5CD1A

Structure of an asymmetric tetramer of human trna m1a58 methyltransferase in a complex with sah and trna3lys
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
288
structure length
281
Chain Sequence
b'SFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
molecule tags Transferase/rna
source organism Homo sapiens
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
total genus 57
structure length 281
sequence length 288
chains with identical sequence D
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5cd1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5cd1A02
3E7PA 4GUAA 5CCXA 3FTDA 3BZBA 1RJDA 5HFJA 5HOQA 3P9NA 4PYNA 2CKDA 3DXYA 4R8RA 5FHQA 4RTOA 2BR5A 1RJEA 4QPNA 2PGXA 4KDRA 2XYRA 1MJFA 1QAOA 3OFJA 4DKJA 3CKKA 5IH3A 4AZTA 1FPQA 1RI3A 2O0LA 3FPJA 5CUQA 3TLJA 5E9QA 2PV0A 2OXTA 5DM4A 4C4AA 4YV1A 3BWBA 3LECA 3T7SA 2P3OA 4GOND 1Q0SA 2IGTA 5CVJA 4Y30A 4QPPA 4YUYA 3EGEA 4F84A 4RTMA 1IY9A 1XDSA 3HVIA 3AXSA 3BWYA 3HM2A 4DQ0A 2OBFA 4QQNA 1YF3A 3DXZA 4X60A 4EVIA 3BGVA 3I58A 3NJRA 4PGHA 3FPEA 4QVKA 4EK9A 1P39A 5EQJB 3JWJA 2AOTA 2KW5A 4EKGA 3EGVA 3FUVA 9MHTA 2Z6QA 5K0EA 1X1CA 3T0IA 3HCEA 1UIRA 4BLUA 2OB1A 3B7PA 3PX3A 5EEGA 5CD1A 5FUBA 1WXWA 2H11A 2EFJA 4PYIA 3Q7EA 1EJ6A 4GC9A 3C6MA 2ZBRA 5DWQA 2UYHA 3LSTA 5HIJA 1Z3CA 4BP1A 3BWMA 1RI4A 1VL5A 3NDJA 1INLA 2PXXA 4XUEA 4AUKA 2AOUB 2BM8A 1KPIA 4R6WA 2E5WA 2VS1A 1Y8CA 5EMKA 5C0OE 4YMHA 3I9FA 3QOWA 4F86A 4GOOD 5LQKA 3GRUA 1VP3A 5K0LA 5DTQA 2BZGA 3HA5A 5FWDA 3P71T 2O06A 3FRHA 3TM4A 3MERA 5K05A 3X0DA 3E05A 2B78A 1QYRA 2HTEA 2YXDA 2AZTA 4KWCA 1KYZA 3UJBA 5BP7A 4RTQA 5ICCA 5KQSA 3M70A 1YFLA 5E9WA 1VE3A 4MWZA 2ZCJA 2GH1A 4FS8A 4OA5A 1IM8A 3PFGA 4L7VA 5EMMA 2O57A 3PVCA 4DCMA 3EMDA 2AN3A 5EHGA 2HNKA 3TKAA 3UJ7A 3MB5A 3SMQA 3I5UA 4ER3A 2GAFA 3KHKA 5G02A 1ZQ9A 5DXAA 1X1AA 3O31A 2NNWB 4E2YA 2P7IA 3AJDA 3C0KA 1VLMA 3BXOA 5LQCA 4UOEA 5E1OA 4PNEA 2IBSA 2I6GA 2VZ9A 4E31A 3KPJA 1X1DA 2XBMA 2R6ZA 3B3FA 2ZFUA 3ELWA 2PVCA 3DMHA 3M6VA 3MTEA 4CTKA 3VC1A 2HWKA 5HILA 3UJ6A 3FPGA 3TRKA 2PWYA 2O07A 4DZRA 1JSXA 2IDJA 3VC2A 2NP6A 3EEYA 2QYOA 4CXMA 2G71A 4O29A 2B3TA 4P7JA 1BOOA 4KDCA 2AOTB 3SSOA 4WVLA 5FA5A 2FYTA 2I62A 2QE6A 1P1CA 1XTPA 2OPBA 3LCCA 3V8VA 1I9GA 1L1EA 3EVCA 3KPVA 3G8AA 4PGGA 2FPOA 2OZVA 1UFKA 4Y2HA 5GP1A 7MHTA 5DLYA 4GC5A 3T7TA 4MQ4A 1G38A 2IP2A 3D2LA 3OU2A 3M6UA 4PYKA 3OU6A 3FPFA 4E2ZA 3EVAA 3LDUA 3KPYA 4HH4A 3UJDA 1MHTA 2AOWA 1B42A 5C9ZA 4DCGA 1XCLA 3THSA 3DULA 1OR8A 2NYUA 5DM2A 1KYWA 3GRRA 3EVGA 2GPYA 4PYJA 3A27A 3LCUA 4R6XA 3SM3A 1XDZA 3NW9A 3C3PA 4FT4A 3ORHA 2PKWA 1RJGA 1UWVA 2EX4A 3LCVB 1I1NA 3GXOA 2ADMA 2ZSUA 2ZZKA 3KR9A 3LBFA 4RSRA 5DM1A 4BLWA 2PX5A 3PTAA 5E1MA 5C1IA 5EMJA 3THRA 4X61A 5K0BA 5K01A 2B9EA 2Z6AA 2IDKA 4IWNA 3WSTA 3HCCA 1G60A 3QOXA 3P2IA 3R0QA 4RTRA 3ELUA 2IPXA 3C6KA 3MHTA 5P8WA 3F4KA 3UA4A 4RVFA 3HVJA 4RVGA 2AVDA 2XVAA 3IHTA 5D1NA 3TOSA 2ZZNA 5EKXA 3AWIA 3KR0A 4DMGA 3B3GA 5FQNA 2PXCA 3MCZA 2H00A 5E9JA 1XCJA 2PT6A 5E2BA 2VDVE 5LQAA 3DUWA 4YUZA 3P8ZA 3E8SA 2AR0A 5GWXA 3UWPA 1KPGA 5E8RA 5BXYA 1WY7A 2NXCA 4BY9E 3Q87B 4HRAA 1N7JA 1NW5A 4OX9Y 2ZLBA 4YV2A 2PLWA 3OE5A 3L8DA 1EG2A 4GQBA 2Y1XA 2K4MA 5DTRA 4IV0A 4CKEA 2FK8A 1JQEA 2OY0A 4LWOA 4C08A 2C7QA 1WZNA 2P7HA 4PONA 4R8SA 4PYOA 3K0BA 4FGZA 5FCDA 5U4XA 5ICEA 4DM3A 2OYRA 3FUTA 1SUIA 4C03A 3KQVA 2PJDA 3EEOA 2JG3A 3SXJA 1NBIA 3G5LA 3TQSA 1SUSA 3AY0A 2ZBQA 4F85A 3PT9A 5EMLA 4BP3A 2BM9A 2JH8A 1L3CA 3DLCA 3SGLA 3REOA 3RW9A 4PYLA 5F2NA 2HV9A 3OZSA 1AQIA 5EGSA 5K8VA 2CMHA 2PXAA 2CWWA 4GEKA 1XXLA 3U81A 1ZG3A 4G56A 1RI2A 1U2ZA 2CL5A 2R3SA 3H2BA 3PB3A 3LDGA 4M36A 4MTLA 2GS9A 4PYQA 4C06A 1O9GA 3C3YA 2AS0A 2ZWVA 1VQ1A 3EVDA 4GOLD 1DL5A 3UJ8A 2XVMA 1N2XA 2YVLA 2ZZMA 3LDFA 3UA3A 4A6DA 3OCJA 2YR0A 3HP7A 4QTUB 3HCFA 5EZSA 3NDIA 1FBNA 3DP7A 1QANA 4LG1A 3FYCA 4X63A 4HSGA 1NW3A 3UBTA 1WS6A 4KRGA 2IH5A 1KXZA 2FRXA 4C04A 1R8XA 5T6BA 1P91A 5GINE 4ER6A 3G8BA 4PWYA 4FT2A 3EVFA 1JG3A 2QRVA 5CVDA 4MHTA 5EZQA 1AQJA 1RJFA 3HCDA 4AX8A 5EG5A 5K0JA 3G88A 3LHDA 2QM3A 2JJQA 5EC8A 3CJQA 4LECA 1H1DA 1HMYA 4OA8A 5ICFA 3V97A 2PX4A 3RODA 4RTNA 3LL7A 3PX2A 5D1HA 5KYGA 3ER9A 3JWHA 5K03A 1QAQA 2B25A 4PCLA 2P3LA 4AZVA 3EVBA 2AN5A 3SSNA 5HEKA 2G72A 1R00A 1L3IA 2ZULA 3TKYA 3LKZA 3OZRA 5HZMA 4YUVA 2PX8A 3GCZA 4QDJA 1X19A 5EIFA 3KQSA 3FTCA 1O54A 1NKVA 2YXLA 3BGDA 4YUXA 4HTFA 3GWZA 4POOA 1EQAA 4KIGA 4E33A 2PX2A 2CMGA 3CJTA 3UJCA 3PLAE 4CKCA 1BKYA 2JH9A 3DR5A 3DTNA 2C7PA 3HA3A 4CKBA 3NMUF 2BR4A 4RWZA 2EG5A 5EPEA 1NV9A 4ER7A 5M5BA 3G2PA 3ID6C 1D2HA 5DSXA 5LQJA 1PJZA 3DLIA 5ERGB 3QV2A 4KIFA 2ZIFA 2IFTA 5DT2A 2H1RA 4MIKA 3SVZA 3E23A 3R3HA 4R05A 5HIIA 1AF7A 3M4XA 5HIKA 1ZHFA 2PWPA 1TW3A 2G8NA 3MCTA 3MQ2A 4P58A 5LQNA 2IH4A 4AZSA 3NTVA 3CCFA 5DXJA 3KKZA 4PYMA 4XUCA 1R74A 5GM2A 5FQOA 5K0CA 1WXXA 4PCAA 2BR3A 2Y1WA 5GM1A 4FSDA 4WXHA 4XUDA 3GIWA 3EGIA 2IIPA 1BHJA 3HNRA 3LBYA 4GF5A 4GOMD 4RYLA 5JUWA 5K0FA 1AV6A 1SQGA 4U7TB 1JTFA 5LSAA 1V39A 3G7UA 3B5IA 1VP9A 2ZW9A 1JQ3A 4RVDA 1DUSA 4RTPA 2GA9A 3EVEA 3DOUA 1QAMA 3M6WA 2C7OA 3R6TA 3FRIA 2IBTA 1ZGAA 1F3LA 3FYDA 3GRVA 1I4WA 3FPHA 2XYQA 