5CD1A

Structure of an asymmetric tetramer of human trna m1a58 methyltransferase in a complex with sah and trna3lys
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
288
structure length
281
Chain Sequence
SFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
total genus 57
structure length 281
sequence length 288
chains with identical sequence D
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5cd1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5cd1A02
1IY9A 4AUKA 4OA8A 2FK8A 4ER3A 3G8AA 4U7PB 4EVIA 3CBGA 1VIDA 1SVUA 3MCTA 5EMKA 3EVAA 1JSZA 1ZGJA 5HIIA 2UYHA 5C0OE 4Y2HA 5GM2A 5EEHA 4E2XA 1ORIA 3SMQA 2BR4A 2Y1XA 1JG1A 2C7QA 3FPFA 3IYLW 1EQAA 2BM9A 5EVJA 4DQ0A 4Y30A 2B25A 2FHPA 4MTLA 2Z6QA 4EKIA 1FP1D 1X19A 1O9GA 2IH5A 1YB2A 4P7GA 3FPGA 3SXJA 3EGVA 3IV6A 3MHTA 5F2NA 3HM2A 4R6XA 3HCCA 1RJFA 5LQKA 4GOND 2Z6AA 5B1SA 1XXLA 2C7OA 4BP3A 3FUXA 3KU1A 4V0RA 4PIPA 2BZGA 3SX0A 3SSMA 1WG8A 2K4MA 2OBFA 5GIOE 1ZQ9A 3FUVA 2PX4A 4FT4A 3HCBA 5EMMA 1JTFA 3TLJA 2YXLA 3GRUA 3REOA 5DPMA 5CUQA 2ZFUA 3LDFA 3PVCA 4QQNA 4AZVA 5LSAA 5LR6A 5CIYA 3FTEA 1TW3A 3OPNA 4RX1A 1M6YA 4XCXA 4C06A 1TPYA 4PYOA 4LG1A 2AOTA 2OZVA 3NW9A 5HILA 4EMSA 1FJXA 4OQEA 2ZZNA 2NP7A 3THSA 2NP6A 1NW8A 3KQYA 4FGZA 4FSDA 2QRVA 4OA5A 3TQSA 3NMUF 2IBTA 3EVBA 2LD4A 1H1DA 5KYGA 3RW9A 2ORED 4RTJA 3A7DA 2IDJA 3TRKA 4E30A 5LQJA 4RVHA 2WA2A 1PRYA 5D1HA 3LBYA 3NDIA 3DOUA 5DM2A 4YMGA 5BXYA 5K0JA 3B5IA 1SKMA 3DMGA 3O7WA 4KVZA 5K09A 1JG2A 4XUEA 3FRHA 1BHJA 3UJ8A 4RTPA 4E2YA 1B42A 2HV9A 1NV8A 2EG5A 2FYTA 3DUWA 5DTMA 4CTJA 2ZBPA 3DLCA 3G2MA 1XDSA 5EKXA 1R8XA 4QQKA 5K0GA 4PYIA 1VP3A 5U4XA 1R8YA 2AN4A 2BR5A 3T7SA 3LCCA 2Q41A 3KPVA 5GWXA 3ER9A 4RTLA 1L3IA 2CKDA 2PSSA 3PS9A 3D2LA 1WS6A 3KQVA 1P91A 3RODA 4MIKA 4PINA 4DZRA 5CVJA 3AWIA 4FS8A 5CVDA 1G8SA 2OPBA 4JXJA 5EZSA 5F2OA 5T64A 3TMAA 3DXYA 4PGHA 2FCAA 2QY6A 3B3GA 3RIEA 4ER0A 4XUCA 3GRYA 3GU3A 2UYQA 3HVJA 4P58A 3TFWA 1NKVA 1UFKA 5FWDA 3BKXA 5K0BA 1D2GA 3VC2A 2JH9A 5GINE 4X63A 1RJDA 2GLUA 3FPHA 3OE4A 2PT9A 3A27A 5FA5A 3LDUA 2UZ4A 3AXTA 5DM4A 3HCAA 2A14A 4RTOA 2CMHA 2O06A 2ZZMA 2AOVA 3ERCA 3QOXA 2ONYA 3QV2A 4OBXA 4C03A 5LQCA 3EVCA 1XDZA 3A7EA 5FQOA 2AOUA 3NJRA 5EC8A 5CVUA 4E70A 1AV6A 1WY7A 1U2ZA 1PJZA 2JG3A 3CC8A 2FK7A 4X61A 2CWWA 3MERA 3FYDA 4NECA 5E8RA 3LPMA 1TW2A 2EFJA 2PXAA 3LECA 1T43A 3DXXA 3I58A 4RSRA 5HFJA 4X1OA 4YV0A 3P9IA 4RTKA 4EKGA 4X60A 5M5BA 2PBFA 3NVKI 1L1EA 3OU2A 4BP1A 3MGGA 5K0NA 2JHCA 4FZVA 5JR3A 5KQRA 2IDKA 3CGGA 2ONZA 5HIKA 5KQSA 1QAMA 1ZHFA 3G89A 3G2OA 4QVGA 2PY6A 1KHHA 3LKZA 4PCAA 3PTAA 2O05A 5FULA 3FPEA 4PYKA 3FTDA 3GO4A 5K03A 1I9GA 1I1NA 5KVAA 4XUDA 1RI1A 3R24A 3K0BA 9MHTA 5E1BA 1I4WA 3OU6A 3M4XA 5E9WA 1N2XA 3BZBA 3HCEA 3OFJA 4CKBA 4DM3A 1YFJA 8MHTA 1EAMA 2PX8A 3R0QA 5IKMA 2BR3A 5EG5A 4PWYA 2ZTHA 3M33A 1F3LA 2EJUA 1X1CA 3OCJA 3VC1A 2VZ9A 1EJ6A 2HTEA 1D2CA 2AS0A 3E8SA 3NWBA 2VDWA 3MAGA 1KPGA 2G71A 2G1PA 1HMYA 3DMHA 4HG2A 1WXWA 2JHPA 3HA5A 3HVHA 3ID6C 3PT9A 5EHIA 3T0IA 4E2WA 4DA4A 2ZSUA 1RI4A 2ZBRA 3G5TA 3LBFA 3LCVB 4U7TB 4KIFA 3BKWA 3GJYA 3V97A 4E31A 5CD1A 5GOZA 1KXZA 4QPPA 2P1DA 2P7HA 3SR4A 3LL7A 2G70A 1DCTA 4PNEA 2YXEA 3P9NA 2P8JA 1UIRA 4F85A 3EVGA 3KQSA 4PYQA 4YUWA 3DR5A 2AVNA 1KP9A 3AXSA 1KR5A 3SVZA 4POOA 3C3PA 3NTVA 3NVMB 2G8NA 3TPZA 1RI3A 2HMYB 4KWCA 1YZ3A 3L8DA 2OO3A 3FUUA 3CCFA 3CKKA 1L9KA 3P71T 5EIWA 2HNKA 2ZWVA 4C08A 5GP1A 2G72A 3FRIA 5GIPE 2AN5A 1FBNA 2VDVE 4GF5A 4PONA 4RV9A 3KPYA 4RWZA 1NW6A 1P39A 3S68A 3HEMA 2YQZA 3UA4A 2C7RA 2PXXA 2NNWB 1FPQA 4ZTBA 3LX6A 3OU7A 2B3TA 3H2BA 3DH0A 3I9FA 4HTFB 2AOWA 4CKCA 1QZZA 4GOMD 3FTCA 3LHDA 2PVCA 5C9ZA 3BGVA 3GXOA 2AZTA 2QM3A 4IKPA 3HA3A 4DF3A 3GRZA 4HTFA 5FA8A 4BY9E 2PWYA 2OY0A 2ERCA 2PT6A 3HA7A 3KPWA 5KS2A 3C3YA 4GOLD 2ZIGA 2N47A 2CMGA 2PKWA 2ZIFA 5E1DA 2NXEA 5FWAA 2H1RA 3TR6A 4EQZA 5DWQA 1HNNA 1F38A 1RJEA 2YR0A 3KR9A 1OR8A 4R05A 3TM4A 4YV2A 1JTEA 5EMLA 1QAOA 2YUIA 3PFHA 4WVLA 3CVOA 3DULA 3X0DA 3O4FA 4C04A 3B89A 3BUSA 5LQRA 4GBED 1N7IA 4X41A 1JG4A 3UFBA 4C4AA 1WZNA 1ZGAA 3KQWA 