2A 4BFYA 3ZCUA 3QYJA 4W9MC 4HB4A 2JFZA 1NNLA 1G5IA 2GBIA 1E3QA 3O1JC 1YT5A 2ZAOA 3LC1O 2MSDB 3BBLA 2IS2A 4OHWA 2UYYA 5B3JC 3C4QA 4IMPA 4JCOA 2YZNA 1BQ4A 5LXTA 3EDYA 2M6KA 5MFPA 4C0XA 5MFZA 1PW5A 2IXAA 1LFDB 2VJMB 5BN4A 6CHYA 4QM7A 4CMIA 2QGZA 2QAJA 1LTQA 2JD2A 1RNLA 1R0ZA 3IPAA 4IH1A 4EUFA 3HI4A 3HV2A 4I8XA 4ANFA 3CNHA 5E6UB 3FH0A 3W6ZA 3ROEA 1ZOOA 5FP0A 3LHDA 1ZW1A 4PVDA 1CQIB 1TZCA 2PMKA 5JUWA 5C9ZA 4NX2A 4P86A 3W8RA 2NTNA 2EFEB 3MFYA 5DTQA 1PVDA 2P78A 1LSUA 4TT3A 2V7QA 2VHZA 1SHJA 1TT5A 4YB8A 2DBRA 2QMOA 3ZQ4A 1ZVJA 3G9TA 3U3OA 5FFFA 2DWUA 1NJSA 2CLOB 2X3YA 3JASA 3TDMA 1FDVA 2QT0A 3N76A 3WGJA 1AS2A 1BS9A 3D7SA 3GT7A 4GUDA 1IHXA 5AKJA 1B7GO 1SAYA 4J07A 2YWRA 4ZEXA 1QIHA 4QUDA 2LWIA 3CRW1 2UYGA 3PX7A 1F20A 1P5JA 5F9HA 1NUUA 2Z2JA 3DVAA 2IEDA 4ZQFA 1M8KA 5ARDA 3FMFA 3DQPA 4INOA 1U2EA 4L2IA 5CX4A 2YBDA 3ZWKA 2ZZMA 3GPCA 3LGSA 2O1EA 5KHOC 1NVDA 1DWQA 1NLFA 5E2BA 3PXEA 2WUVA 2X4DA 4W4TA 3RRBA 4Q48A 4QLBA 4R8VA 1KF0A 4XFKA 3H6KA 5B3JA 3TOZA 2APJA 2RONA 1LC3A 2E49A 2OC9A 4NCXA 2HQSA 4RK0A 4Y1EA 2ADOA 2MT9A 2AOVA 3JQBC 5K51A 3S7ZA 1RZ3A 2AFHB 4NDNE 2HF9A 2XLBA 5CGQB 2CSUA 3SGLA 1YS7A 4WZZA 2EGGA 3WC4A 4PSVA 2VSFA 1URPA 5K3AA 1PHRA 3R75A 2V0CA 5EJEA 2WVJA 4IOJA 2WIJA 4RQAA 5LXTB 4KK3A 2V55B 4UUMA 1HOTA 1DQSA 4RADA 2IPOA 3CKLA 3JWEA 3SZGA 1U0EA 2NU7B 1EUZA 5LQUA 3DWEX 2IS4A 1S4QA 2RHHA 4RKFA 2EZ9A 1HZZC 2AZTA 3V9AA 4DLPA 3OUZA 2FE1A 4DCJA 2ZIFA 1RU3A 3C3BA 4EO9A 1C7RA 3E2IA 5KDDA 4DC9A 3A06A 1ZK3A 1NKVA 3AY0A 5DW0A 5BORA 5DNDA 4TTQA 4LMRA 4R2HA 3DVLA 1F8FA 3GPBA 2ONCA 3B3QA 1VL0A 3MMZA 4QJBA 3RJMA 3SHWA 3OEWA 1K4YA 2IEAA 2NTEA 2OHVA 2GSDA 1QS0B 1TT5B 1WO8A 4BMXA 3UT0A 5JRDS 1NY5A 2HY7A 3GGDA 1GTVA 3I6IA 2E4WA 3L6EA 2K87A 3JASB 4L5BA 4WOPA 1G60A 2F8SA 1HA3A 5K8IA 3A2MA 3RIGA 1GADO 2OAEA 3CG0A 4L76A 