5BW5A 5CIYA 4JXJA 5CVEA 1KPHA 3KQQA 3R9XB 2AVNA 3OZTA 2ONYA 1NW6A 3P97A 3R24A 2N47A 4BLVA 1KP9A 3MTIA 4QTTB 5FWAA 4C07A 3GJYA 1NE2A 3TFWA 5GIPE 1D2GA 3DXXA 3NWBA 4RV9A 3KQOA 5CVVA 4X41A 1O9HA 1RI5A 3LKDA 3FZGA 4HGYA 4OBWA 2UZ4A 1YFJA 1G55A 3VSEA 1R8YA 4QVGA 2HR1A 1L9KA 1DCTA 5FA8A 1EIZA 3RIEA 3KQWA 3KQYA 3ME5A 3KPWA 2PT9A 3DMFA 3GDHA 2P8JA 1XVAA 4ZTBA 2AOVA 1NV8A 3HVKA 3ERCA 3OU7A 2OB2A 3KR1A 1YB2A 1ORHA 5FADA 1VPTA 3P2KA 2WA1A 3M33A 4DA4A 2WK1A 3MAGA 2AN4A 2JHPA 2XYVA 2P35A 2NXNA 4OBXA 4C05A 2GB4A 4RVHA 2FCAA 1Q0TA 5KVAA 5F2OA 1JG1A 5EIWA 3FTFA 3NVMB 5JR3A 3ER8A 3P9KA 2AOUA 4PIMA 10MHA 1L3BA 2ERCA 2QRVB 1JG4A 3IEIA 4ATNA 3GNLA 2ZBPA 2VDWA 3CC8A 3KU1A 4U7PB 5DX8A 5H02A 5GIOE 1VIDA 3NVKI 4PIPA 2ONZA 4XCXA 1SVUA 3M6XA 5K0GA 2IH2A 3SSMA 2G1PA 1PRYA 2FK7A 1FJXA 5LQUA 4M37A 2YUIA 4ER5A 5EKUA 2NP7A 2P1DA 5CVUA 1EJ0A 3TMAA 3G89A 3ELDA 4NECA 1D2CA 3FUWA 2I9KA 1JG2A 1SQFA 3CJRA 1G8AA 4FP9A 5DM0A 3A26A 4HC4A 5DRTA 1NT2A 5CM2Z 1P1BA 4HGZA 3ANXA 4YUWA 5DRYA 4Z2YA 4A6EA 3UZUA 4QDKA 1EAMA 3G5TA 1YZ3A 2ZWAA 1XDUA 5EHIA 4M38A 4E70A 1VBFA 3LPMA 5DTMA 1JQDA 3GO4A 2YTZA 3GGDA 3K6RA 4P7FA 2UYCA 2P3QA 3O7WA 2G70A 1KHHA 3A7EA 2B2CA 4CTJA 2VP3A 5EEHA 1TPYA 1FP1D 4RTSA 1NW8A 5FTWA 1BC5A 3I64A 4OQEA 4EKIA 3BUSA 4FZVA 3KPUA 2PSSA 2UYQA 2AOXA 2ZIEA 2JHCA 5MHTA 4FSXA 3B3JA 4HG2A 1N7IA 2VDUE 3G2MA 3IYLW 3NWEA 5BW4A 3G2OA 4LWPA 3A7DA 3FUXA 3KQMA 2QY6A 5DPMA 3P9CA 4IV8A 3TM5A 5E2AA 3B89A 3O4FA 4KVZA 1HNNA 4P7GA 3KQTA 3FUUA 3IV6A 3LX6A 5T64A 3A4TA 5IKMA 2P40A 2PY6A 5E1DA 3MGGA 3HA7A 3SX0A 3BKXA 3FTEA 1XJ5A 4B17A 2EJTA 2DPMA 1JR4A 2ZIGA 3I53A 3S68A 4ER0A 3VYWA 3TPZA 1T43A 1M6YA 1M6EX 4DF3A 4P7KA 1F38A 5FHRA 2ESRA 5B1SA 3EVZA 5E1BA 2GLUA 5EOVA 2EJUA 3KR2A 4E2WA 4EQZA 1KR5A 4OQDA 1G6Q1 5E8JA 1SG9A 3CVOA 1YZHA 2O05A 2YXEA 1ZGJA 4YV0A 3BT7A 4GBED 3HTXA 3PS9A 3BKWA 4ISCA 2PBFA 3KQPA 4YMGA 1WG8A 2YQZA 3OE4A 2OO3A 3SR4A 2FHPA 4V0RA 3HVHA 2C7RA 3HCBA 3G2QA 4AZWA 3GU3A 1QZZA 2LD4A 4RTJA 4X1OA 3BGIA 2BH2A 1FP2A 3GRZA 2OKCA 8MHTA 2NXJA 4QQKA 5DSTA 4KW7A 2V74B 1NBHA 1YUBA 2HMYB 5LQRA 4K6MA 2JHAA 4H0NA 3T7RA 4HTFB 3UJ9A 3EPPA 5DX0A 1M0EA 1X1BA 1R18A 3DMGA 4M7RA 4RTLA 4CWAA 2DULA 3EMBA 3LGAA 3CBGA 2NXEA 3DH0A 2UYOA 3P2EA 5FULA 5F2KA 2Q41A 2I7CA 5DX1A 3TR6A 4E32A 1SKMA 2A14A 3P9IA 2Z6UA 4RX1A 4EMSA 1KIAA 4V0QA 5GOZA 5KS2A 1JSZA 3ELYA 4IKPA 4E30A 1ORIA 4PINA 1TW2A 2WA2A 3A25A 3HCAA 3OFKA 3OPNA 3PFHA 5EVJA 3UJAA 3AXTA 5K0NA 3CGGA 5LR6A 1RI1A 2YX1A 5KQRA 2ORED 2V7EA 5CCBA 5ICGA 3HEMA 5K09A 3BWCA 1JTEA 4RTKA 1IXKA 3JWGA 3JWIA 5T67A 1ZKDA 2P41A 4E2XA 2ZTHA 1NW7A 2ZVJA 1G8SA 2F8LA 4FR0A 3UFBA 5HIMA 3GRYA 1R6AA
chains in the Genus database with same CATH superfamily
1IUNA 1RQGA 2I4LA 2CK3A 4EW3A 3CVXA 5DNUA 4H1HA 1GPMA 3RUCA 2H2AA 3H9GA 3PFIA 1TCAA 4D9BA 5I4BA 3FOAA 2G09A 2JLSA 2QAGA 1RZRA 5L3SA 2OE2A 1POXA 4OOEA 4TKVB 1VL8A 4IMJB 1JLLA 1MJFA 3OFJA 1AY0A 3OJCA 4LV8B 3NT4A 3WDLA 1NJGA 1D8TA 2BL4A 2PMBA 3FPJA 1P4RA 3AR4A 2XMQA 4FUTA 3AY7A 1C30A 3BD8A 4IV5A 4M1SA 4WZAA 5FEMA 1IH8A 1LWNA 2ORVA 3U4MA 1YGYA 1IY9A 2VYNA 3HVIA 4MB6A 3RROA 3TAXA 3OTQA 4ZXFA 1W9MA 5TQVA 3A1FA 4FGKA 3CONA 3F9RA 3RSOA 3EQZA 3MUNA 4RCYA 2GR9A 2MM0A 1TF5A 4MAMA 1SXQA 3V48A 1X7YB 5DCWA 4UXIA 3AERA 4HEHA 3EGVA 3FUVA 2FQWA 1XC7A 2L69A 4UARA 4YNBA 1E3MA 3T0IA 3A6FA 1XX6A 2F90A 4P8RA 1P74A 3ZY4A 4OU5A 1ZK4A 5TQ2B 4QVIA 3IUBA 3EGWA 4P35A 1EJ6A 3QE3A 3G17A 1F2TA 4CLRB 4JYAB 3ZHVA 1G6OA 1WPRA 3LSTA 3FPSA 4YI5A 1ODCA 5HIJA 1AH2A 1B8VA 2H1LA 2R6AA 3FJOA 2JGMA 5IDXA 3GDGA 1NBWB 5CFQA 1WO8A 3CVWA 4UKDA 2D06A 5FNZA 3U7FB 5KEIA 2OA0A 1L7EA 2DBZA 5E6RA 2ACKA 2HA5A 2XYHA 2JI7A 4WXMA 4KDLA 3OT4A 2X58A 4ME6A 3SC4A 4ETMA 1HDXA 3V32A 4ZICA 4FOLA 1EWQA 3K0CC 1BFDA 4TN1A 3OEEA 1G7SA 4YDQA 5JS2A 1ISHA 2BH9A 4IWXA 4Z0PA 5A7GA 4P31A 4FEGA 4HDRA 4Y6RA 3PGLA 3VOAA 3FWHA 1QZUA 1PJRA 2PGAA 1SQSA 3GHHA 2HWXA 3PVSA 4NCXA 3PFGA 3T99A 4X65B 6ABPA 1FW6A 1KJ8A 2PWZA 4I2NA 1FNBA 3H7IA 2VTKA 3EXFB 4J3JA 4NAUA 4YMUA 3I5UA 2DTDA 1WZEA 4L5YA 2J5QA 2Y1OA 1U5AA 4OQQA 1I80A 2O54A 4HGPA 4L4UA 1KJ9A 1NXXA 1W581 3K3PA 1PEKE 2EDCA 5KJ1A 4OQLA 4O2AA 2FETA 2I67A 3TJRA 5F2EA 1GA1A 2C61A 3G0CA 5DLQC 4N0QA 4N9WA 5FFFA 3ZZTA 2Q0XA 3RASA 2C54A 2HT6A 3M1LA 5CX1B 1Y7HA 5KTSA 2VAMA 1JDJA 5AUQA 1A9RA 3A6KA 1ELOA 3CCCA 5KTRA 3EC1A 3EHDA 3T9CA 1Q0PA 2EL9A 5KYUA 4NAVA 1QR6A 3DWEX 1NNLA 2JFYA 4IGKA 4XARA 1OLXA 1XZEA 4BFUA 4WAUA 5EWMA 4GPAA 1KMHA 4AP5A 2GT1A 4EGFA 4CXMA 1BOOA 4BPBA 5H5JA 2BFCB 3S27A 4DREA 3WMGA 3TIXB 4DNQA 4M87A 2CD7A 2WFAA 3LCCA 4PU0A 3QXSA 1NSFA 3G5AA 4HP8A 1V11A 3HBMA 5ALVA 1R7RA 5HGJA 4CI9A 4PGGA 4YASA 3W77A 3ZGZA 2OZVA 2VHVA 1UK8A 3LUBA 5DLYA 1MNAA 1VBKA 2AKYA 3ZXIA 4MS3B 2CYCA 2C2ZA 4EI7A 4RV0A 2HSDA 4EJMA 3DONA 1UJ4A 4J16C 1JA9A 1LI5A 1TEVA 3FNBA 1QHFA 5DSZA 5DM2A 1Z2DA 2GD0A 1Z8NA 2FSHA 3GPDG 1AK9A 1LDEA 3O3CA 4PYJA 1X74A 2FPPA 4Q19A 2VQFB 1DOZA 1EGAA 5JWHA 4AKGA 1U90A 1U8YA 3QJGA 4C6TA 1RE0A 1X15A 2E4AA 1VCOA 1T29A 5DM1A 3TCNA 4ZCRA 5EHZA 3MYYA 4NATA 1ICIA 1K7SN 3BSWA 3CEHA 4IIBA 4CEJA 1FJ2A 1GG9A 1S8NA 2WMOB 2YS7A 3FYTA 3G9TA 3ZXUB 3WXBA 2D7DA 1P0FA 