5EZQA 3THRA 4AZSA 2PX2A 4AX8A 5BP7A 3BWMA 3P9KA 4CTKA 3G7UA 3OFKA 3UJ9A 1X1DA 1SQGA 2IPXA 4E32A 2XYVA 1SUSA 1IXKA 5EKUA 1NW7A 3T7RA 5ICEA 2UYCA 1EIZA 5G02A 3HCDA 2PJDA 2VS1A 2HWKA 1YF3A 1JSXA 2JJQA 4H0NA 5E8JA 1AQJA 1IM8A 5ERGB 1KPHA 1VPTA 2PGXA 3BGDA 3KQTA 4C07A 5JUWA 5DM0A 3EVZA 3G8BA 2YXDA 3P2KA 1QAQA 4QTTB 3KQPA 3EGEA 5E2BA 4RTMA 2CL5A 1XTPA 4FR0A 5DTQA 3UJBA 4RTQA 1VLMA 2Z6UA 4YUVA 3KR1A 5C1IA 3BWCA 3FPJA 3G88A 3R9XB 5K0EA 2I62A 3ELYA 2P7IA 3KR2A 3SM3A 1VE3A 5ICFA 2DULA 2PWPA 3OZSA 4LWPA 2P41A 5DX1A 1Y8CA 4LECA 5DLYA 3WSTA 5K0FA 1N7JA 2ZWAA 2GAFA 2XYQA 1R74A 4IV0A 4BLVA 2BM8A 3UA3A 1KYZA 5HEKA 3HTXA 4QVKA 2VDUE 3JWGA 2AOTB 3EPPA 1R6AA 3P2EA 1NE2A 3M6UA 4R8SA 1M0EA 4RTNA 3HNRA 5E1MA 5E9QA 1DUSA 5DM1A 2QRVB 5DRYA 3SSNA 4RVFA 4HRAA 2R3SA 4P7JA 5GM1A 5EGSA 3BT7A 1G8AA 3M70A 1SQFA 4M7RA 3AY0A 3EEYA 4A6DA 3Q7EA 3KQMA 2HR1A 3EVEA 2AN3A 4MWZA 3LSTA 4PCLA 3SSOA 5EEGA 4YUYA 3EVDA 1NW3A 2F8LA 2NXJA 3FUTA 3BWBA 3AJDA 4QTUB 2IFTA 2NXCA 2B9EA 2NYUA 4FT2A 3B3FA 2B78A 2JH8A 1G60A 4OBWA 1JG3A 1YUBA 1KPIA 3FYCA 2IH4A 4QPNA 2ZIEA 4O29A 2ZCJA 4ER5A 2P35A 5FADA 5T67A 4AZTA 2OB2A 2FPOA 3TM5A 2ZVJA 1NV9A 4KDRA 3NWEA 4P7FA 4WXHA 5K05A 3HP7A 3JWHA 2ESRA 5CCBA 3P8ZA 1RI2A 4KIGA 1ZG3A 5E1OA 1ORHA 1VL5A 3BGIA 3ME5A 1INLA 1DL5A 4L7VA 2EJTA 4GUAA 3ELWA 3GRVA 2EX4A 2R6ZA 1VP9A 5D1NA 2ZULA 1G6Q1 5DT2A 4ATNA 4F84A 3ER8A 2OKCA 5E9JA 1X1BA 2XBMA 2B2CA 5P8WA 1RI5A 1JQEA 1YZHA 3KR0A 3TKYA 4MHTA 1BKYA 3PLAE 4OQDA 5DX0A 3I64A 3TKAA 3JWJA 1SG9A 3C0KA 5CVVA 2PLWA 5ICGA 2IBSA 1VBFA 1WXXA 3KPUA 5FCDA 3GWZA 5HOQA 5BW4A 5DSXA 2AOUB 3LCUA 4KW7A 2I9KA 1P1BA 4HSGA 4YUXA 3GCZA 4RVDA 3MQ2A 5IH3A 5K0LA 3UJCA 1Z3CA 2Y1WA 1SUIA 5DX8A 2FRXA 4CWAA 4CKEA 3DTNA 4DCGA 1BC5A 5FHQA 2C7PA 2PX5A 2GPYA 3GIWA 4DKJA 3PFGA 3UZUA 5LQAA 2E5WA 4PGGA 4DMGA 2V7EA 3M6XA 3R3HA 4KRGA 4LWOA 3KPJA 3R6TA 5FTWA 1AF7A 1JR4A 1V39A 3MTIA 1D2HA 4MQ4A 3GGDA 2H00A 2O07A 3PX3A 3EEOA 2GS9A 2XVMA 3A25A 3K6RA 3DLIA 3DP7A 4P7KA 5EMJA 1G55A 5EHGA 3GNLA 2AR0A 1NBIA 1BOOA 1XCJA 2I7CA 3B7PA 4PYNA 2GA9A 3P9CA 4IV8A 4CXMA 4GQBA 4ER7A 1YFLA 3B3JA 4F86A 3UWPA 1Q0SA 3ORHA 3GDHA 4YMHA 3MCZA 3OZRA 3PX2A 1G38A 10MHA 4OX9Y 3P97A 1XJ5A 5DSTA 5FHRA 2QYOA 3A26A 3GRRA 1RJGA 4YUZA 1R00A 2I6GA 4R6WA 3JWIA 2ADMA 3OE5A 4R8RA 4ISCA 4RVGA 4QDKA 4FSXA 3LKDA 2QE6A 7MHTA 1XVAA 3EVFA 4HH4A 2ZZKA 3O31A 4K6MA 4RTSA 2AOXA 2P3OA 1NT2A 1L3CA 5LQUA 2IIPA 4RTRA 5T6BA 2UYOA 2ZBQA 2WK1A 3HCFA 3UJAA 4PYJA 5ICCA 5K01A 1M6EX 1R18A 3CJQA 3KQQA 4GC9A 4PIMA 5EPEA 5CVEA 3VYWA 4Z2YA 3UBTA 1MHTA 5K8VA 3SGLA 3E7PA 4E2ZA 3KQOA 3MTEA 4M36A 3UJ7A 3IEIA 3G2PA 4M37A 2YX1A 3LDGA 5EOVA 3BWYA 3U81A 4EK9A 5EQJB 2ZLBA 3FZGA 3C6KA 2BH2A 3UJ6A 4E33A 3C6MA 3DMFA 5DRTA 3QOWA 3P2IA 5HIMA 3NDJA 2GH1A 1NW5A 4HGZA 2OYRA 3ANXA 4PYMA 3EMBA 5EIFA 5DXAA 2VP3A 1ZKDA 3EMDA 5H02A 4B17A 3VSEA 3UJDA 4M38A 2WA1A 2H11A 2IP2A 5MHTA 2OB1A 1JQ3A 1JQDA 2IH2A 4HC4A 2JHAA 5CM2Z 4BLWA 4GOOD 1KIAA 2KW5A 5FUBA 2YTZA 3PB3A 4GC5A 2O57A 5CCXA 4IWNA 3E05A 5HZMA 1XCLA 3KHKA 3OZTA 5FQNA 3IHTA 3MB5A 5BW5A 1EJ0A 1VQ1A 5K0CA 3EGIA 3V8VA 3FUWA 2V74B 4PYLA 3A4TA 4BLUA 1P1CA 3KKZA 2AVDA 2P40A 3E23A 2P3LA 3CJTA 2NXNA 4RYLA 2O0LA 3FTFA 1EG2A 1QANA 1X1AA 3G5LA 4C05A 1O9HA 1Q0TA 2IGTA 1XDUA 5DTRA 4AZWA 3TOSA 2P3QA 5F2KA 3HVKA 3Q87B 2XVAA 3ELUA 1UWVA 4QDJA 5DXJA 1MJFA 4YV1A 4DCMA 1O54A 4V0QA 4ER6A 4A6EA 3T7TA 3I53A 3M6VA 2PXCA 2DPMA 3M6WA 2PV0A 4G56A 4KDCA 5LQNA 3LGAA 5E2AA 2XYRA 5HIJA 3F4KA 1AQIA 1L3BA 4FP9A 4GEKA 2OXTA 3CJRA 2ZW9A 3G2QA 4UOEA 1KYWA 3BXOA 3I5UA 3DXZA 4HGYA 1NBHA 3ELDA 3HVIA 1QYRA 1FP2A 2GB4A 2YVLA
chains in the Genus database with same CATH superfamily