5IH3A 4C0HA 2IIBA 3TGPA 3SC3A 4D9CA 4KMRA 1HMYA 4AIRA 5KOHB 4FCTA 1CPYA 3UV6A 1A8PA 1VLHA 3OZ7A 4EG0A 5FL3A 1JYEA 1WZUA 3IBGA 3M81A 4UM8B 1XZDA 3AW8A 4KMOA 4NENA 3JQBA 4KQ9A 1H23A 1P2TA 3OOJA 2A78A 3AWIA 3ZWNA 5D00A 1KMQA 3FHCB 2NTVA 3EAFA 3F73A 4DR2B 4HDNA 2RI1A 4LDPA 4B3MB 2IPLA 1Q20A 1M72A 1NKSA 4MRMA 1SCBA 3KBBA 4YN3A 2J5BA 4E32A 4M54A 1GSOA 1IQUA 4JJIA 3FHJA 4MEAA 4LF4B 1SWVA 3AEXA 3FFTA 5FWNA 1HL7A 1V2HE 2PQ0A 2WM3A 3N8HA 2IELA 4LYHA 1HZZA 4DDTA 5EPEA 4BFVA 3KOMA 3HUUA 1EFRA 4I7EA 4AJ9A 5AW4A 5JSQA 5AFSA 2ZE5A 3VI4B 3CVOA 3M1IA 4H35A 2IH5A 3WMGA 1YVPA 4IUBS 5EC8A 2PKYX 3I0ZA 4QTUB 3NV9A 1O8BA 1JNYA 2CLCX 1GKUB 4BLOA 4KJZA 3UBTA 1XMXA 3O8NA 4ECEA 4K0RA 1NOIA 5CGZA 1MV5A 1RSZA 2JG3A 4GW3A 4K6FA 1RYDA 4B2PA 1RWNA 4CKWB 2W6ID 3T7AA 4KKXB 3CBQA 4EY8A 3IR7A 3RFTA 3ZV4A 4YCLA 1WXHA 4AICA 8GPBA 1QV9A 5MF6A 1Z17A 3LYUA 3NHLA 1MJHA 4ZYVA 1Z26A 4QA9A 1GQOA 1YA8A 1AKWA 1DO0A 4LDZA 5GONF 4CTMA 2LXNA 4DW8A 2O8DA 3HBNA 3ENVA 2QX6A 1CWUA 2DH6A 3U4IA 1LPPA 2QRNA 1G2OA 2RKOA 4L28A 3SX0A 3MBIA 1A9ZA 4B84A 4H3HB 1G5QA 1ZGCA 2KSQA 3EVAA 2OYCA 5D2CA 4HEQA 5A7GA 1YBMA 1MB2A 1PNRA 4EI9A 4GD3Q 3AW9A 2OUKA 3T7SA 5LQJA 3D0OA 4LECA 2MINB 3KKOA 4BNNA 4C2TA 1S9HA 1Y7PA 5CXXA 4X97A 4YRGA 4GKAA 3P27A 4P98A 3ECCA 5KEIA 5D3MA 5K01A 3CW2A 1QU2A 4JEUA 2IKSA 5DIZA 3BGWA 5JYBA 1A9QA 1XP8A 1OH6A 1LPNA 4HDNB 5F76A 3VUFA 1C9KA 1UK7A 3THXA 2DWCA 2XMDA 2CJXA 1E6EA 2P79A 2P40A 2NSHA 4MRMB 2GF2A 3RD5A 4B6EA 4B71A 4CQMA 4AO8A 2JIBA 1LPBB 1JRLA 3QXHA 2H9AA 3QVWA 3R0QA 5CNKA 5KNCA 4RIGA 2QLNA 4MRRA 1OZ0A 2QD3A 3T1NA 1BRMA 5EZQA 1WTCA 4GWGA 1JEOA 2PDAA 5IX8A 1P9OA 4U3JB 5FOSA 3NONA 1ABEA 1X7ZA 3P7MA 4FGJA 1KVQA 4DG8A 5HIKA 1KFCB 3UUEA 1WCXA 4FFWA 4RVOA 1X15A 1WKCA 3T7KA 3RVJA 1RYYA 1PTKA 2VFAA 4R2IA 2V58A 4B47A 1X92A 4Z3KA 2PQ6A