3G0IA 2HKIA 1WUKS 4Q1DA 4YECA 3LQYA 4ND3A 3TPCA 1W0KD 1X7XA 4HQLA 5C1OA 3U7EB 4IMPA 4X93A 2QWXA 3UNXA 4G5RA 1Z0SA 4IQFA 2VDPB 1CUIA 4R83A 5DWVA 3WJ7A 1UPBA 3C48A 5IAKA 1D2EA 3PQ3A 4YMGA 3FXAA 3L7DA 3WZLA 4AROA 4J29A 4DXHA 5BWLA 5BY2A 3X1ZA 2C20A 3LDHA 1XKTA 3B8HA 1T10A 4P3XA 5DCLA 1YTUA 3Q87B 3BJZA 1ZAYA 3RS2A 1C7FA 2O3TA 3T34A 4X1IA 1E0KA 1RP1A 2O6HA 1FK8A 2VC2B 3ZDCA 3DBRB 1QWOA 5LM3A 4Q1EA 2W6QA 1NLUA 4C08A 2AMYA 1SNYA 4OMUA 5BV1A 1SPBS 4FHFA 3GJSA 2VPQA 2YJNA 1ZY2A 3OFNA 4GKAA 5JS7A 1Y6GA 4B75A 4BX2A 1NBIA 1VSQA 2WWFA 3IMKA 2PX0A 1M8KA 4O02B 1PTJC 3AF6A 3P4YA 2VBFA 1UOPA 1YA8A 1QIMA 1W88A 2XOEA 5I9TA 5DKFA 3KWJA 3ZWXA 4A8JA 2GCOB 3AP1A 1DTEA 5E0OA 4XM2A 1RYBA 4FX5A 1ZNYA 4NXMB 2ZIVB 2CW5A 1DEOA 1N3BA 1XD2B 2P5SA 2WJPA 3GP5A 4HB0A 4AULA 1N5LA 1JBQA 2A58A 1KZ4A 1VIMA 2HBQA 1V4BA 2H65A 2HXSA 2UZ0A 4QYTA 1P7CA 1ZH0A 5NULA 3W2HA 3ZDDA 3OZWA 2PUDA 4UUQA 4DV7B 3AJAA 3PJDA 5EQDA 4OMCA 1V5FA 4QFDA 4MUFA 2IOFK 5AKJA 3V7FA 4TKMA 4OXNA 1JI0A 2A84A 1XALA 2AE2A 1SUAA 1OFGA 1CY2A 3DKKA 2JRCA 3MJCA 1U9ZA 2Y1FA 4O08A 4MULA 5EZSA 4EW2A 5I9NA 1EXVA 1I30A 1II0A 4KH1A 3ORSA 2RHMA 2GZ1A 2WMNB 1GQ2A 1PBNA 2B1GA 2VSFA 1TUBA 5EPPA 1J23A 4X54A 2V7QA 1QCZA 4F93B 2ZI9A 4TKZA 3VVCA 1P61B 3NB0A 3PRHA 1PWYE 1KKLA 1Z4LA 4D4HA 3TDMA 3W5SA 3OTOB 4RIGA 2NWQA 1N9ZA 1M8GA 1MP0A 4TXJA 3H9EO 1OSNA 1Q95A 3RAFC 1SKYE 3LHDA 3MA0A 3AM3A 3VR4D 3ENKA 1FDRA 3NWJA 4GFDA 3V4ZA 1Y3CE 2BBSA 1A8SA 4G0YA 4FMBB 1GGHA 1SHKA 3TB4A 5HZMA 1L5FA 1R00A 3I83A 3IIIA 5GMOA 4C0QC 2ZYVX 2PX8A 2BEUA 2C4KA 4M0UA 3SS7X 1QH8A 1X80A 2XCUA 1ARZA 3FYHA 4TWZA 5JTTA 1RAAA 3L6OO 3HYCA 2JGAA 1Z5WA 5JY6A 1J21A 2BFFA 3UIEA 2VZ0A 2X5NA 4M21A 1L5YA 1RWWA 3HA3A 4FQ5A 4DMRA 2IZ6A 2P2LA 4QUBA 1UMBB 4UFPA 3ZCRA 2D2FA 2CNLA 4P2GA 4B2PA 1R4AA 2VVTA 2MJLA 4IXDA 3PHHA 4DCTA 3GQBB 1Y3HA 3T4PA 4EHIA 3R3HA 5HKKA 2DXIA 3MZ0A 1QYCA 3CFYA 4AJ4A 3FPAA 4GSYA 4JKIA 1Z6ZA 1GVNB 4GKKB 3WP0A 1U6KA 1UFVA 3L6DA 3ORFA 4XW2A 3TXXA 4HWPA 4LZJA 4WBXC 1ZCZA 1I36A 1KU6A 2PKQP 3BIWA 3COSA 2XUKA 1JIKA 4WZ6A 1COWD 1EINA 4AN0A 3AKEA 2JIQA 3QE0A 4Q9KA 5BUSA 1M0TA 5K0FA 3U7GA 1AV6A 4YJKA 3AB3A 1ESEA 2UU9B 1ES9A 5B53A 5AUOB 1ZEMA 4CT4B 3DLAA 2ZW9A 2DR2A 2IDMA 3EXHA 1ZCBA 1P4JA 2BHNA 3HHPA 3GRVA 1WZIA 4WIAA 3UPUA 4BKMA 3B51X 4LRQA 4JXJA 4JBWA 1W49A 1M1NA 4LDAA 1NNI1 3C6ZA 1DKPA 4JT4A 2OZPA 1FX0A 3OFVA 3OLZA 5KREA 4KR6A 1CUSA 1LH0A 2GDJA 4M1WA 4MLCA 4N3CA 3QA9A 1KY5A 1L7VC 4L0QA 3T06B 3TFWA 1JPUA 4DNOA 1U9CA 4E5VA 5F7XA 3KQOA 3MC1A 2I7VA 4WX2B 1CG6A 3C1UA 3OT1B 3VJKA 2EC5A 4ZCMA 3U4QB 1SVSA 2R7LA 2V58A 3BTOA 2HH9A 4B80A 2LCFA 4BZZA 3LUKA 5DLEA 5B4VA 1DCTA 3KQYA 4ZTZB 5DN9A 1QHEA 3BXEA 2IS1A 2QBYB 3ERCA 2QLTA 1I5EA 2DUNA 5MGNA 1H3EA 4AJJA 2O8CB 1AUVA 2I3DA 2KM1A 1BHQ1 3CIFA 3UEOA 5L3ZA 4WBNF 3BEDA 4CF7A 1XNGA 2H7XA 2Z4TA 4B8YA 3G2HA 1XZFA 4FW8A 3T9AA 2GB4A 1U11A 1NFFA 1U6IA 3CQ9A 1COZA 1U3CA 2O3JA 2XDQB 4KE6A 3I05A 4M98A 3RSGA 4ZO9A 3ER8A 5LB4A 4IM7A 2DQKA 3K6JA 2D5BA 1Y4AE 4IDDA 3UUFA 3C6YA 4OEHA 2Y0PA 5TVKA 1IBLB 4X20A 5E9AA 4U2FA 1XZCA 1W87A 2QRUA 3P9RA 3WKEA 3VDRA 2DEUA 5ALXA 1TJ4A 3D4PA 3TZQA 2AFHE 5EKUA 3E61A 1QRRA 3OM8A 4J0EA 1AQ6A 1R5OA 1E4EB 2HXGA 3LQRA 4C3OB 5JQGF 2ACEA 1DC7A 2PH5A 1MC8A 3HDYA 5CM2Z 1P1BA 5H9VA 5KJFA 1DRJA 1KO7A 3L93A 1C0KA 5T8KA 1EAMA 2JH3A 3L6EA 2IYYA 4N8SA 5EHIA 3L77A 3QHAA 4E5PA 5JYEA 1O5IA 2AMFA 2XCIA 3UAVA 1ZAKA 1G98A 2W2KB 3UH1A 2CDAA 4N8EA 5KCMA 1EVZA 3A1EA 4O1MA 5HFAA 1KHHA 1OLUA 1RZVA 1XVLA 3OPYB 2R6GA 2VP3A 4MQ6A 1XFAA 5EWLB 5THQA 5KX5B 4UMVA 2AJDA 1U9IA 4D8WA 2PL3A 4IVPA 4LBYA 4CM8A 2AT1A 4TRNA 1KRXA 3ILHA 2PGJA 4TS4A 2W2OA 4FMDB 3I61A 2WDZA 1XCMA 5KYUB 1B73A 4NOMA 1TGYA 4N12A 4I6JA 4H7EA 4WXPA 2FEAA 4DIKA 2QTMA 1MEEA 2V4ZA 4I14A 4LJ6A 3MJTA 4RZXA 4TROA 3TIIA 3H99A 5FJIA 4HWTA 5E3HA 2JCVA 5KNCA 3DMRA 3SJAA 4EUEA 4EY4A 3LY8A 3DQZA 3TCXB 4BGVA 5CG1A 4PNPA 3FVVA 2ORWA 3E27A 4NLLA 3UICA 2GJSA 2J6HA 2N42A 5HE8A 1JG7A 3F3SA 5ESDA 2HX1A 3AKCA 1XRJA 5JNWA 4UHEA 1XMXA 2IW3A 2OUIA 4Z7OB 4BBZA 2IE0A 5HMMA 4C0BA 1G8GA 1BU5A 3MCVA 3WB0A 3LSYA 5DASA 3NIGB 3BRQA 4R2HA 5B3LA 2ESRA 3BG5A 5FPKA 4J76A 3QX9A 2EJUA 4ZCQA 1D9XA 5D6WA 2X40A 3RFCA 5CRIA 2VTVA 1RHJA 4JJZA 3ENNA 1E6LA 2XQVA 2C04A 1HR0B 2H6EA 3GN1A 3I1FA 2C58A 3MXOA 4M9RA 1UDBA 1X0VA 1C3OB 1NM5A 5BQFA 1KI1A 1C0EA 3HBAA 3LHIA 4YA6A 5KDDA 4AM8A 1Z0ZA 3FMVA 2GKGA 3O26A 1WW8A 1G8PA 5D00A 1ZUIA 4LFAB 3HBLA 1B8NA 3BB1A 5FTJA 4EZIA 5JCOA 4L85A 3N6RA 4X1YB 4F9TA 1CUEA 5JXHA 1BDHA 2DGDA 1DJLA 2QTTA 3EPPA 4M55A 1RQNA 2HNBA 4HMOA 3E6AA 2CXQA 3O8QB 3BFVA 2R00A 3AETB 3R3YA 4L6AA 4WACA 2Q29A 1MRZA 3GLTA 1XVUA 5CXXA 3SZGA 4AWXA 4EMSA 1OPRA 5D6OA 2SICE 1SKAA 3WL3A 1MQSA 2JBAA 4KAFA 1G5IA 2QT9A 2GBIA 2JIPA 3C3AA 3QK7A 3CGGA 4RD4A 1CYDA 1RI1A 2YX1A 4J0GA 3ZHTA 2ORED 1NQOA 1FFCA 1TQ4A 1ZM7A 1ODJA 3WK7A 1Y7IA 5K09A 3C7CB 4AKSA 1JTEA 4NV1A 4WFJA 4RTKA 5G0TA 3B2NA 1OXVA 4M3NA 4Q1AA 5KSWB 1R4NA 4L4XA 4JT8A 2I80A 3VZCA 4J4TA 1UEJA 4UUAA 3W3ZB 2H1FA 4MUMA 4XM1A 4K87A 4CTOA 1G5TA 1OZGA 2D2IA 3FN4A 4KQMA 5D01A 3RU3A 3QIVA 4J0CA 4LISA 2C92A 2OENG 3G3EA 1J1ZA 4XD2A 4TMKA 1M73E 2QAGC 2K2QB 