1I0LA 4UKDA 5HM8A 2ACEA 3DVAB 1JB9A 1R4AA 3E9DA 2Z57A 2ZRNA 3LC2O 1KH1A 4K9RA 4OQLA 2HRZA 3U3KA 1ZGJA 2DJIA 3PUZA 1G8PA 3Q7TA 4R2IA 4YJ2B 4B4KA 1KFKB 1U1EA 1DRJA 1A8HA 4YCDA 2ONKA 1SZPA 1RW4A 4ZCTA 5D87A 3H0EA 4EB8A 1EXDA 2BGGA 3K5HA 2A33A 4PN3A 1NXWA 4URUR 1W0KD 1QYCA 2HNBA 3UJPA 2K2WA 2AFHE 3NKVA 5E7MA 3SXJA 4C14A 3U4IA 1RJFA 4G0ZA 4BUCA 4A6PA 4EGJA 4DLBA 3FUXA 4YCSA 2CXPA 1VJ5A 2VK2A 1FX0A 3SSMA 4M1TA 2JLXA 5TX7A 3CW2A 2HRBA 2P6MA 2WJGA 3NBYC 2QTMA 1DB3A 2PU5A 1Q7BA 3IQFA 2GXSA 4U2FA 3U7JA 1DFGA 3DO5A 3R7AA 2P5YA 3GLGE 3VPGA 5D5QA 1NBAA 4JV5B 3PEVA 2VLIA 1R4MA 1IY0A 2QR5A 1E1QD 4P3OA 2QT9A 3LZDA 4QYXA 3G79A 1B6GA 3C6QA 1QGAA 4ENWA 2FFQA 2HREA 4X8LA 5B1EA 4EHLA 1UDCA 5KYGA 3N05A 3MS4A 4QDTA 5TQVA 1H8EA 1U0JA 4D3ZA 4M8LA 4HEJA 3KVOA 5K0FA 3IKVA 4B6EA 1ZZEA 4MV4A 3LA6A 3WBFA 4QSHA 3S0JA 3PDIB 3GLSA 5FLKA 4EYOA 4F6RA 2FDCA 2D1YA 1YASA 3ZVNA 2DCUA 2XTJA 3DR3A 4OH1A 3FWNA 1OASA 2RIPA 3EWNA 4KZPA 7REQB 3WL6A 3DUWA 3AI7A 3LCJA 1U90A 3IIMA 3PSAA 4PZ9A 5CB4F 1JAHA 4PLGA 2IXFA 1D5CA 2G4LA 3INNA 5C8XA 1H2HA 5K0GA 3T7SA 2JLZA 2YS7A 2ZJ5A 1UQRA 3O4HA 1IOLA 3Q85A 4M9UA 4GP9A 5G0SA 4KQKA 4UHEA 5JSZB 4L4ZA 2GKGA 4FHFA 1T91A 4K3UA 5KKNB 5CVJA 2IS1A 3MS2A 3TI7A 4F91B 4PGGA 3ZJ5A 4CT5A 3P4YA 3NP7A 2EWVA 2DCMA 4QOSA 1U2DC 3RIEA 3T0GA 2CMFA 5TMEA 2QIOA 1NKVA 5FWDA 1R0WA 5JJKA 3QK7A 2E5LB 3VR5H 1A9OA 4PZEA 5BOVA 1J7KA 1EWTA 1CP2A 1G2PA 5IFLA 1W5AA 3E8MA 4OQPA 1TYCA 4A16A 5AVUA 3K09A 1YB1A 1JIVA 2HKIA 3GJSA 4Q7MB 4NBNA 5TGTA 2RGDA 3B1VA 1PUXA 3UMJA 4DYVA 2IELA 1S2IA 2ONYA 4ENTA 3EZYA 2GXAA 3A2KA 1Z16A 3CY6A 4PFQA 4BQSA 2H5JA 3G2HA 5CT6A 1C3OA 3ZJUA 1RP1A 4MO9A 4Q05A 5FV4A 4H16A 4YECA 2C7BA 3QYAA 2EJCA 3LQ2A 4QU5A 3WGGA 2HYIC 2FX5A 3B9PA 1CQIB 1RAGA 1KI8A 1AF4A 3G0IA 4PM4A 4RVNA 4X61A 1XHEA 2X4LA 4BWFB 4DN6A 2JIQA 2PTGA 1AK1A 4U7JA 1EFUA 3T3DA 1WD5A 3QFFA 1CRZA 1LF0A 1T4DA 1T5SA 2WMYA 3BIFA 5JMPA 2DUMA 3G0GA 3CNEA 3NIDB 1O2DA 4P3NA 5HFJA 1W5SA 5BUZA 4EKGA 1Z8FA 2VP2A 1RVV1 2OL4A 2PJUA 4K2AA 4UUOA 3WYDA 4Q7EA 1LFDB 3LRPA 1MAVA 1G291 4Q24A 2MSKA 2FZKA 1VOTA 2UXCB 3C4JA 4YN3A 2A9OA 5CHYA 5A9SA 4DRXA 4PCAA 1WBDA 4A0SA 4WNAA 3A1CA 1FYDA 4GQAA 2AFHA 4FGKA 1DP4A 3GGGA 1GLGA 1F8XA 3Q12A 4UNPA 5T5QA 1ISRA 4OHZA 3M4NA 5AW8A 5KYKA 1ORTA 2WIJA 4WCFB 5EFOA 1E1RD 4YR7A 4N0EA 1OHHD 5G4KA 1I51A 2XE4A 4EWLA 2J3MA 1O4WA 1QHGA 3JSXA 1RSZA 1OV4A 1UC8A 3ESBA 4R9VA 1A8SA 1MJGM 4X7PA 2NV0A 1UPBA 3LHIA 1Z0ZA 3LA8A 4V0OA 5IBQA 2KWIA 3MVEA 2KYRA 2I3ZA 3QGMA 3VBEA 4A9AA 1VMKA 2MMGA 5E38A 4BVAA 5JS6A 2JK1A 5K0SA 2G1AA 4MWEA 3NXSA 5JXGA 3SHQA 4HLNA 3E9ZA 1ZR4A 1K8YB 3HBLA 3NHBA 2G71A 3BL8A 1M2EA 4Q7KA 5EUBA 4KMOA 1WXWA 5DIFA 4B45A 1QIMA 1AUPA 2IK8A 4NU8X 5COBA 2X4DA 3RJZA 1OLSB 4RF5A 2H52A 3GR6A 4UEQA 4E2WA 4YJHB 2UZ0A 3I9LA 1TMYA 1DCTA 5D3QA 3SXUA 1KXZA 5ERYA 3WB2A 1XNRB 5FTMA 2V6FA 1JYEA 4OLJA 4OSEA 5FPQA 4F85A 1H6AA 1TMOA 4NHOA 4QEDA 3T8YA 4ETWA 4Z8XA 4LF5B 4IG9A 2XNHA 2Q5LA 2WJVA 3JASA 3SF0A 2NV6A 1C9NA 3DKVA 3IP9A 4FFWA 3M6FA 4Q16A 1NX9A 1KQFA 4CGZA 2HQOA 4TKZA 2WJAA 2HNKA 3OWXA 1V2HE 1T9KA 2FSUA 2AN5A 1NDUA 2OAP1 3UAOA 3NV7A 1QXSA 3HG7A 3ZVLA 2ZB3A 3RSCA 2JC3A 4XRRA 2PL5A 4PF1A 4A3SA 1LC3A 4JYPA 4CPDA 2BEWB 2YQZA 2J4DA 2PH3A 3AIOA 3BH7A 3RUAA 1ZD4A 5EFZA 3JYHA 1TTHA 1GTSA 3D3JA 1TVEA 3VMFA 4WACA 4GMKA 4RESA 3T3GA 3BGVA 1LVUA 1TJNA 4I55A 1DAFA 4MQEB 4UCWA 1S3IA 1Q11A 4YWHA 1EDOA 1JLHA 3RH0A 3CR7A 3CIFA 2XSZA 2CHUA 1L7RA 1VSQA 2QPLA 1GRRA 3ICCA 4N39A 2H65A 3MWDA 2X9LA 3CF2A 3QVWA 1HNNA 3OTWA 5AI5A 3KR9A 2ST1A 3TKLA 3ZDZB 1EAYA 3O8OA 2ZG6A 4LF6B 1U8EA 2QM8A 4D4IA 5FTJA 4IZHA 3G2LA 2NZ2A 3ZHRA 2B8JA 5LQRA 1T34A 2MTBA 1P9LA 3TQIA 3LYLA 2EFEB 3LP5A 4G5XA 4TMFA 1Q0ZA 3RTBA 3IAM1 1G20E 1WTCA 2CFOA 3E2PA 3RRXA 1ZGAA 4I9NA 3K6SB 1O6GA 1E6EA 5FPPA 1IAQA 3BD7A 3DL0A 4R2HA 3W3ZB 2IPXA 1BJTA 4URWR 3TMYA 2XYVA 4DLSA 1RCTE 1X1EA 3O5AA 1IXKA 3PUVA 1NW7A 3K3PA 4L6AA 1X77A 2I1LA 1FS6A 3G1TA 4Z9AA 1RIIA 4RUKA 5C3MA 3AX6A 3R09A 3GGPA 2A30A 4K6HA 3T5AA 3CWZA 1E64A 1TM3E 5E7IA 2FCRA 4MCJA 1V11B 3ENWA 2PGAA 5EXSA 3W3AD 1JVNA 2WJPA 3AEQA 5AK0A 1X15A 3OMXA 4NDZA 1Y1LA 3PICA 4P6VF 3RRZA 1RWQA 2RH5A 3KQPA 5A4KA 2PZ8A 3HKBB 2GZDA 4P35A 4L22A 1N33B 1VLMA 2FG7C 3OUUA 2ZJYA 4RS3A 5GVRA 1RDFA 4YUVA 3R8CA 4F0JA 3V7FA 3N2ZB 4PG8A 3THXA 3EAGA 4RV4A 4OO3A 1CZHA 3X44A 4XDZA 4XCVA 4G89A 1YAHA 3I4LA 2CUNA 1V47A 4OQFA 2DG2A 3UHFA 4O3FA 1USIA 5KYUA 4B6GA 3ZR4B 3BICA 2CK3A 5AW3A 1ZN2A 