3I8OA 2XKBA 3QVGA 3GYBA 2IUSA 1J00A 2J09A 5K6RA 1NFRA 4EBFA 4CN8A 3SYKA 4E7OA 5T41A 4UE6A 3C14C 3NBUA 4ZREA 4IOJA 5A2QA 4AQYB 3ZY5A 2RI1A 3DT8A 4EG5A 4KV7A 1XRPA 4M0LA 5ESWA 3NP9A 2XE4A 3FKSD 3MT0A 2W2QA 4LK3A 3W8FA 3ZWWA 3QENA 3JYNA 4XLZA 4NPHA 1QV7A 1V6SA 2P3OA 1NIPA 4LKRA 3OHPA 2RGNA 4NTZA 3WJAA 5BT8A 2Z56A 2XDPA 2JGJA 4BQIA 2EYQA 3UTCA 2D1RA 3L1KA 3X1JA 5C7YA 1TZJA 3AXSA 1ZO8A 4LE2A 2PMFA 2HQRA 2Z8ZA 4JT2A 1Z74A 4Y2YA 5IKXA 1A4UA 2XHZA 1AS0A 3ND9A 4FIZA 5TJHA 3ZK8A 2F9LA 4P3OA 1XPOA 2CF6A 3UXEA 1P39A 4OH1A 4JKOA 4LQCA 2AJ8A 1YOBA 2FFBA 4W63A 2NU6A 3IC5A 2AQ8A 5EEGA 4EKYA 1UXGA 1EEXB 2Y1KA 3ITEA 1NBMD 3Q1LA 4DG9A 1S2IA 4G0WA 3C6MA 1U8AA 5HS4A 4QUIA 4RIEA 3RUAA 1VMAA 1A9ZA 2OAGA 4PHCA 1YMVA 1XZGA 1HSZA 1O2DA 1QHSA 1RI4A 4HLQB 1T6BY 1QUFA 3EFOA 3T1VA 4AJLA 5LNK1 2DJ5A 1GKYA 2IV7A 3FZEA 3PXEA 4BRWA 4NI5A 5I5GA 2XLBA 3KQHA 1N7HA 4J1QA 1M34B 4RS4A 5C0OE 3U7HB 2GLXA 3AINA 2W0SA 3RR2A 1NTRA 3GPCA 4M86A 1CNMA 1QB7A 3FYUC 4DHEA 2GJ4A 1T3TA 3H11B 5EJ2A 3L3BA 2NVUB 2YYYA 2C3MA 4YRFA 3TE7A 5IFLA 1TM7E 2B78A 1QYRA 3REFA 1TUGA 1H94A 1ZX1A 1JLSA 4BV3A 3F9CA 4QUEA 1RPAA 4NOJA 4B34A 1SOVA 1NW9B 4QDUA 3STHA 5AW4A 4HLCA 4BMZA 4M0CA 1G8JA 4XVUA 2VOJA 1QYIA 4BP9A 2BFBA 2WT4A 5DXAA 1RQXA 5K6AA 1W88B 4G1EB 1B0UA 1TEZA 4Q1FA 5KX5A 4YLEA 4IDFA 2CNNA 1O58A 5JAHA 2B1QA 5E1OA 3KFLA 1JFTA 1SHJA 4LSZA 4E31A 2R6ZA 1A8UA 1T24A 4EARA 1LY1A 3DOJA 4GXTA 1WBJB 1W6UA 3B1JA 2X3UA 3CF6R 4OHPA 5EGNA 1WMDA 4CKWA 1JLMA 1J7KA 2FWBA 1J9ZA 1HZZC 1DKQA 1IONA 2CLHB 2R1VB 1YHYA 3B60A 4Q66C 4QNNA 3WB1A 4FB4A 2ZQZA 1P1CA 4RK6A 3AEUA 2ECFA 1KAMA 4JLWA 2RH9B 5A3SA 1SKYB 1TT7A 4RF5A 1E3WB 3G8AA 3U60B 1TAUA 7MHTA 3LIIA 2GN6A 2VUIB 2Q5HA 2PZLA 4HJRA 3J81k 3ZGVA 5SICE 2CL7X 4EIWA 2O5EA 1FNCA 2BFDA 2JRLA 4YN3A 3O94A 5GONF 1EIWA 2FUEA 3RO7A 3LBIA 2BFPA 2FR8C 2E5FA 1QJCA 1KY2A 3LOUA 3TH5A 3VAAA 3EUFA 3OJWA 4R1NA 1T6ZA 1PDOA 3DL4A 2BCGY 5ALQA 4HWGA 1Z6XA 1WSDA 4FE4A 4F9FA 2FLVA 2GRUA 2HHJA 1XDZA 4JODA 2P79A 3NW9A 1N4AA 5JSQA 3DOEA 1UWVA 1N9GB 1UL1X 3D5QA 3KR9A 5CH3A 3NBXX 4AYTA 5BW6B 4NBVA 1D4AA 1OMOA 2NN3C 3EZFA 3Q98A 3VMMA 1K3FA 2PZEA 3BMCA 5DU2A 1OV4A 2B9EA 1NZJA 1TE2A 1G66A 3IHLA 4R01A 3FRJA 5E7MA 4Y2TA 3S40A 3PV0A 1YI8A 3FBTA 3WSTA 2ADFA 4A0FA 1Z16A 1N2ZA 3MLEA 4FC6A 5PGMA 3WRWA 4CMEC 2OESA 4BNZA 2G4LA 3F6EX 1K6JA 4NFHA 1U0TA 4XYBA 4XD7D 2LCIA 2P2DA 3FKSA 4OB8A 3MD0A 5A5DA 1N5OX 1PJ2A 1T5BA 2NUBA 1Q92A 5EXXA 3RSFA 2VUUA 1QHHB 3HKCB 4R4JA 3EPHA 5FOUA 3WGGA 1EU1A 1K5DA 2PRKA 4BLTA 5HUQA 1Q0HA 3TI7A 4BE4A 4BDSA 5LOVB 2H9YA 3E8SA 3P8ZA 5GWXA 1PNRA 5K51A 3V6MA 1IL0A 1U2GA 2IELA 1H3NA 4IDPA 2D54A 1EE2A 2XQJA 3DLPX 4XDZA 5HGXA 2HTFA 4I9GA 3N2YA 1JU9A 3L1VA 1N0IA 2XW6A 1UBOS 2JI8A 4GI1A 2IP4A 1KMHB 1LJUA 4ND1A 3K94A 4N49A 4CGZA 2FW8A 2HF2A 1LBEA 1W1IA 2YJ3A 2HEGA 3NWPA 4ID3A 4MVJP 4OKSA 1NVGA 4O5AA 2D8MA 4LJ4A 4CIAA 2ST1A 5U4XA 1OLUB 4HFRA 3NUZA 5IZ4A 4JB0A 2YXBA 1T6YA 3D6FA 5HJ2A 3SFVA 2PMDA 3G5LA 3TQSA 3AY0A 3A3YA 3BMQA 4C5CA 3ETDA 1VYVA 2GASA 4KBYA 3R7DA 5FAXA 3L8YA 1OX4B 2G80A 4JLSA 2QKYA 1NRXA 2XCQA 3BCRA 3DNMA 2ZYTX 1FP7A 3P0EA 3LKBA 1VIVA 2GS9A 1U3FA 1O9GA 3W5VA 3IFSA 5JBQA 2JJ2D 5CT9A 1ZUD1 2B7LA 1E1CA 5IJ9A 1KWGA 1WV1A 2W6MA 1SXJB 4DCJA 1KQPA 2DFTA 3LDFA 4NCNA 3RAEC 4I19A 2CDBA 2UZ3A 5DK4A 1V26A 2HJGA 3L41A 1YI1A 1UC8A 1YFKA 2YS6A 3O38A 1IFXA 2WUDA 4TM7A 3TJMA 2Q4DA 3FYCA 4Q4LA 3UBTA 1EVEA 1J5EB 1JIVA 2DWQA 3L6UA 2X0KA 5DMXA 2NU8A 3KB6A 4F6RB 1KXZA 2X7JA 1BZYA 1M6HA 1O1YA 4IUCS 4MIEA 1I33A 1RQ2A 4FINA 4QUGA 3U80A 4CDNA 3WKCA 1XDGA 4ZYVA 2OHJA 5H16A 2AFHB 1ISJA 3HMKA 4TTAA 1UEXC 3GNQA 3W2GA 1LPSA 3H97A 1FFWA 2I7XA 5FNVF 2FSVC 3C3JA 4RJIA 1ULSA 4CCWA 4ZCIA 3HK2A 2ICAA 3RARA 3ZTYA 1I4TD 1KI6B 2P4QA 4LZNA 4K1XA 3PX2A 1C2YA 5KTKA 1KO8A 1T8WA 1RRKA 3ZWDA 2AMLA 2Q8PA 1FSFA 1R0ZA 4GI7A 5LP6B 3NT5A 2QUIA 1VG0B 3DEJA 4CETA 2VI5A 1YZGA 3JQAA 4NYJR 3D8BA 4HDSB 4LOKA 5L3RA 4I8IA 1LBHA 2X7HA 3AP2A 3OD1A 3RS0A 2IPMA 4POOA 2YJZA 4DZZA 1CW2B 2O9JA 4W1PA 3OBIA 3KE8A 4MKRA 3WI7A 3GEMA 4BVJA 1HE5A 5EJIA 1M5UA 1YS7A 2G67A 1JLLB 4L3OA 4RY0A 4U00A 4P80A 1W5BA 3C3BA 4Q03A 1IBKB 2HZ7A 1TAHA 1OFVA 1OC4A 1V35A 2G5TA 2RBGA 2ZIFA 3BXPA 1SQ6A 4GBGA 4TYQA 4ZWNA 4C2BA 4EDFA 5KC9A 1QK4A 4R31A 4QPDA 1BE6A 4OHUA 2B21A 3VZDA 1CB7A 3GBSA 3NVDA 5J47A 1F60A 5EIBD 4ZYUA 2IH4A 3Q41A 4A8JC 4F4CA 5ESXA 1BGWA 2QL9A 4XQ0A 5C80A 1KWKA 4PCAA 2BR3A 1U7PA 3D2CA 3AU8A 1XELA 2G77B 3SEAA 1BHJA 1UQRA 2NSJA 2YV1A 4FOPA 5KBYA 1CERA 1SVWA 4HLDA 3IAM6 1PUXA 3G7UA 4YRQA 4HH3C 3SLRA 1M2VA 2QR3A 1DUSA 4E4YA 2QQFA 1YR9A 4RTPA 4YRCA 3DOUA 3EFEA 1ULBA 4FN5A 3SZMA 4CLHA 5BR8B 1UMCA 1XTSA 3UMSA 2RGGA 1GEGA 2VSQA 4CEIA 1VSTA 1U98A 3LC0A 3GJ7A 2XYQA 5BW5A 4OQYA 5JY1A 1M0WA 1ZITA 4YQZA 3ZZMA 1AMOA 3PF9A 3MTAA 4HDMA 1D1SA 1HG0A 4D1YA 5KSYA 3EUWA 3OZTA 4EX6A 1DT3A 4FX2A 4PZEA 1DBWA 1E98A 5F1OA 3GUHA 4R1TA 3SF0A 1K9VF 2OL4A 1SUWA 1IZ9A 1GQFA 1FX0B 1WDMA 5IMBA 1T2VA 3FZGA 3PJRA 4AJ9A 5DBIA 1EUZA 2J5XA 3KO8A 1R8YA 2P5YA 4GM0A 1U0JA 4KXLA 5DYNA 4G81A 4KITB 2BMEA 4C0WA 3JQAB 1CS0A 4D4KA 1DFIA 1RXEA 2VT3A 2D0DA 4REQB 2QYSA 3GELA 3LPLA 3ZI0A 1ICEA 2DQYA 2RARA 1G4UR 4OKIA 3RVJA 2HMAA 2JKVA 4O2BF 1T25A 5LL6P 3NDBB 1ISGA 8ATCA 5FTLA 2FSSA 2XYVA 5FIUA 1V8BA 3JRWA 3H2ZA 2B0JA 4OBXA 1ZIPA 3FAZA 1KKMA 3EWIA 3L0DA 3O4JA 4M7OA 4CM4B 4B4UA 5KVAA 2GBLC 1U2EA 2QJWA 4HX5A 4NH0A 5G0SA 3RANA 4QUJA 4RE6A 3T35A 1JG4A 4ATNA 3DB1A 4BRZA 1WHSB 4WD3A 3HLTA 4N0DA 2WQ7A 4WTOA 4R9UC 4XCXA 1SVUA 1Y8QA 2DWOA 3VHXA 3K31A 4RA9B 2E1RA 1LNSA 2X9GA 4B3IA 4EO9A 5LOVA 5JNTA 4KCGA 2XWPA 1HE1C 2NP7A 5DIZA 4J0HA 3I04M 5JZOA 2RJOA 3I6QA 2OCPA 1T4BA 5FH9A 1G8AA 3C97A 4HC4A 4W9NC 1E3IA 1VZ2A 1YL7A 1LLCA 5FPTA 4CQNA 3A70A 5KDLA 1L5LA 3QLJA 3EEQA 3T52A 1TMKA 4G1VA 4QDKA 3JRXA 2C57A 3GLUA 2OO7A 4QUDA 4KOEC 2YWRA 5AVUA 2DLCX 1P62B 2QMZA 3V8QA 3RUFA 2G07A 1KIFA 5CW2A 2JKYA 1GPUA 5C51B 5AI5A 2VDNB 1L7AA 1SAYA 4JB3A 2QJOA 1I7LA 2HHLA 3FPKA 4CTJA 4N41A 4GUDA 1TPYA 2M98A 2XUGA 2OV6A 4MRAA 4TRMA 2XOKD 5C8YB 2J3JA 3G23A 3I64A 4NEQA 3I9V1 4OQEA 1X1QA 1Z0UA 3H8JA 4OM7A 3FTPA 4DY6A 5A1TA 1IZ8A 1GKIA 1OFUX 4M8NE 2JHCA 2WABA 4Q3DA 2RI6A 4UFOA 2OBBA 2NZXA 4AG3A 2VDUE 3RYFB 3L1JA 5MDHA 3BTSA 3GWGA 2RHHA 1XZAA 3I2FA 1V9SA 1W5FA 5E6SB 2Q21A 2Q8NA 3EDCA 4GLOA 3E3AA 1H9CA 1P0IA 1SO8A 4BQFA 1KAOA 1LPPA 2FPIA 3A6GA 3IUNA 4JBLA 3ZEAA 4JDPA 1U2DA 4DTIA 1U2DC 4KXXA 2LCQA 2PO7A 4YS6A 4QASA 3FOZA 3TIVA 3HA7A 2NO4A 2A9OA 2O0KA 1GG2A 2C00A 3KWMA 1DVRA 3C8UA 3H8SA 2X41A 5JMOA 5FB3A 3ABQB 4F0JA 1FW8A 1MQ9A 4MO2A 4BBJA 1HFJA 5EJ8A 1SD2A 3KKKA 3R20A 4TN5A 2D2VA 2I6SA 3HCOA 4F6RA 3U7IA 2X22A 1RJWA 3HKBA 4OSEA 4RIIA 1VMEA 3SEFA 3UCXA 1GG8A 3GJQA 1DTWB 1CQJA 1LPNA 1VMDA 2I8CA 4X3PA 3DMTC 4I6GA 3PQ4A 1KC1A 4K9PA 1EHCA 4TTRA 3I32A 2IRWA 1T2UA 1WHTA 4FJ1A 1Q7GA 3AH8A 3QX8A 4XJVA 4AO6A 2CVZA 1Y33E 4ZOQI 1AGRA 1C30B 1Z8HA 3W6OA 3IE1A 2GRJA 2FHPA 4J7AA 4X6YA 3OPYI 1VSUA 3DZJA 4FILA 5F4BA 1P0MA 4MLPA 1DRKA 3PGKA 2FMXA 3ZY3A 1ABBA 3PFKA 4MUGA 3L4JA 3DL0A 3BDAA 1H6CA 2QTVA 3OIFA 2DECA 4QQKA 4Z0NA 3QIAA 2IYUA 5DSTA 3B53X 3QX3A 5CB4A 4AJHA 2I1WA 1FA9A 4JI7B 3FZQA 3N6VA 2P1ZA 1XDBA 4D5GA 2W2TA 3R9KA 1JQKA 1CJBA 5KJEA 1MXHA 3EXHC 2R62A 2NXEA 3CBGA 3GJ3A 1E5TA 2AF4C 3MUOA 4CM8B 4U7JA 5A4MS 2Z6UA 1KIAA 2QUHA 4URWR 3RSSA 3SE0A 4DJDC 1V2GA 1R1DA 4WXYB 2C2HA 3EK2A 3IQDB 1P33A 1TLLA 2WF8A 4RULA 5CX1A 4KU4A 3ODGA 5CD9A 3V8MA 1EBBA 1KQOA 2BMDA 1DQZA 3CEJA 4C1NA 1JXQA 2WU3A 4DRZA 4E2XA 4Y1GA 1MH1A 1D0VA 2G8LA 3IO5A 1QO0A 3C3DA 4J3FA 3ZJTA 3ISTA 4Q6BA 5J2TF 3KKOA 4AIIA 4B35A 2AC2A 2RHDA 4LCBA 1FPMA 4NDNE 3HM2A 4INAA 4S1PA 4X7PA 5EKSA 1I3MA 2MIIA 2YY6A 4FTWA 4Q48A 3ZVKA 1NONA 3NHSA 1JIIA 3P9NA 2FU5C 1RBYA 4IH1A 3DXYA 2QPLA 2QZPA 1ZONA 2EARA 1DJPA 4LHSA 2OCAA 1FXUA 1TAGA 4Y1EA 3FTFA 1GFZA 1TIBA 1OXKB 1ZVQA 3A4VA 2QD2A 3AR6A 4JLBA 3TLJA 2EKBA 1RCFA 3FDJA 4HK4A 1JBKA 3A31A 1JIUA 3P9XA 5HNKA 1U0GA 1OYOA 4TTQA 1IBCA 5AQ1A 4J1SA 3FHCB 1YASA 2ZOSA 3MJ4A 5LXTF 3T8YA 3LS2A 1PDWA 4MWDA 3KYDA 1IK4A 4WN9A 3RYHA 2J08A 4MUHA 4Q39A 1PF7E 2Z1MA 2VYND 3MT8A 4EY6A 1KXJA 4EVIA 1QVRA 3FSJX 1IZYA 1K5HA 3GCXA 1LPMA 4IEIA 1W5EA 2D0IA 2VF5X 1KERA 3D54D 4KACA 3B38A 4YRRA 4H15A 3HYSA 3DBVO 4IHJA 3TSZA 3B7PA 1NRJB 4MVYA 4HFJA 4JJEA 4D57A 3ZU6A 3IE2A 1US8B 4CTNA 1ZVJA 5ENVA 4IZIA 3K16A 5K3AA 3H4TA 5C46F 5JJKA 3UV7A 2H1SA 3HB0A 3WHPA 3CW9A 1GT91 4GW3A 5GAJA 2XBUA 3A9SA 2BT4A 3BZUA 2PZ8A 2WAOA 3QVJA 1A76A 1LRKA 4UXJA 3D6HA 3K20A 2XNDA 3EIWA 3FF1A 1LZLA 4JT9A 4N54A 4RHEA 1OLSB 4Y98A 4M9QA 4S1NA 5CB6A 2WJWA 1S3SA 2PUGA 1AHHA 2W2XA 3EWAA 1MJNA 3GC6A 4F86A 2QUKA 3FYUA 4X44A 3EZYA 3ZE0B 1IY8A 4EYQA 4KO3S 1MUUA 5FPPA 4DIFA 1FTSA 2BZGA 2X8BA 1ZD9A 5DTQA 1YS4A 1GNPA 4MARA 1KK1A 2BE9A 1VL0A 2VYQA 1T2EA 1WUYA 1YL6A 3ET5A 1A97A 4X71A 4UM9B 2GYUA 3W5HA 4Y6LA 4G8CA 4ZIRB 3ACBA 5KQSA 1HT0A 4E88A 3DCNA 5AW2A 3TAHA 3QU2A 2FUG6 4L9AA 2QGZA 5AKYA 1NVTA 1SBCA 2P0YA 5CA0A 3GVPA 2VNIA 1HDIA 5H68A 5KOHB 4K9LA 1CRQA 2H48A 3E9DA 3B6MA 5J5VA 3V1YA 1PR3A 3DDCA 3OCYA 2X0DA 4CODB 4DCSA 3AY6A 5JAQA 1JAHA 1X3LA 4QDTA 1J0XO 3MILA 3WYGA 1XD2A 4NYMQ 1QK5A 2JK0A 3TOVA 4GXRA 4GGMX 2M6RA 4BJ5A 4I4LA 4WKGA 3K2IA 2EFHB 4AWBA 2PVCA 1Q21A 3VH4A 3CTPA 3NNDA 4S1OA 3U9TA 5E4JA 1KMIY 1WNFA 3JTMA 4IIFA 5JMPA 1SXJA 3MJFA 4NMXB 5F5NA 4KDIA 5CLQA 3U3JA 2PZAA 3QE4A 1U2TA 1X7GA 3SYLA 3BIOA 1ISFA 1YDGA 3IP6A 4U7WA 1WMBA 1EXWA 3CYFA 3WYNA 9LDTA 1FVXA 2FPKA 3MELA 3OF3A 2NO5A 2Y0CA 4C6RA 3EVCA 1YGPA 2R7AA 5JCZA 3JD3A 1W0CA 5DM60 3PC7A 1TLFA 4HAWA 1C9YA 1GAXA 1O7JA 2I0FA 2FR8A 3D8TA 3FPCA 2H4XA 3FFBA 3HCPA 3FPFA 3N3BC 4MWGA 4CZ2A 3H84A 4P36A 4F38A 1QIGA 1E3SA 1B42A 1SQ0A 2IL1A 4BNTA 3EASA 1L4KA 2B83A 4FFLA 2QT1A 5JT1A 1DU4A 3ZWVA 3H5RA 2D5LA 3P27A 2FZVA 3LCUA 1DRWA 3T38A 3ULKA 3D43A 3RLFA 3M6FA 2YZMA 2GNOA 5EC8A 3LCVB 2HC9A 4JYCA 4TMXA 2ERXA 5HA5A 4D9MA 1UKZA 3ZV3A 4PN3A 1RIFA 2X0NA 4FNGA 2DERA 2NNLD 4BVBA 1S3GA 3MGBA 3RRFA 1QIFA 2EGGA 3EMVA 1GLVA 3PU6A 4WOJA 3L9WA 3EPJA 4C4TA 1Q7RA 1KJQA 1AE1A 2XOKA 4M1YA 3HY4A 2QVGA 2FFAA 5T4BA 2D5IA 4HDNA 2EGUA 1MORA 2H51A 4J9UE 4B44A 1GPLA 2XPCA 2IVZA 2CB9A 2IHTA 3C8DA 3G1TA 3LM8A 3NETA 4QOHA 5GPBA 3W90A 2VUSA 2FE4A 1DKNA 2GM3A 1B6SA 4JP5A 3MWJA 3PFFA 2GHIA 2HSJA 2W98A 1NQWA 3W8RA 1A7AA 1TMGE 5ALEA 4DJAA 4YUZA 1JS1X 4U0KA 