3OPXA 3C8DA 1TQ6A 2AOTB 3HJAA 1Q44A 4L7QA 2H2AA 5YASA 3TMKA 3U9LA 1UBTS 2YOFA 3KTAA 4A8PA 3GA0A 4PRZA 1JHAA 3W04A 1HE8B 4EY3A 4F93B 5ALSA 1QIJA 2QEQA 1CRPA 1RLOA 2JATA 5D86A 1OXMA 3CT4A 2R3SA 1BXGB 3CKLA 2PK3A 3UN1A 3L5KA 1D1QA 1EFAA 2HR1A 2X6RA 1OFVA 1V8FA 1FK8A 2E5FA 3LO8A 4UATA 3WMWA 4JWTA 3ZE9A 4MQBA 1L7NA 1V6AA 2CDNA 5LMCA 3I2HA 1NW3A 1E1QA 1U2TA 3M6IA 4GI3A 5EMNA 4BO4A 1YAJA 1M2GA 1T35A 2G06A 2GZ3A 4RK7A 4Y2VA 4HLUC 1YJCA 2XMPA 2XTNA 1ORVA 5H3LA 4O4LF 5HFNA 3ZQJA 1TTTA 3LWBA 3RNLA 1J5PA 2OUIA 3NWOA 3KELA 3KOUA 2ZCJA 3QBTA 3IJ5A 1EX6A 4AZTA 1R1DA 4I50A 4DCVA 2ZANA 2X0NA 2O3TA 1JU4A 4O4HB 2H51A 4KYUA 3HUUA 3SDZA 1OVGA 1ZG3A 3R5FA 2ECFA 3OECA 1WU8A 3SJZA 1SHJA 2ZKIA 3DW3X 4FM9A 4N8SA 2VQDA 2FW9A 3MBKA 3X1WA 2VDOB 5A6SB 1NP6A 3FSJX 3UY4A 4F96A 1XI2A 3PFKA 2Q5OA 2GF0A 4LPSA 3WQBA 3SX4A 3GLIE 4JS0A 4Q9AA 5B64A 3TW8B 4WVFA 4AS1A 1UT5A 2BHLA 2QLLA 1V1MA 3JD3A 4O1MA 2B2NA 3EGXA 3WWOA 5HXAA 4TYYA 4FYXA 2GBPA 1ZOOA 5AFSA 3ETGA 5JPIA 3KWJA 4ENRA 3TLGA 4PBTA 1FDUA 5G1OA 2OZKA 3LCUA 1D1PA 4D0NA 2BGTA 3HMKA 1GUFA 2I8AA 5DHRA 1Z5UA 1YGPA 5IH3A 1OLSA 3K2QA 3B38A 2EBUA 4J1QA 3TGPA 1REQA 2GN6A 4D97A 4X6UA 3V9AA 2C58A 1BC5A 3L6EA 2ZSDA 2LKCA 3PITA 3JS5A 4FEAA 4E5PA 2HJHA 1XRPA 1YIDA 1TRKA 2PEZA 3A3OA 4XQCA 5CDFE 5J4KA 5FTWA 3UWMA 1NIJA 3G0CA 1IHPA 5FUXA 3RVOA 4CEJA 1WXHA 2JGLA 3QQ5A 3B9RA 3MF4A 2ZATA 2P27A 1GZUA 4I6EA 1VHWA 3I2YX 5BSMA 1AGRA 4GRAA 4F5DA 1SIOA 3WZ2A 4MV0A 2I7CA 1HR0B 3I9KA 3KKPA 1I4EB 4EJSC 1UMKA 1Z7EA 4BNFA 5LUAA 1T13A 1KO1A 1XTBA 4YMHA 2QOEA 4XYEA 2RGNA 3QFHA 1DKOA 1A71A 1UZUA 2HMAA 2QJOA 4AT1A 1JHYA 3ZGYA 2F67A 1BKDR 1F17A 3LBIA 3F8SA 3P9XA 4JXZA 5B30A 2XKJE 4PTZA 1ZCBA 2I6GA 3IIKA 5AM1A 2O52A 2PQ0A 5DHTA 3OLVA 4R8RA 1WXGA 2BGIA 5DBIA 3K5PA 3QM1A 4F97A 5L3SB 1ENZA 4MEJA 1U9ZA 3CUTA 4Y0NA 1SZCA 3U4GA 2PS0A 3VSBA 2P3OA 3ZUGA 1H2FA 5JW6A 2RHMA 4FYVA 5FNVF 5LU8A 1XQWA 1U6KA 3OHPA 2R1UA 4N03A 4PZCA 3MTQA 3GD7A 1RNLA 3NCHA 1NUTA 4TLCA 2J9GA 3L7NA 4TMVA 1NFFA 4BLQA 3DMPA 1M67A 4FC6A 4LWZA 1VDMA 4KPEC 2I3BA 1E4YA 3IKTA 2O7SA 3JAKA 4TVSA 4ZA2A 4KQFA 2HYDA 4BFUA 5BN1A 3KOMA 2BDUA 1V5EA 2AG1A 4DQKA 3FBWA 1RC1A 3QOWA 2PE5A 2SKEA 2AC2A 4JX8A 1XNQB 2QQEA 4DQLA 1N6OA 2WZBA 4UQOA 1J09A 1ODIA 5IDYA 3W0LB 1JHQA 2VP3A 5C4IA 3VSEA 1C3VA 4LGCA 3BK1A 4WFJA 5I7HA 2XCUA 2WA1A 1OBFO 4KR6A 3H8VA 3R2JA 1GY8A 4IL5A 4DV6B 4F3TA 5L4SA 1VLZA 3IAHA 1OOEA 3L18A 4I1UA 4JOCA 3THXB 1JFVA 3W8NA 2FOLA 2OGSA 1KS9A 3DBHB 4LTDA 2CVFA 2J3QA 3H05A 1J1ZA 2JD1A 3MTDA 3EN0A 3TGLA 2G83A 4PG6A 5FFNA 5BW5A 5KHOC 2HGSA 1ML4A 2CLFB 4B6JA 5JQGA 1PZEA 2C2MA 1P4RA 2I4IA 1F3OA 3O73A 3A9CA 2ZDGA 4QHTA 4ZU1X 3SC2B 3CSUA 5A7HA 2QSYA 4HLQB 4DSOA 3H75A 4QASA 5K7SA 2C96A 1P8AA 1RBZA 4HI0E 4RLQA 1C0KA 4WA8A 4ETNA 2DFNA 3NYQA 3OI7A 3U80A 2VDJA 3KWLA 2VXOA 3OO0A 4MVWA 5C7IO 3LX5A 2H57A 2B98A 5DK4A 2OV3A 2ES4A 4TS1A 4YAIA 1AHPA 1E1CB 1DO2A 2C2ZA 4JKYA 4NEGA 4R9NA 1HFWA 5F73A 3VVLA 4HB2A 2X3FA 1HLFA 2P3QA 2X0RA 3C1UA 4RLHA 1C1XA 4CDMA 1MV5A 4DCOA 4BOYA 1XZJA 2O19A 1WUIS 4YV1A 3QVSA 4IIXA 1DHRA 2FRDC 3PDUA 4P08A 3T7TA 4AJ4A 1QV6A 1Y5LA 4LXTA 4ER6A 5LQNA 1JZTA 1Q92A 2VJCA 5CURA 4F2HA 4AIIA 4P53A 3EE6A 2IYRA 3F4KA 5GJVC 3KKEA 3ORYA 4L5CA 4GEKA 4N9WA 2OXTA 2P1RA 3QELA 1X9HA 1X1RA 3H3JA 1NMSA 2WW8A 3B7WA 3RIXA 1Y9DA 1GR0A 4X3CA 4JI8B 4MAAA 4DSTA 1LUAA 1LSOA 4HEHA 2IS6A 1GFIA 2F3RA 4HXGA 1X70A 2OTCA 4R1NA 3CBGA 4MDHA 1T0HB 3E0XA 1P9NA 4GGMX 1RWVA 3EPHA 1MNQA 1OWPA 2ISCA 3IQDB 2FGJA 4TWAA 1TB4A 2BFAA 3D3WB 1JU3A 2BR4A 5AM5A 3HYNA 4P4NA 4XRGA 2UVDA 3Q9LA 4RW0A 1I9CA 2WM2A 3FLAA 3FPAA 2PS3A 5AW9A 4W5QA 1OB5A 4IVRA 4ZANA 3K9GA 1U28A 2Z83A 1DRUA 3IV6A 4LRUA 3D0OA 3ZWVA 4L78A 1ZUWA 4IWYA 2PWZA 1NI4B 4R98A 3TXAA 4OI4A 2ZS9A 3VZCA 4NJMB 4HNRA 1ULAA 1LRKA 4LGVA 3SDBA 2VP6A 4RFSB 3ZI4A 5IUJC 1P4GA 3B85A 3ZX5A 3BTVA 1IDOA 5KOIA 2JJYA 3NUGA 4UHFA 1W75A 3RK1A 2W22A 1FDRA 1FW8A 2ZTSA 4NX2A 5L3RA 1ABBA 4FYPA 2QYHA 2PRYA 1JE1A 1NT4A 1ZEJA 2GN0A 1A1SA 3DE7X 4IW3B 4P5EA 3GLFA 1FA9A 1JFRA 5BQXA 4FILA 4HHEA 3CR8A 4MRSA 2IBTA 