3GJZA 1J0CA 5ECWA 3S6JA 3IT2A 4JI6B 5J2UB 2R4TA 4BBPA 2QM0A 4HBZA 3OTGA 1N1GA 3NONA 3LAWA 4YHBA 1E6CA 2WHPA 1FUIA 3WWZA 1GGMA 2YWJA 2Y1XA 3O75A 4H3VA 1EUQA 4F5YA 4ZVUA 1MVOA 4RZ3A 1GFIA 5KPJA 3EEBA 3QF4B 1PD1A 2EL7A 4ILKA 4DQDA 3P9SA 2L42A 4DEVA 2PZMA 3ASVA 2CCJA 3OY7A 4PYOA 4GZLA 1I2AA 3KB1A 5IK2A 1QPZA 4MYHA 1ZH2A 2AI2A 5ICEA 2UVQA 1PLJA 2D7CA 1COWA 7YASA 1RMQA 4BZXA 4UNQA 4AIRA 1CSEE 1F0KA 2I8AA 4F85A 2QZJA 4BP3A 2JH8A 3QUBA 4CLOA 1B8OA 3ZDEA 3O8OA 1E2KA 5A9TA 2BGKA 3F7NA 3K9WA 1NMSA 1HRDA 3HKDA 4JP3A 3GJXC 1XCPA 3BMQB 1K1EA 1KY3A 3UOWA 3ZCSA 1BG6A 3ETHA 3RVNA 1O6ZA 4ETIA 3K8YA 5DM70 1WBDA 2XQKA 2FUNB 5AM3A 2O7NA 1S0UA 2ZRPA 4HVAA 4CGYA 5B1HA 3OT1A 1C3OA 3STTA 3J81A 1DL5A 3BPSA 5ELMA 3BWEA 5INTA 1CJUC 2DFPA 4QYSA 1P5ZB 1VE1A 4JUDX 3JVDA 3RK4A 2VHUA 2WSLA 3GJ0A 1BYUA 4FZRA 4GZ6A 1FSGA 1SR8A 1I3OA 3A0UA 3FMIA 3GAAA 3VHQA 1NI4A 1MOPA 3N0VA 3OM1A 4TQGA 2ZM5A 1NKTA 3BICA 1HL7A 2JIMA 1BMQA 1W30A 3C24A 2C3UA 4JQZA 5ALTA 4H6XA 5A2GA 3QLUC 5B2ZA 4B5LA 3WVNA 4AUEA 4F5ZA 4FFPA 4E12A 5IH7A 3CLVA 3TNFA 1H42A 3BYZA 4TXHA 3JXEA 4MYSA 4J1TC 3BERA 4EHJA 5JZVA 1QHYA 1TTTA 4NEGA 4ZOBA 5LDHA 5E7IA 2HIHA 1Z4MA 3DTYA 1E9SA 1XA3A 1KIMA 4LSMA 2Z9CA 3IKVA 2I54A 1KYQA 1XU7A 4RH3A 4MHTA 2R47A 1UPAA 3EMKA 5TPZA 4I81A 3HRIA 1ZD4A 3GT4A 1Z0JA 2G36A 2PRIA 5K6AC 4Z4QA 5C7OO 1IMJA 1KK2A 1F8GA 3A14A 1JYEA 3KSMA 4Q4AA 5F78A 3OPQA 5DGCA 2HOQA 3K9BA 3PD7A 1N2HA 5DF1A 5FR1A 5I9SA 1E0DA 1P2VA 3IDAA 4ITVA 4QGAA 3OLCX 1X3SA 1GCGA 3F49S 3Q72A 1OGJA 1T34A 5EJ9A 4YJ2F 4RQUA 4QFBA 1F6BA 2V6BA 4KQKA 3OZRA 4S3MA 3IJEB 4EKNB 5F77A 3FOFC 4PX9A 4EPVA 3KQSA 1GKUB 5J5CA 4F3CA 3C4QA 3H9QA 3ITDA 5ES3A 2ZIXA 4OI4A 4YUXA 4AL4A 1U5CA 2CHUA 3D7SA 1XTRA 2H4ZA 3NTRA 2IQ5A 4JSRA 3TLGA 1UJMA 3QKSA 4E33A 1I5OA 1GRNA 3CJTA 4P1ZA 4UAGA 2JJ1A 1U8CB 3K4HA 4D82A 1LF5A 5JH7A 1GNTA 5DW0A 3GZJA 3WLAA 1OX6A 5LQJA 3ZGYA 3G8CA 4GKJB 4X7RA 1K3TA 2LW7A 3S81A 5IX8A 2BGIA 1GPNA 4C3UA 1BGVA 2RGCA 3P5SA 1FTGA 1JVSA 1UR5A 4YAEA 5LFAA 4AJ2A 1IN7A 3Q8WA 5JSHA 1G5RA 1FY2A 3WHLA 4Z4CA 2VQ6A 4PZ0A 3D3QA 1XCGB 4L5IA 4I50B 3SQXA 1RXCA 2P9QA 3AHGA 1SD1A 1KL7A 4G84A 4UE3S 3WY9A 4KG7A 1JTFA 3C6XA 3CNQS 1IHDA 3VPHA 2G1UA 4P7BA 2ZYIA 4RVDA 2R751 2VAPA 1SCQA 2EERA 3WMEA 2R97A 2QYHA 2V3WA 3H5IA 4BQRA 3IOEA 2B4TO 2PKEA 5AOCA 3GFSA 1Q19A 1BWRA 1Y8ZA 4FYVA 2BEWA 2GARA 2X6QA 2ZI7A 1TO6A 2CXRA 1REQB 1RYNA 3MTIA 1E7RA 1W36B 1K0FA 1WU8A 3KKQA 4Q4AB 1CRWG 3WO0A 3NWBA 4X0EA 1XZJA 1H2RS 3GFVA 3VPFA 4F72A 1XZMA 1MIOA 2H1CA 2GOYA 4YO8A 1DAPA 5LP6A 4UPEA 2NPOA 4KNYA 1SCUB 5DHPA 2UKDA 2VZEA 3BB3A 4NS1A 1XZPA 2ZRGA 4D4MA 1AHPA 3CRZA 3GLQA 1EFAA 1UEIA 1R12A 5JSKA 1EP9A 3GZTB 1CUYA 1E89A 4LXHA 1UC5B 5BSFA 5KO2A 4YJFB 2APJA 3COYA 3GA7A 4XIJA 4WL0A 5HW0A 2WWRA 1EK5A 1J1IA 3DVSX 1AQLA 1SXGA 2GZSA 1LBSA 3JV7A 3M33A 4HX2A 4RPGA 5K4GA 3MAGA 3FCXA 1UJBA 3OC0A 1RIIA 3DBOB 2ZVQX 4BFSA 4F97A 3AUKA 3N0TA 1Q0TA 5ERXA 5EIWA 4AECA 4GWKA 1HQDA 1XEWY 3I5MA 4GRDA 3BFPA 3V80A 5JR3A 3INGA 3ZHBA 3IEIA 2XCSB 1UUFA 3K1AA 3MTQA 3GLIA 4AMBA 1HDYA 4PC7A 4AJNA 1IQPA 1J2JA 2IZ5A 4Q3KA 4RTJA 3M6XA 2VAVA 2FSGA 1M8JA 4BNMA 1ZOSA 4MWBA 5JATA 1UQTA 3A6PC 1YQTA 5B3JA 1PQ4A 1EDEA 1XTBA 2RGUA 4HYYA 4RIFA 4DXDA 3ESDA 5JWRA 2I9KA 1D2CA 4JP2A 2VP2A 1QKKA 2AK3A 3NDPA 3ZV5A 5FBQB 5CIWA 3UC9A 2WB2A 1EWRA 2VXBA 2PA3A 4Z2YA 4A6XA 3K6SA 3CV3A 4IL5A 1AKQA 3H5OA 1K98A 5C9ZA 1CX9B 1IQUA 2C07A 1EWVA 1J70A 2PL5A 1FFXA 4I36A 5E4YA 3VKGA 1E4VA 1MCZA 1QIJA 4H0FA 1VBFA 3L04A 1ADJA 2EWVA 2CXNA 3HR7A 4JVMA 3ZPXA 3ZCPA 4HDMB 3Q8KA 4URZR 4MYUA 1M1YB 3SP1A 1ULHA 4BEVA 1H2EA 2VRWA 5CVTA 4H1WA 5IKPA 3GLHA 3LCMA 2HD4A 2P0EA 2ETXA 3CISA 4X7BA 5IC6A 1WY5A 2Z2KA 4ZDJA 4C4YA 3EXG2 1Q1NA 4MUNA 3K9LA 4DT1A 5CLFA 4KR7A 1GGEA 3DT9A 3RCBA 3CB2A 3PTLA 2FSVA 2VHWA 4WESA 4DQUA 1A2BA 4OXXA 1FZQA 4WK6A 3GMIA 3SQMA 1HRKA 1P75A 2GFHA 5LA6B 1DT5A 5CLJA 1MN6A 1YB6A 3UAWA 2PXHA 4Z1MD 3PX7A 4K3VA 1ZFNA 4N9QA 3WYCA 4EHLA 2EHJA 1AIPA 2CZGA 1KC3A 1A8QA 1HDZA 1QDLB 2AX4A 4F96A 4A3SA 1GSIA 1EX6A 2ZI3A 4C6SA 1II8B 3SX0A 1C1XA 1UP6A 4FI3F 1G21E 1E2FA 1ZA1A 4S2EA 2KI5A 3UATA 1SBYA 3L4EA 2O7VA 1GRVA 1C9NA 2HRDA 2J9GA 1M6YA 4OYHA 3VR5A 4DF3A 2PUAA 5J43A 1TUIA 3D4NA 3HMQA 4ZAVA 1GPKA 4L8GA 5EN4A 4IUDS 2EU8A 5ES4B 3QUSA 4RA9A 2JFVA 2QW1A 5A5VA 1ZGJA 4GX1A 1J0EA 4PW0A 5G41A 1NU8A 3HJHA 3VZSA 3HTXA 1HI9A 2O2IA 4B2IA 3KQPA 3O9MA 4J0QA 3WGHA 1PFQA 3TNJA 3H5NA 4QD3A 3RIXA 5JPCA 1E8MA 4OP1A 1F5SA 3AVOA 5FTNA 1F7VA 2GX6A 3D0OA 3EQ8A 1DXOA 2VUHB 3Q2IA 2AZXA 3LY5A 4EAQA 4EUKA 1JRLA 4IG4A 2AV6A 1LJ8A 2OP0A 3GJ6A 4PIVA 2RKOA 3PC8C 3RABA 2UXDB 5LZ8A 5DE3A 2FEKA 2D59A 5TQ0B 2G25A 3GVCA 2W4IA 1I3KA 3DNFA 3P52A 4RHXA 3FMOB 2TYSB 4XEHA 5ALGA 3UHJA 1PX0A 4YIHA 2GBCA 4MRMA 4RTLA 1QRAA 3BIXA 4ARSA 1EX1A 3WL4A 3H5VA 1MU0A 4UDXX 5TXGA 2JI9A 2RONA 2I7CA 2RE8A 5C8YA 1B2RA 3D8RA 1SKMA 4IHJF 3KJQA 4KVGA 2JA2A 4ZV7A 4V0QA 5KS2A 2ZUSA 4C5BA 5KNBD 3ZWKA 2ZIWB 2H0QA 3KDPA 3AXTA 2GPBA 3QV1A 4QKQA 4EYSA 5AKLA 3RC1A 2V8BA 2WB4A 1V7QA 4D3FA 2H4HA 1G20E 3HEMA 3WLJA 4LE1A 4JA2A 5A9RA 3QFFA 1UXHA 5ITSA 1V5EA 1A9OA 3ON5A 5L6LB 1YVDA 2JAOA 4QXQA 2ZCVA 4BO9A 1LK0A 2VK1A 4HDAA 5K8TA 3EZGA 3HNPA 1A0OA 1Q1GA 2FMHA 2JCXA 1Z17A 3MOIA 2PT5A 3EG9A 4EP1A 2ZUUA 1QGYA 1RYEA 4CLOB 5IHPA 3LUCA 1DCMA 4MS1A 2DPHA 1SBZA 3LX4A 4W7HA 2ZATA 5K3FA 4NL4H 2W8BB 5BUCA 1Y5LA 4URFA 5BWMA 2F6RA 5FHQA 5KKCA 1EVJA 4PYRA 1QPBA 3PSHA 1NMEA 4DARA 2GCGA 1PS8A 1RI3A 3IKLA 3JWPA 2QK4A 5EPOA 1P29A 3RFTA 4L0MA 2JHFA 2QTLA 4GOND 4KR9A 4NS4A 5BN3A 5HRAA 4QPPA 1PYGA 3K6KA 5A4AA 1W48A 2A5LA 1X87A 1E8NA 4I2VA 5JZBA 3NQ41 4EYOA 2O8DA 3CHYA 4NYMR 4X3OA 2GK7A 1BW9B 3MNFA 1WPXA 1QFJA 3BF8A 1NXVA 2CFIA 1Q77A 1ZHHA 4BP8A 2C9CA 1Q0LA 1RQLA 1ZM9A 5AW5A 1PK8A 3DZBA 2Z6QA 4IFIA 3ADKA 1Y48E 5IC4A 2G1AA 2GETA 5JYBA 2VYCA 3I8XA 3EZXA 1AA6A 2VNHA 4GC9A 2BGNA 4IXNA 1Z73A 2ZB7A 2NZYA 3KJNA 2IWHA 4NJMA 1TFUA 3BWMA 2BD0A 3PQ6A 5AFSA 3VR1A 4P33A 3BD6A 4QTYA 3K73O 2R9VA 1JAXA 4FWIB 4M83A 4CMAA 2R79A 2C4HA 3MRXA 4H4DA 4MR8B 2ZG6A 4LN1A 4PZYA 3GFBA 3I9FA 3U4IA 2FPSA 2CNKA 2OO5A 3NKVA 3P0HA 1KSGA 4AG5A 2BI7A 1OU4A 3QKSB 5K0LA 1MNQA 2J4CA 3IUEA 3VPXA 1N9GA 4BNUA 3M3PA 2QF7A 4W9MC 4FHCA 1QQ7A 2ZXUA 2ZANA 1LV7A 3F8WA 3I5AA 4MWEA 4ZQIA 1KYZA 2ZR9A 1ZC4A 3M70A 4E5NA 3IALA 1WMSA 1AVTA 4CKBB 2OCGA 3PA8A 1PK7A 4MH0R 1NZFA 4G5QA 3WAGA 1KMCA 3SFTA 4MDHA 3IBYA 4UCXA 3ZHSA 1OX5A 3H5LA 4Q4DA 2WMDA 4MB0A 3MB5A 2P6PA 3E84A 5TARA 3SMQA 5KWVA 2OHXA 3USES 2GAFA 1CZRA 4NDZA 2FGJA 4CCYB 1Z75A 5KVQA 1N0UA 5LKAA 4MRPA 5FDFA 3OT5A 2JLZA 4Q9JA 1CP3A 1NUQA 1TD1A 3OMLA 4FKMA 3WDSA 2CB0A 4KIWA 3V9PA 4F9GA 1NG9A 1PKXA 3B52X 1ULAA 4MV5A 2H7CA 1JEYA 2BHRA 3VC1A 3BL6A 3ONVA 4EHDA 2ZSFA 7ABPA 4BJ1A 4MW5A 1C9JA 2MSKA 2Y66A 4DDUA 3TLCA 4JQCA 4Y8VA 1I2CA 3USZA 1LI7A 1FQJA 1AKMA 1NSYA 1W93A 4DBVO 2AD5A 1I7QB 4PO9A 5LLSA 3LHFA 4L7QA 1EUDA 3IUQA 3E5RA 3FYSA 3INNA 3WV4A 4OHYA 2FPOA 1XMIA 3AEKA 2PX3A 4WLFA 5DHQA 4GC5A 4IJ6A 2O48X 4MQ4A 1Y3AA 4C22A 1K7FB 4WNIA 1TUEA 5HJEA 4CL2A 4M8LA 5MF6A 3IPCA 2ZJ8A 5D85A 2FWPA 4EO7A 1BWSA 3CU5A 4BMVA 4R5HA 4EABA 2GPYA 3RC7A 2WJGA 2UXCB 4Q7JB 1PEAA 2PKWA 1M10A 4TMFA 2ZZKA 4NESA 4FDAA 4RSGA 5SZHB 1B93A 1NP7A 4QDOA 3SC6A 3SJCA 1MRSA 4RFSA 2F3TA 4OHVA 3M8KA 2VTDA 1QJ4A 2BKVA 2VR1A 4A26A 3CO0S 1BXRB 2DZDA 1YRHA 2WWTA 4I5IA 3VBCA 3UHPA 5H8WA 2PD4A 3H1EA 1VLHA 1V95A 5BN4B 1TAQA 3ZDAA 5CIQA 4E5SA 1OHHD 1U0HC 3L7JA 2PKRA 1XIVA 1X2BA 1ZZGA 3AWIA 2VP5A 1BD3A 4DDMA 5JD5A 4E7PA 1YS2X 1IZ7A 4BN5A 4XYGA 4XIFA 1GY8A 2YRFA 1XCJA 4QIHA 3ZE8A 5I9MA 3O83A 2F1HA 4DY4A 4JR2A 4CVNA 4PQRA 1CZUA 2QVCA 2Z95A 2ACWA 1RXUA 1AQUA 2AW3A 1UADA 2Y92A 3ZJUA 5KTMA 5E8RA 4BY9E 2I65A 3CUTA 1H5NA 3IPLA 3HO1A 4MAAA 4L4SA 3KLOA 5FOWA 3FGZA 3HYLA 1UPXA 1P1RA 1EG2A 3B9QA 3ZXYA 2YHIB 1E7QA 1IXZA 4BMCA 4Q4JA 3QHQA 1BCRB 3TL2A 1TTPB 1JIXA 3QP9A 4B6JA 1BN7A 4MA5A 2OCXA 3B70A 3OUUA 4HCJA 3BL8A 1VFPA 3R6DA 3VPDA 3ZNOA 5C7IO 5HHTA 2HFKA 1FU7A 3AESA 3HV2A 3L8GA 3ZBTA 2WYIA 2P6OA 2EFGA 4ESOA 2BM9A 1I1HA 2WR8A 3DL7A 3H8WA 2HMUA 2G4VA 4NVRA 1EVYA 2CMHA 3LHKA 3UUEA 2NUPB 2XGGA 5JO0A 1MMFB 3C5HA 4GEKA 5AT1A 5KIAA 2BP7A 3I2IA 4YQEA 3VR3D 2VJLA 1FVOA 3H2BA 2R3SA 3NRJA 3FFTA 3ETGA 4QOFA 4NXNB 3NGLA 1ZI9A 2PG3A 4ZQFA 2FQQA 2CNDA 4C0LA 3CMCO 1J6UA 1MF7A 4O4LA 1OD6A 1RCTE 4NU0A 4PG7A 1I4OA 1Y8AA 1YS6A 1H85A 4AF6A 1SUDA 2GWRA 1MABA 4RYDA 4MVJI 1B74A 4G5FA 5DDIP 1P19A 4JJAA 3S1AA 1G1AA 5B3AA 2EZ4A 1YQWA 3NDIA 1TCBA 1W19A 4KYTA 1CXZA 1JMKC 2Z6VA 1RHKA 5IWAB 4OI2A 1N57A 2CXOA 1OH8A 4MV6A 3MW8A 4G37A 3PR1A 4B9EA 1AZLA 3ZLUA 2OBYA 2WVHA 3JAWB 5LU9A 2D3TA 1EXNA 4U7GA 1M2VB 1EWKA 2ATCA 4QRDA 5LMZA 2J3EA 4M0MA 2VA8A 5M04A 2X6TA 4HZGA 3VSDA 1VLLA 4FT2A 2XAAA 2XVZA 2PFKA 2WM8A 4MS4A 3TTXA 5AESA 5F2NA 2ZVDA 5EYPB 2V3CC 3F78A 1TK9A 4XCVA 3KIPA 4KE7A 1YB7A 3H9BA 4WNCA 3DL2A 4EZBA 4HLUC 4OFWA 1HMYA 2JANA 3LZCA 5BYJA 3V97A 3D5TA 4MIYA 3ZGNA 4CM6A 2WKPA 2A33A 4I4IA 3U4QA 3TDKA 1WUHS 3EVBA 4MI9A 3GGCA 3OP1A 2ZULA 1V71A 2YHIA 4GMGA 5KKNB 4ZVVA 4BVHA 1X39A 1JG6A 1GYQA 2A67A 1YS1X 2HDWA 4KI0A 3ISVA 4WKBA 3ZV4A 1HE4A 1U28C 3QXJA 1L7RA 2HLDA 1H0HA 1N2SA 2JD0A 2O2CA 4EA9A 2R5WA 1Y5MA 3E9EA 2FN9A 4OHRA 1KR2A 2X4DA 1X14A 2IXAA 2XE7A 3OX1A 4TSRA 2IE8A 2CVHA 2ZAMA 4LGCA 3ECCA 4OLHA 3WZ2A 2JC3A 3PNOA 5M5BA 1ZK0A 5D3KA 4XSGA 3KOYA 1K7CA 1M6NA 3T1NA 4E2FA 4R05A 1PLKA 1WXEA 4XRGA 4K0KB 2I87A 2LDBA 4UHHA 4HXYA 5F1YA 5BSGA 4D4GA 3MTDA 2NW6A 4HMQA 3MQ2A 4Y7CA 3JQ7B 4B2YA 4B3HA 2PBRA 2IF0A 3GQVA 1M1ZA 3B6KA 2ANCA 4OOFA 5CAEB 2WKSA 4DDWA 1Q0QA 3WWOA 4ASUA 1FCJA 4LC0A 2B20A 1WCV1 4WXHA 4LRWA 3SOPA 3K70C 3R5XA 1JNXX 3BX1A 1E7SA 4HADA 1R8SA 2B0CA 2TRSB 3JW8A 2BFNA 5L4SA 3PHCA 4N7MA 5CT4A 4EB6A 3HJGA 1JQ3A 4EJ0A 1U2QA 3I76A 3T4EA 4PICA 4EFKA 3R9IA 1P1IA 3F5DA 4JSTA 4W1RA 5ALNA 3H86A 4CKWB 2WZQA 2VBCA 1PJLA 1GCUA 1ZGAA 4ND7A 4WFQA 4BO3A 5B7QA 3LCRA 3LW7A 3V8PA 5LD2C 3CRNA 3NFRA 4NCHA 4UREA 3U7QB 3G02A 3IUJA 3CGWA 1D07A 4EPRA 2X2PA 4MPPA 2FQXA 3P97A 1JUDA 4RHCA 3CA8A 5A0TA 3FIJA 1PJ8A 3AK4A 4B1FA 3V1NA 5L3QA 1EESA 1SCBA 2H2DA 4D4JA 4R51A 4YRKA 3RC9A 2O4CA 1WUJS 1YFJA 3C43A 1OI7A 2OQVA 4BGEA 3FZNA 3TZ6A 3QUTA 4NOKA 2P9GA 4BB6A 2OHIA 5FWXB 1EEHA 2AOVA 1OYWA 3QE2A 4PQYA 2D0PB 4FCWA 3E2MA 3BOSA 3LP8A 2W2PA 1XQ1A 1Y3IA 1F12A 1Y80A 4KXNA 4P92A 4W6ZA 2BGLA 2I4OA 