4K81B 5FIUA 1SKQA 4B9AA 2WIKA 4BXOB 3V1YA 3FE2A 1GWNA 3CLKA 2WUFA 3HSKA 1QVWA 3NEYA 4UUQA 5GONB 3U37A 4CTMA 4YMGA 2P6RA 2A0FA 3ZVRA 3TCNA 1WLFA 3ADCA 2J0EA 5FOQA 3FRHA 5IJAA 2WHPB 4QC2A 4EFLA 4KWTA 1OPXA 3MWYW 3Q5EA 4PV7A 3VTAA 4TYNA 1YRLA 3L9XA 3K96A 1OCEA 2W37A 3HU1A 4WGFA 3C1TA 3RU2A 2OM2A 3M1AA 2NVOA 2OXCA 5HCIA 1U4SA 2BR5A 3BEOA 2Q41A 4R1MA 3BFXA 3RAJA 5BSRA 3MILA 4Q9JA 4RTLA 4NNPA 4EBBA 1UPUA 3D4IA 2JIPA 4UQLA 5TQ0B 1SKYE 3KQVA 5ED4A 3I5YA 1H66A 2J7PD 2O6LA 2PMWB 3D6MA 4INOA 1RYFA 2XB9A 4URYR 3TRHA 4C20A 4F4UA 3LY7A 3MHPA 1EVJA 1QE5A 2EKPA 4H08A 5L4LA 1KSFX 3AZPA 3FFWA 3FAZA 1QFXA 1L1FA 1MG5A 2QMOA 4GKKB 4X63A 4IIFA 4IIHA 2V5AA 4KREA 1KK3A 1Q6YA 2AGVA 3AYZB 1JFSA 2XUKA 5KWEA 4OXKA 3THYA 1MCZA 2AC4A 3GXBA 2ZGVA 1E7QA 3NEAA 3TJZA 4ND2A 2CYAA 1F12A 2AQHA 1XTKA 1Q1ZA 4MO2A 4TL9A 2O06A 3STWA 3CZCA 1NNLA 4CMAA 3UMFA 1GPLA 3R7DA 1KOJA 4ROTA 1PHPA 1DXOA 1I3KA 4KPGA 5CH5A 5KZMB 3KB6A 1N6LA 5JD6A 5ULLA 2JIRA 2WYHA 1VLHA 3G0DA 3FBGA 3GLKA 4B3IA 3EJ6A 2X15A 3PEFA 4B1FA 1J23A 1RPAA 3GJ8A 3LPMA 3EY4A 1BX1A 4I4TB 2BVNA 3LT4A 2FUNB 4TKVB 4DSUA 1T1IA 4BQRA 2VHZA 4HFMA 4RH1A 1NVDA 2IPLA 4D2IA 3FFAA 1C9EA 2FW0A 4CLEA 3HADA 3ONFA 4PSDA 5K3EA 3AF6A 2J32A 5CNIA 4CM7A 3TVYA 2LXNA 2QW8A 5IYZF 4CM5A 3OM8A 3E2MA 3KEMA 4QVGA 4GPTA 4OJQA 3WNZA 4BNTA 2CNOA 1BWSA 2QVXX 1VIMA 3QTLA 1UPAA 4WA7A 5IH7A 1X42A 1C50A 2XAUA 5H59A 4DDKA 4HNTA 4KH1A 4HQNA 4B6PA 4WJLA 3AVVA 4P3YA 1TK9A 4ID9A 2VO1A 4C43A 1ESNA 4H7EA 4Q1BA 5E6RA 2XSZD 4UTXA 3TR5A 3SICE 2QRHA 3T1HB 2YMPA 1V16A 3SXPA 1HYBA 1M1YA 2O2JA 3FIJA 4B3HA 2QD1A 3EOZA 3VJRA 3TD9A 3DBVO 1YI8A 2HJVA 2FKAA 5IT0A 4EJSA 3R9WA 3FPLA 2F6RA 2WU8A 3IJEB 4MKHA 3I9JA 4TLEA 2XOKA 1J8YF 3CIOA 4WTOA 4MS4A 2VZ9A 5GV7A 4BFCA 2I5PO 3HR4A 1QH1A 2QDKA 4W1QA 4EHBA 3NWBA 2QUZA 3H1GA 3DMTA 2O9JA 1D4OA 1QWOA 1EZ4A 1RAFA 1ZGGA 1GP2A 2P78A 2PT5A 3DD5A 3DMHA 5JS8A 2R8PA 4MW1A 2ZRKA 1GAJA 4RPJA 2NWQA 2BLNA 2EL7A 3T9FA 3TN7A 1K5DA 4P92A 2BELA 5B1IA 1ZISA 1PWEA 2VH5R 5LP6F 1YHNA 3QXHA 4X20B 4BNNA 5E6SB 2BFFB 1UFRA 3O21A 1ZEMA 4H31A 4QPPA 2YJZA 4TM7A 3SQMA 3WL5A 4CQLA 3LL7A 3OPYB 1APBA 2F3PA 5BQ5A 1ZBDA 3AUFA 2DTXA 1CZ5A 5DISB 4EFDA 5LD2B 1E7SA 4U00A 2YWCA 1DKPA 3EYWA 3E22B 4IDCA 1MFZA 3NYIA 3SHOA 3ZU5A 2OO3A 4LPKA 4CT0A 1FTNA 2PNJA 1O7JA 3COZA 3ZWYA 4HT3B 3P71T 4BJ3A 1GSIA 1M54A 2N3ZA 4JFRA 3WKBA 5A4FS 1SRRA 1ZJ6A 1ABFA 4MYSA 3HCWA 2X0FA 5J2TA 2ECOA 3EGCA 2UVPA 3MTGA 4PONA 5KVQA 3H42B 4EEZA 1QNLA 2HUPA 3HB5X 1RQGA 2R8YA 5B12A 3GUUA 2VPTA 4ITRC 4RSGA 3J7TA 1R9NA 1A27A 2A9FA 3D2CA 4HQLA 4UUPA 3IT3A 3KDSE 2Z4TA 1A2QA 4GYYA 4X5OA 2HW8A 3KIPA 3ND7A 3U60B 3FTCA 3DFFA 3JVEA 2OWDA 3G5MA 1IPEA 4LGMA 3K73O 1DAGA 1W581 3VNUA 3PUYA 2JB9A 3LDAA 4L9AA 1XA3A 1LV8A 3RUEA 3L8FA 3OJCA 4C7MA 4K28A 1U65A 4CM8A 7MDHA 2OG1A 5LQAA 3TR6A 3GJTA 4OUDB 4EUSA 2CCKA 4D02A 1KMIY 3AEXA 3NLLA 5KQMA 2I4OA 3FNEA 1JMYA 3M4ZA 1MZVA 4MQFA 5IBCA 3SNHA 1E6LA 5BW6B 3B70A 3PUHA 4FEYA 2DQZA 1LC0A 3DB2A 5CXXA 3JARA 2D0PB 1AXRA 1WDMA 1I2BA 1XL0A 2YZKA 4C4AA 5IC4A 4K8OA 2WG2A 2PFKA 1G4AE 3NTLA 5G4LA 1KAOA 1X1DA 2WJIA 4PQEA 1N7GA 1UMCB 3D8SA 1CUDA 2C57A 2OBMA 2OD7A 2X7XA 4P7BA 4N6GA 3VPFA 4BAUA 3RRJA 4OSOA 5KOHA 2O2YA 3AI2A 3HCDA 3U62A 1SBZA 3BJMA 2C00A 3S2FA 5JRZA 1RCFA 3TEMA 3NDBB 3KQTA 5JCJA 4JLPA 4NYIQ 5J2UA 2HXGA 4YUWA 5COQA 2QW1A 2P2LA 2V7PA 4FQ8A 4OP1A 4FYJA 4RACA 4XEHA 2V97A 3TLGB 3EGEA 5FR1A 4TVKA 2ODAA 1T5BA 3AR5A 4DGQA 5LBTA 3W6OA 1IXZA 2Z6UA 1K7SN 4JI1B 1E7RA 3L8MA 3G88A 4E6EA 4GYKA 2ZSIA 1F2UA 1Y3FE 2P7IA 2FN8A 5H82A 5ALHA 2XOEA 2GM3A 3OZSA 5ICFA 1AKEA 1EUCA 5LB2A 4TWZA 2VEOA 1ZCZA 4X97A 3QFSA 4A27A 3ZHUA 2REQB 2ZVQX 4YQYA 4ZOQI 2NZ8A 5B3AA 4AJLA 2XYQA 2BM8A 3SR3A 2OZLB 2ZPUA 3EEBA 3MJSA 2R11A 1DOHA 2LTAA 2O5RA 2BMFA 4KODA 5GJCA 2OCPA 1Q3HA 1IC6A 3NONA 3EZNA 2EWMA 3SQWA 5ALLA 3UCFA 4V0NA 3TZKA 3AY0A 4GMDA 3ZS8A 1YB4A 3KQMA 4B4UA 4RLFA 2EWWA 1EDBA 4GMFA 2G36A 1U4NA 2IOHA 3N28A 4ZOLF 4ENSA 3AW8A 1NPDA 4V3CA 5HQJA 3VR4D 2H3EA 3FHCB 2O8DB 4NNJA 4FT2A 4KRYA 4R01A 3ONNA 1V43A 3HBAA 4M7OA 