4WZBA 5FADA 3WLIA 2ISCA 1QSGA 2IITA 2XJ9A 2I6FA 3L7CA 4G4SP 5F76A 3WNQA 3ZV6A 1QFSA 4ZA2A 5EIBC 4KHPB 2ZSBA 3LWZA 1O57A 1K5GA 4FLMA 1KZ1A 4C05A 2VJCA 5AVRA 3GG2A 3L0ZA 4FCTA 4GXNA 5JCJA 2Q1DX 1YTLA 3ZG6A 2BE7A 3KDSE 3OC6A 4ZOCA 3QM1A 4A0GA 5B7PA 3NH6A 2BDUA 4RPKA 3N2GA 4Q18A 2V9ZA 4FYIA 4Q00A 4N5MA 4MMZB 2IPAB 1S4QA 2C8KA 2YUIA 5M29A 4UHCA 4YJGA 2PFGA 2A1UA 3H2JA 3HDTA 3F6CA 5AI6A 1EJ0A 3E3LA 3G89A 3IDQA 1WW2A 2F3UA 3QFSA 2ZPAA 1UDXA 3FUWA 4LJYA 2G9UA 4LOAA 3PQ7A 3KT0A 1PBTA 3G1UA 4ZXPA 1JSRA 2F67A 4DRYA 1E92A 4EECA 1PJAA 1ZNWA 3UZUA 3WTBA 2RHGB 3G5TA 1QPGA 1Y8RB 4PGFA 4ZVLA 3DAYA 1E63A 2MOKA 1KBQA 3T54A 4TMWA 2BKUA 1ZCFA 3K7EA 3O7WA 2QB5A 4P5EA 3BHJA 4ED9A 3E3MA 2CBZA 5L3SB 2ZAOA 1IULA 3GV0A 4P93A 3STUA 3NYIA 4EGSA 4UCFA 5CEEA 1NIJA 3OETA 2Q1YA 1GZ4A 1G2PA 2WMYA 3CR3C 5MHTA 4OPMA 1ADCA 3AB7A 3B3JA 3PRJA 4FSHA 4TPKA 3NWEA 5JC1A 1QO7A 5HZHA 1ADBA 1IHXA 4JD5A 4BLRA 3D7LA 1XWIA 3ND8A 1GGJA 1R9GA 5ITVA 2FZ5A 3I72A 2EFYA 1A8PA 3VNAA 1ZNZA 2XYPA 1RRGA 1KJNA 2IPLA 5EZ6B 4LVUA 4CDRA 2KE5A 4HZUB 3TEMA 3NNSA 4BO6A 2W8ZA 3CNBA 5EIAA 3LXRA 4O63O 2ZIGA 5F51A 2QQ0A 1RM4A 3BQNB 5A04A 3EY4A 4W8HA 4GWLA 1THTA 4D3SA 1YHNA 1IHOA 1T3LA 2QV7A 3HPRA 1YIDA 3AQ4A 4EX7A 4D26A 3LCJA 3PE6A 3RD5A 3R5TA 2YIMA 4Y6GB 4EMUA 2DHRA 4MW4A 1FC0A 1Z8DA 2FA9A 2VSNA 4YCDA 4YT4A 2XZOA 2EJVA 2YJ5A 4GPZA 4ARUA 2P9BA 3QEOA 3QKUA 2H18A 1GU1A 1U7OA 3RRYA 3R5SA 4BLQA 3WNCA 5F9FA 1G7RA 1B0PA 3F3KA 2B37A 2UZ1A 4KK4A 4MR8A 3Q88A 1JTVA 1T9ZA 3G2QA 4FFRA 3GU3A 3IILA 2WAYA 3K6SB 5H80A 4P82A 2XNDD 5HUJA 2UZAA 4OSPA 3KKLA 1WXHA 1QGDA 1ZXXA 1MPXA 2CKMA 3PKZA 4O4IB 1FNMA 3CUEF 3JQQA 1SHLA 3KXKA 2GAAA 2HMYB 3K1ZA 3MJVA 1LK5A 3UANA 1QLWA 2JHAA 3OKCA 3UJ9A 5C5CA 4TYNA 1ETHA 5JO9A 3I1JA 3THXB 2PAFA 3ORYA 3DH0A 3QVKA 3D0RA 2D00A 4JVSB 1FVHA 3TRFA 2HSEA 3MCAA 5ALMA 1MB9A 2F1IA 2BONA 4HPWA 3VNRA 1PQYA 1W85A 4JC8A 4XR9A 5GOZA 1JSZA 3ELYA 3L7AA 3UF0A 2Q1TA 4EA8A 1HH4A 1YL5A 4KSCA 1L8AA 4S04A 3BK2A 3KL4A 4G67A 2QXUA 3TSYA 2JGIA 2TS1A 3AR2A 4Q9LA 5U9CA 4WUTA 1I01A 4RMHA 3GAZA 4ZAZA 2J3IA 4L3VA 4ZT7A 3WK4A 4R8KA 5J1TB 2L19A 4RBNA 1NNUA 1Z37A 3BMNA 3ZWYA 3FJ1A 3WAKA 4GLBA 4FFDA 2Q9UA 2AJCA 2E55A 2YNMC 2HU7A 1GGFA 3J7TA 1G8MA 5HE9A 5A0FA 3RLIA 3PGJA 2BEUB 2OK7A 1QX3A 2QUBA 2XUFA 4DA6A 1QFXA 4M8SA 3SCZA 4A5OA 1OQAA 3KJEA 3WGNA 1OXUA 1I0IA 2QRLA 3RDPA 3WGYA 3WLQA 1NX9A 1XAGA 1ZUNB 4UAUA 1KDTA 4CUKA 3UMCA 2PD3A 3ONFA 5JAPA 2PUCA 2IEBA 1KAGA 4AKIA 3WWCA 5CB0A 4BRUA 1Q15A 3DDNA 3O4RA 1AZTA 2O0LA 3EH1A 5TT0A 4FGWA 1AURA 4L2IB 3OX3A 3E4DA 4A36A 4TV9B 1OAAA 1GADO 2PU5A 1UZUA 3GDWA 1MO4A 4MGZR 3P96A 2ADOA 2IGTA 4MV0A 4TVKA 5CK4A 3CF4A 5ICMA 3QYJA 3NLLA 4JCCA 4YREA 4RTMA 5T3YA 1EJ2A 2O19A 2C0CA 1GUFA 4IUYA 4DCNA 4I8DA 5EHQA 4X60A 1A4XA 3QQ7A 1Z6AA 5CDFA 2C84A 2H3HA 2C2KA 3FPEA 1E5DA 3ROGA 4NFSA 3B7WA 4B0PA 2QGFA 5JD4A 1OJ7A 5CA0F 4INOA 4AMVA 4ZQGA 4II3A 2FP3A 3WE7A 5CD1A 3AR3A 5FUBA 1E3WA 4U4AA 5BN4A 3M6IA 1KEZA 3A05A 3GLGA 5AKXA 1GPYA 4B47A 2GQ0A 4BMNA 4PC2A 1LFAA 3MINB 1VGVA 1RYFA 4QJ5A 3IA7A 1IU9A 4AUKA 1VJGA 4J2OA 3NHLA 2BM8A 4JBXA 1L4EA 2I2BA 3O47A 2A7XA 1BEUB 1Y1QA 2GZ3A 4CMJA 3QBTA 5EXDA 2GFIA 3MJSA 4Y2PA 4DG8A 4K03A 3IMFA 2EHDA 2PT7A 3JVEA 1KYVA 2G88A 5ALWA 3SQDA 2E48A 4AC9A 3DVAA 1ZVVA 2A9FA 1R0BA 3LYUA 3TM4A 5IM5A 1USWA 3I2GA 5KTPA 3E05A 2WFMA 2AN1A 2GEJA 3GZNB 4RTQA 5C8ZA 2ONCA 2HJSA 4ANFA 2DWUA 2PDAA 3R7SA 5A5EA 4PLVA 2UUOA 1WXDA 1M66A 2AH5A 1P7PA 4LOIA 4OHOA 1D7OA 2VRCD 3E9ZA 3OWOA 4QU0A 4FR2A 3LLSA 4UE2A 2CLEB 1TYZA 4ER3A 2WM2A 3STWA 2V7TA 1CJCA 1DBPA 1REQA 2VSYA 2WE8A 2ZJBA 3IOBA 3AR7A 3LGXA 3O31A 5AKZA 1G9TA 3RS4A 1XL1A 3N0XA 4EYGA 1LU9A 3BXOA 3KUXA 3BGSA 1G291 1EZ1A 1YUMA 4ZQCB 2Q2OA 3KJGA 4NEHB 1QWSA 2VZ9A 4UEWA 3ZD8A 4HNAA 2Y05A 4RLSA 4BATA 3R8FA 2PUTA 4PO3X 3ZU2A 1WB9A 2AFIB 1ZDMA 4X1KA 2VBGA 2Y4NA 1NI4B 2FPGB 2OG1A 3C74A 4G85A 4RLFA 5ALPA 2I2AA 3HZRA 1B4DA 5FX2A 4QUHA 4YEDA 5EQFA 1JHVA 2FWRA 2W2LA 4M1EA 2HYDA 1Z0FA 2NGRA 1CV2A 1UMCB 3V8VA 1B6GA 1I9GA 1CULC 4EHFA 1X70A 4Y2HA 5AVZA 3AF2A 2R1UA 4HN4B 4KQ2A 3CIOA 5JAUA 1VIYA 2P5TB 1PT9A 2FF5A 3FOWA 3NHYA 4GI5A 1ENZA 4ZANA 5FUXA 2FVYA 3M5DA 5FI3A 1JJBA 4L73A 1AN9A 3DD1A 3PXGA 4BFWA 3TW8A 3N05A 2QTNA 1M2EA 1R37A 3I30X 4Z54A 3MWEB 5TQJA 3SM3A 2QBYA 4JJ4A 5FTMA 4L4ZA 1NBEA 1GIAA 4Y2UA 4MPRA 2I3GA 2Q4EA 2HK9A 3GNSA 3KCNA 3MSCA 4W99A 3FLEA 3KM0A 4S1WA 2Z6AA 3A6ZA 1KSFX 1X7XB 2GRAA 1YBAA 2COKA 3H75A 3QOXA 2FNAA 1KVTA 3SQNA 4U02A 2Q3BA 4EPTA 4RTRA 3TR0A 2B82A 5E7JA 5GONB 1U6JA 3MAAC 2YVUA 1N77A 4XIYA 2C4UA 1DEKA 1ANKA 1K68A 2J3DA 2R8XA 2WVJA 1YMUA 1YZYA 1NYLA 3LHSA 4GI2A 4CM3A 2ZZNA 4XSHA 2JK1A 3VJMA 1U4NA 5FL7D 2MMCA 3FWKA 4J94A 4JYPA 1I7SB 4FD3A 1I0ZA 3QXXA 4L9SA 5ALUA 1XLTA 2CLFB 4CF3A 5BMVB 2H00A 4ZT3A 4YC7A 3S3TA 2C9MA 2VDVE 1VBNA 4BO1A 4DMKA 3IO3A 5HF5A 4WVFA 2CMFA 1NLYA 1IMOA 4X1IB 2PKYX 1URPA 3ETCA 1A1SA 4R68A 2GN1A 4DS3A 1U4OA 4I5EA 3QYPA 4E13A 4U2KA 4D9CA 1JKXA 3X1WA 3OE5A 1KI7A 5ANRB 1P5JA 3DO8A 4KO2S 1YR6A 2IA5A 2BFEB 2K4MA 1OF1A 1N32B 3D64A 1EVQA 3IT1A 4A15A 4Y0NA 4CU2A 3H11A 4G1CA 4H7KA 3ZI7A 1YSCA 4PAGA 4XVQA 1IUOA 2LBPA 3T7KA 3GFPA