4QBTA 5DB4A 2PUTA 3V3TA 4B43A 2BYTA 4IDEA 2ZVJA 1MW8X 1B3BA 3EZFA 4BZXA 2JPDA 2HK8A 1SAYA 4KIGA 1OKKD 1Z4PX 1IVNA 1U0EA 2AMVA 2X7JA 4R69A 4ARZB 4IJUA 4D43A 3R40A 1YACA 3BOSA 1PFKA 1XIVA 2GJKA 2ZULA 2WMNB 2BBWA 3UVEA 5EWJB 3DZJA 2V58A 4JBNA 2VZLA 1NP7A 1M1YB 3KOOA 3OIYA 5C2JB 4CG0A 8ATCA 1XRRA 2Z09A 5IN5A 3VR3A 4OQDA 3IPXA 3VR5D 4NNOA 1M1UA 1C41A 4CQNA 5HF9A 4RZQA 4WWHA 2X8BA 2HU8A 2VHYA 4YONB 5FOTA 2A9QA 2Q2OA 3QVGB 4WY2A 2C5LA 2I8LA 3RYIB 1AGXA 2X6TA 3UO8B 1WB4A 3AUJB 3ESAA 4B87A 1XTUA 3EZXA 5BURA 4XM0A 3DLBA 3BRQA 2PH7A 3F6RA 4UHCA 1EH5A 1SD2A 5IJ0A 1GCIA 2ZBGA 3IT0A 3LUHA 1JYFA 3I0ZA 2BJHA 3R7WB 5JBQA 3F7OA 5KYXB 3KQUA 4I81A 4X6XA 4BO7A 1H42A 4WOBA 5A4DA 4YCCA 3PQ8A 1GILA 1QV9A 2FE1A 5FHQA 3VO2A 3GIWA 4UMDA 5LVAA 4DKJA 3VNBA 2J85A 3BULA 1XD9A 2OESA 4HBZA 3M5PA 4KOAA 1YS7A 1KRHA 1NYRA 3ENZA 3H4TA 3NGMA 2VHXA 4FZ5A 3WYFA 2W6MA 1M7GA 2HQSA 4ZALA 2DVMA 3W79A 4I9GA 5GVSA 4LV5B 4AK9A 1QRDA 3MTIA 4JELA 1K8ZB 2R1TA 3E4DA 3O93A 4J1SA 3EEOA 2P9GA 3A25A 1BE0A 2DUNA 5JXWA 2OCXA 3PD7A 1LWOA 2WOJA 5EHGA 5K4HA 4MVJH 5I5EA 2BFCB 1OAAA 3IEXA 5F3DA 3TSOA 2VJLA 4EVSA 3F78A 4L73A 4EW3A 4ZCLA 4F86A 2NQTA 2G7ZA 1WKVA 2VN8A 3AHHA 2D3WA 4W5HA 5ARBA 4E12A 1DAIA 1Z63A 3EQZA 2UZ1B 4IICA 2OGZA 2ZQYA 1PVVA 4QYTA 5LN1A 1YHYA 1J22A 1LPMA 1XVIA 2X8AA 3IULA 4IQ0A 2IRWA 2YYAA 1RJGA 2F1KA 3UHOA 1IJBA 3EARA 3GGSA 3A6LA 5IX8A 1CUFA 3MPOA 4J2TA 3L9WA 5CG2A 1KDRA 3CXRA 4UVEA 1V45E 1J2TA 2HBQA 3MW8A 4XPZA 4TQUS 4ZCSA 1TTPB 2BP7A 7MHTA 1EVYA 4KR2A 4LZNA 1SQ5A 2Q9AA 4NPAA 1J2UA 1FVOA 1RZRA 1NN0A 2HMVA 5CYFA 3KSBC 2B4YA 1MP0A 1EX7A 1IOZA 1IMJA 3BMQA 3FSEA 2WFAA 3BJEA 4QEKA 2DQSA 1EXMA 3ZZTA 1QQBA 1ZCFA 3S27A 2ZVPX 3TQHA 2VK8A 1U3WA 2XYHA 3G2NA 3KM0A 5C3UA 5IMSA 1DUIA 1KEPA 3GK3A 3IVRA 1QPZA 4JJ8A 1XSEA 1H65A 4M8IA 3VH4A 1EHCA 2Z1NA 1Y3DE 2F9LA 1MH9A 2CF6A 2W4MA 5DBOA 4KAXA 2CVOA 1JFLA 4D9BA 3N7UA 3WB0A 5KVSA 3ZWXA 1U8FO 1QRUA 1EUCB 2D5IA 5CFZA 4BP9A 3WAJA 3GA5A 2PXHA 2LVBA 3N53A 1KOFA 4ISBA 4BVHA 3LY8A 4KQXA 3JWPA 3WS7A 1J97A 2JFYA 2ZRMA 4OATA 2I03A 1MEJA 5DXAA 3PGXA 3WK7A 1FDTA 1CS4C 1E2GA 2HADA 3Q10A 1PWYE 3FKSA 3WWYA 2XCQA 3E81A 5JJ5A 3MN1A 4ZQBA 1EFTA 1DARA 1T6ZA 5E0OA 1U8UA 2EG9A 3Q0EA 4NFYA 1UMDA 4KMSA 2EDCA 3DBRB 4ZCQA 1YRQA 1EFVB 2DHEA 3NWJA 1D4FA 1VQ1A 3V8VA 1VFPA 2PRZA 4PAQA 1SD5A 3P9YA 4PYLA 1E3IA 4R9SA 4I08A 1NW9B 2FZVA 3MWLA 4EKYA 3DTVB 3A6PC 2FOIA 3FR7A 4YFYA 4CMIB 1Z4LA 2HT6A 2BC9A 1P60A 3VNQA 4N0MA 2QT0A 3ACCA 3E84A 1PG5A 3I8SA 3WK8A 2P11A 2F48A 1DCKA 4AJHA 1JXMA 3IIIA 1Z2NX 1MR3F 2ZIXB 3RSSA 4DARA 3RC1A 1KFCB 2IGTA 3C7AA 3I04M 3V8NA 4PRKA 5AT1A 4CDNA 4F9TA 6NULA 2FUEA 3W5SA 1E9EA 1PT7A 5AKIA 5I01A 1UOOA 3EXG1 4QDUA 1QDEA 4L9RA 4YP0A 3NBFA 3QU7A 2AG0A 5LZ9A 2G40A 2J5KA 1VKHA 5TE9A 4A8JB 1R7RA 5CA1F 2P90A 1WF3A 1CJMA 2PV0A 4G56A 1SN7A 3W2EA 3LGAA 1W94A 5JO9A 4CN8A 4F2PA 4F5WA 4OX9B 2EU8A 2Y1FA 3BCHA 2VCYA 3Q8XB 1W30A 4L2IB 3FCXA 3SHVA 3AHJA 4QVIA 1V4VA 3DXZA 1PF7E 4I1YA 3H5OA 5ILQA 3SF8B 2OEPA 1BJRE 1DTWA 2JS7A 2TMDA 4G1FA 5F21A 2XCIA 3GLTA 2NUPA 1IZ7A 2LIPA 2UUPA 3IP8A 3SHFA 1NG9A 3D64A 2JFZA 1TKAA 2CHGA 4JYAB 3O4IA 2FHSA 4PG7A 4TV9A 4BNKA 2D3TA 2ZWPA 4MWSA 5GM2A 3NBZC 1JRLA 3KKNA 3JD1A 1SUEA 4C3OB 1ICEA 5EUQB 5DN9A 5DLPA 4MTLA 2VI5A 4WLNA 2GESA 3WL4A 3N76A 1O9GA 2DBQA 4DV0B 3BIXA 3OOSA 4EF4A 2D59A 2D5AA 5BVHB 2Q1WA 2GD0A 4ZJYA 1KI6B 3TGWA 1KFJB 4BV2A 3NHLA 3ZE7A 3AM4A 3K71B 2I29A 2PTHA 3BQMB 1GAWA 4PIPA 4V0LA 1G8YA 4G9EA 4YTEA 5IN4A 5IDWA 2Z3WA 4BKOA 1QVRA 2JHGA 4ASUD 4F9EA 3AB8A 1DZIA 1TCAA 3PG5A 2F17A 3KZOA 1AKQA 5CK4A 4DV7B 2PKRA 4LJ6A 4EB6B 1L4KA 3KETA 3ZV4A 1DKLA 1RLMA 3ILXA 4C0KA 3RVQA 4IS3A 4J4BA 2QA5A 2QVCA 3EVTA 2I3AA 4EQ6A 2Z9BA 2EFGA 4DZZA 1WKBA 4GU5A 1M2WA 4W82A 1FMLA 2R5WA 2OCYC 3CWQA 1IQPA 1OGYA 1M5UA 3RW9A 4LMBA 3SFZA 4YPVA 2IDJA 1CZUA 3KXLA 5FAXA 1TVMA 5CVTA 3GFGA 4OHCA 5TS2A 5E95A 4UOZA 5C51B 4E1VA 1MRZA 3HJTA 4URVR 2C3YA 4TTVA 5F64A 4XM2A 3SYLA 1VZ3A 4PAMA 4Z9YA 5FWXB 5LYJF 3QBDA 4CTJA 1F8GA 1SHZA 4W5JA 2II6A 3KL2A 1PQ4A 1XDBA 2JH3A 2HZBA 3EH2A 2V65A 1AV7A 1L7QA 4JLWA 4BBZA 1CY7A 1VP3A 1U3TA 3EBLA 1R8YA 3I5MA 3H2KA 4DG8A 4XVUA 4J16A 1CUYA 2Z2YA 2OBXA 1ZD5A 3KOYA 3ICVA 1Q7GA 1GL3A 4DWWA 4DS3A 2XLBA 2TS1A 4QULA 1U2GA 3U13A 5CVDA 3GLGA 2QL5A 1DKNA 1L1QA 3A1TA 4G0MA 4QRHA 3ZHBA 1YS1X 3T5CA 4X8OA 4OCZA 1W9MA 121PA 2VDNB 2XIJA 3BKXA 3SLRA 4NCKA 5GINE 5UKDA 4A5OA 2PPVA 3DOEA 4CNBA 1LPPA 3G6WA 3H5WA 5CYPA 5KSWB 3U3JA 1U0LA 2ZAOA 2E3JA 5FI3A 4PN7A 3GEPA 4ETMA 4WFIA 4TXJA 4DHWA 1UUFA 2I22A 5E2IA 1ONPA 5BW8A 5JPDA 3U6KA 1ZH0A 1V48A 4UU7A 4HH0A 3HHPA 3CBQA 5LZ7A 3VX4A 1QK4A 2PAFA 1YC2A 3PHCA 2WU1A 4OOFA 1XEAA 5FUWA 2FK7A 3IGFA 3F3KA 4L74A 4N3NA 5COAA 5KNBA 4GHWA 1WOYA 3FOBA 1FMCA 1OQAA 5IAKA 5MFPA 5FNZA 3VNAA 5I7WA 4LDRA 1OILA 4LHSA 1FYVA 1YWGO 3S5UA 1GFZA 4A1OA 1Z36A 4PSUA 1MLDA 4A03A 5ALJA 1HM5A 8GPBA 1E5TA 1FBTA 4FHCA 4YAEA 3ZBPA 2IEYA 3JALA 3HB4X 1J70A 3OY7A 3OZVA 5G1PA 1JQAA 1G9SA 1N2EA 3OE7D 3QYJA 1YMQA 2DPGA 4P33A 2CXTA 1YRYE 4RK0A 1K2VN 1KHHA 1KZ7B 1CRWG 2EZTA 2WSLA 4M1KA 4I8DA 4CM8B 3VA7A 3PTAA 4L16A 3AESA 4X92A 4Z54A 1FXWA 1WCV1 1I9GA 3IUPA 1N6RA 3R7LA 3C3EA 4M83A 3LBAA 4NCAA 3E9MA 4XSGA 1G8HA 2OORA 1K89A 3AY6A 3K1YA 4H3SA 5E3HA 1N2XA 2JBAA 5BQOA 2BI7A 3OKPA 2B1IA 4LHEA 4DM3A 2IT1A 1QONA 4KGVA 4YY3B 1I4OA 2CMKA 4KE6A 2YIDA 2CHVA 3RTEA 1E6UA 2ZTHA 1FNNA 3HL4A 1JEYB 5HSGA 1IEVA 2HSEA 3KJZA 4NTZA 4WZZA 3CVJA 3L7IA 2P9BA 2Z8XA 1H5QA 4JBIA 5EJ4A 2CNWD 2VDWA 4MYRA 4JBYA 3FLBA 5CU7A 5KPDA 1G1MA 1R3DA 2G1PA 4MW6A 2P4HX 3MA0A 3ASZA 3ZYCA 4C5BA 1QZUA 3CMMA 1E8NA 3FCAA 3R77A 5C4GB 3GROA 3NZEA 3L0PA 3HZOA 2ZI3A 3F98A 5JLAA 1X7YA 3IUEA 2ZI9A 3T0IA 3CLRC 4GE0A 1FTGA 2ZBRA 4OB6A 3EULA 2LDXA 4L8GA 5AO9A 4QG3A 4KK3A 1Y6GA 1D1SA 2MWMA 2HM7A 2NYVA 2AQKA 2RJ3A 4Y9DA 5DHQA 2HWXA 5EJIA 4Z53A 1QU2A 4TKUA 1KWKA 4MI9A 5CA0B 2SHKA 1UIRA 2RI0A 4FX2A 4IPTA 4MUGA 1YS4A 2CLHB 4NPHA 4MOWA 2D1RA 4LDJA 3HXLA 4WDQA 4B85A 3FKQA 1WPGA 4IDNA 5KOYA 4WNYA 3RT7A 4PLTA 4S0ZA 1HDCA 4FX5A 4QGAA 1GXSA 2Y77A 3MJCA 3O2QB 5H3CA 4B7ZA 3IOBA 4R40A 2H1CA 2QSZA 3J81A 3ABQB 1MVOA 4TL6A 3WLHA 3UH1A 1W85B 2WHQA 1P39A 2X2PA 1PGNA 3JQ6A 3WMRA 4Q02A 4FBLA 5ESWA 3F67A 2BKAA 4YREA 2VWPA 3SZOA 5KTTA 2IZ1A 1V1JA 1V2GA 2ZJ6A 3I9FA 2VK4A 3KJEA 3IJPA 3OT5A 3PJGA 4EYGA 1HDEA 2PN1A 4B2PA 2GAAA 5KNDA 1COZA 2I2WA 2PMFA 2VL7A 1ZGCA 2WUEA 3O74A 4IGKA 3HA3A 5EWLB 3A06A 3ZZ0A 1I7PA 4CQMB 1XR3A 2JLQA 4IDOA 2GO7A 3PUJA 1XPJA 2FX2A 3HFJA 3O8OB 1MGPA 3DO6A 2A6PA 3EPJA 5EIXA 2IXTA 2AF3C 3A3KA 3GMTA 2XAAA 2QHXA 3IDAA 3OJFA 5ALYA 1EUDA 1SBTA 3KEFA 5FNVB 3TNYA 4A4DA 4UTPA 2QRPA 4QTZA 2LE0A 5AIBA 4WVLA 4Q3OA 2CDAA 2OK8A 5KKAA 5BSUA 4RK1A 2CD9A 1TZCA 2ZCVA 4I55F 1XTIA 1WDLA 3P9ZA 4JC4A 4MUEA 3S29A 4CDGA 5I9SA 5HRAA 1JG4A 2XLCA 3I76A 3GPLA 5AOBA 1O77A 1OJ7A 4LN1A 3MTJA 1YJ5A 3BZUA 1SQGA 5JH7A 2WBLC 1XPUA 5HE8A 1KJIA 1P7ZA 3LLCA 5F7OA 2OHHA 3F6EX 3OA2A 4FU0A 4IIGA 2VQSA 4QODA 4MUYA 4YDHB 4CG2A 4C22A 3L8EA 4BB5A 1ZJJA 4RD2A 3TB4A 2FP3A 1OKKA 2FJUA 1RYYA 1GA1A 3LI2A 3QUTA 2JCXA 4Y6LA 3OE7A 1RRGA 4DC9A 3I9V1 3L92A 4PRLA 4UNSA 3SEAA 1DAEA 1XLWA 1R8JA 4JFAA 1EB9A 3OAAA 4BX0A 2IXBA 5E2BA 1J8MF 1DO8A 4FNAA 4Z6KA 1OGIA 1SB9A 3ZTTA 1W59A 1WAMA 4TL7A 3ZDQA 1I7QB 5DBEX 1QFYA 5D6NA 3IJRA 1MVNA 5K0EA 4MRMA 3AEYA 1G7RA 1JDPA 1BJKA 1Y8CA 2V3VA 3I04A 2EQ5A 1GUDA 3P4UA 4NV0A 4JUCA 1QS0A 4G37A 1J1IA 5TJHA 2VJPA 3LGSA 2HCFA 3KV3O 2NN3C 3K0AB 1D6NA 2L2QA 4R7GA 4BMSA 5IPFA 2AKEA 4E13A 5BN3B 2VSYA 2J9RA 2RGCA 3EA5A 4M1MA 4JLDA 3AM1A 4AY6A 3KVRA 3AKDA 4EVRA 4N49A 2QRVB 1GNVA 5DRYA 3TD6A 4DB2A 1MA0A 2A9JA 3UB4A 1G8AA 2YV3A 2BPOA 3MWJA 1RWPA 3PRJA 3HBNA 4X7RA 5AK6A 3USES 1Q5PA 3RBAA 4AIRA 2VJMA 1X87A 4ZVKA 1ZU4A 5IG2A 3S1LA 5SYMA 3PNMA 3TW0A 2X0KA 2IX3A 1MVLA 1NNI1 2I80A 1FMFA 2G09A 3JQ8B 4FE3A 4H7IA 4H6VA 2ZB7A 1I10A 2NYUA 2GCNA 1YRWA 2JGEA 1QF9A 3BMNB 2B78A 1H05A 1IRIA 1H2AS 3IB6A 3KHSA 4ESOA 2OMEA 1CV2A 6LDHA 3GJ7A 1OWLA 4QPNA 3OE1A 3IUSA 1E3SA 5GZ3A 1PL8A 4FE7A 3AR8A 4UAVA 1GPWB 3LCMA 3OURA 5CW2A 1JEYA 3KEQA 3IUMA 4L57A 3TM5A 4C0HA 4D9GA 3M9XA 3NWEA 5GONF 4BO3A 1KDPA 2V5VA 4LHVA 3V48A 2YZ7A 4S2EA 3N7AA 1ETUA 4YJGB 1ZGZA 3I01A 1LQUA 3PSHA 4GUAA 2AD1A 1KK0A 2AC7A 3AJRA 3UG6A 2KX7A 1PJRA 3II6X 1HRDA 4J4TA 1KAHA 2VQFB 2XBMA 1KMNA 5KQPA 4LJ4A 3MBIA 2HBZA 4CM1A 2HCTA 1COWD 4BFSA 3R9XA 2DY0A 1I36A 4R9UC 4HZGA 1FS4A 4MQUA 6REQB 1UBNA 3L0DA 2W2OA 1S2GA 1C9MA 2Q2NA 2RHHA 4IYRA 4RIHA 4AN1A 1J2RA 1N0HA 2FEWB 5KQLA 2QX7A 2EOAA 5KYWB 4MDFA 2F4NA 1LBIA 4NV1A 2AA3A 4P3PA 1TPZA 2XQIA 3FY4A 4ZVVA 5HKOA 3PDCA 3LM8A 1XKXA 2RCNA 1EGVB 4PLCA 1E96A 2Q99A 1A77A 3DEYX 3K7EA 2O14A 4EPYA 4QNRA 4C0LA 4YRPA 1RRVA 3OPYA 1LJ8A 4LMPA 4B82A 1OLOA 2E5WA 4QOJA 5KWIA 3E61A 3NOQA 3FD8A 4V02A 4HS9A 5K99A 4FYHA 1T8UA 4Z1MD 4FR2A 5HCUA 3VZRA 3OY2A 2AJDA 1PK9A 1AF7A 1JDJA 1CJCA 3E22A 3F4BA 1ADBA 4NWIA 3CX4A 3TAUA 4AJ1A 2H00A 5BUCA 1EFVA 2OENG 3IVCA 3PX3A 3TTXA 1R50A 4OK3A 3SBDA 1NLMA 4EMUA 5K8LA 2PX6A 4P7KA 5K4GA 1LBHA 3O3NB 5BYJA 2NAFA 1RAHA 3HQ4O 5TGZA 2VBIA 1JQ5A 4NH0A 5DE3A 3CISA 5L7TA 4BU1A 4HNVA 3G68A 2OFPA 5KCZA 4M22A 1KEWA 1Q3TA 2WKWA 2ZYWX 1UDAA 1W1WA 4ONEA 5LZ8A 4F3NA 3QWBA 5MGBA 2O23A 3PX2A 2Q5CA 1PGOA 2YIJA 2JI6A 1I7SB 1E3DA 1ZGBA 1ZI9A 3F46A 4P0QB 2W8BA 2IX9A 3L4JA 4YJDA 5F1OA 4FNGA 1I4TD 2YNMA 1WB6A 3DG9A 2VNSA 3GJXC 4RHTA 4R6WA 1ECLA 1W5BA 4CIDA 4M1SA 3Q1LA 5JH7B 1XAJA 4GRDA 4QDKA 1XLVA 3UC9A 2DB3A 2BJVA 3EXIB 1BXRA 2Y0PA 5H3HA 2DR0A 2WF9A 3KVYA 3SEQA 2B0CA 1XCMA 4Z4IA 1TZ2A 1UDBA 1WD7A 4H7PA 2J8ZA 1KI2A 3CN7A 4BFYA 4DDMA 2JFOA 3WO0A 2F1HA 4B6FA 2B20A 4NFHA 4JASB 4C6SA 2ZU0C 3CINA 2E87A 4JP5A 2FLVA 2A0UA 3PX7A 4DY6A 1MOSA 3EZ6A 3RRNA 1ULSA 5TQ2B 1Z74A 1AC5A 3NNSA 3U9SA 2QPOA 2FWRA 3DS8A 3WISA 1KR2A 2A3RA 3FUCA 3EXFA 3M6AA 3OD1A 4FPXA 4I4TF 4TXNA 5ESDA 3R5JA 2W93A 4KHZA 3KCQA 1CSEE 2WD7B 3KAPA 4OGGA 3WE7A 3UT5A 5EESA 1XZGA 4GKBA 2WMDA 3U48A 4MQMA 4UHBA 1FU8A 4RA9B 1O95A 2GZSA 3HUFA 1UJ2A 4RQBA 2WTBA 4F92B 3VH1A 2I71A 3TLZA 3I9NA 2VTDA 1PTKA 5THKA 4D79A 5JMOA 5L3QB 1DMSA 3Q5DA 4B3SB 1MO3A 2WF6A 3ZOZA 4QO7A 2YHIB 4V0ME 5EYPB 1T3TA 2WIDA 4J0IA 4GOOD 1HWYA 5SZHB 2LP4Y 2MINA 3PB3A 4CHGA 4J75A 1S89A 3DBOB 1QQ7A 2PLRA 1NBMA 4AJ2A 4J1NA 4LDQA 3GOQA 2FW6A 2H4YA 3DJYA 1Q12A 3FUWA 2X8WA 4XD2A 2V74B 5ECYA 1XD2A 2PIDA 3JATA 3AIIA 4RY0A 3DFMA 1Z5PA 1PT5A 3GIDA 4B81A 3BMNA 5HA5A 4B9EA 4Y3UA 3UPTA 1B2LA 1EI9A 4GYJA 3LC0A 4JSTA 5SY4A 1F48A 2RK6A 4G01B 1II9A 1K75A 3PC3A 3RS2A 5I8ZA 5F35A 4D3XA 4BZWA 2QRNA 3GPBA 1XDUA 2IXGA 3GEEA 3KUKA 4IX9A 4P1ZA 3FA2A 4ZP1A 5FORA 5FJJA 5K2MA 4BMOB 2XVAA 1KMMA 2ZT7A 4ECEA 3DE2X 3UK0A 2NACA 5F51A 4D9KA 2YINC 1TGVA 1V8ZA 1AGNA 1P7CA 2HDHA 4KH0A 2PGOA 1JIJA 1ZOIA 3CLTC 4UM9D 3DNFA 4FHZA 4BVJA 1Y3AA 4ZV4A 5KQGA 3PQ5A 4FP9A 4REOA 2XB4A 4UTZA 3U4QA 3AF4A 4F2DA 1E2FA 4NU6A 5JSYA 3AF3A 1C4KA 1TK2A 5LR6A 2YUTA 6REQA 1D7OA 4WKPA 1IY9A 2WM9B 2YN2A 3I28A 3NETA 2BTQA 1L7MA 2GEKA 1EDEA 2REXB 3O4VA 1FDWA 3DF7A 2JZCA 4NARA 5HF6A 3DOIA 1N6HA 4FJ0A 3EVAA 1T0UA 2YYZA 4RU1A 5EEHA 2RI1A 3G23A 1Y5MA 1AA6A 1K63A 4EGSA 5IWAB 4NBWA 3KXKA 3LE8A 4JR0A 1CUEA 2JAHA 3ETJA 2GARA 1W88A 4HX5A 3BM5A 4UULA 4TZ0A 2CXHA 4WKBA 4FFBB 3FZQA 1ZMBA 3EGVA 4Q9KA 5DCUA 4M89A 2JCYA 2Q0SA 3NNDA 4YO8A 4R84A 5JDIA 2YV2A 1QFJA 3PRHA 4GX1A 2BSQA 3KU1A 2C3OA 1XALA 3SDSA 4DJAA 4R3WA 3MAAC 3SX0A 2IC5A 2BV3A 4H1WA 4R1SA 4CIAA 3INYA 1L5KA 2VKQA 2VJOA 3BQNB 2QI9F 4IJ5A 4DT1B 1NXPA 5AHRA 4AJEA 4CIWA 3S7ZA 1BCSB 4ZYUA 2G67A 5AVJA 1M2NA 2JIZD 4V39A 5KNBD 2XE6A 3NM4A 4Y0VA 1VLQA 3QXCA 2AOTA 2D54A 3NW9A 4QXOA 1CK4A 4RJJA 4X93A 2NP7A 3GB9A 1TXGA 1M7BA 1Z6QA 2REBA 2AUTA 3IMEA 3N9IA 1LF5A 4I9HA 4OAPA 3HACA 1B76A 2C2HA 3JQ9A 5TRTA 3TZEA 3L2OB 3V2UA 5L6LB 1M1XB 3ZW9A 2AWNA 1P0FA 3HI6A 4DBLC 3DMGA 1P5ZB 4RVUA 3GUYA 1J99A 3JQFA 2VRCA 3UJ8A 4C0BA 3N5CA 5IABA 3OQHA 3WHKA 1I3CA 1M8JA 4J2OA 4BPRA 1CYEA 1PZFA 2Y0EA 3OLYA 3HO6A 4YMWA 4J0QA 4ZXFA 1AB6A 4TS3A 4YJ3A 3HDVA 4BBJA 4PG5A 4UVDA 4UC4A 1A2OA 3VZSA 1Y1KE 4J49A 4S3MA 1MORA 1S9DA 1XRNA 3M9WA 4DBVO 2GKOA 2V4ZA 2VXBA 4NQRA 1QE3A 4YP5A 4YRDA 4A2CA 4EG8A 3QE2A 1WS6A 3WR5A 4H18A 3ZBUA 1T8SA 4MIKA 4CF5A 4PINA 4P80A 5LMUB 3W2GA 3S40A 4JXJA 5EZSA 1NVAA 2GFAA 2ZBDA 3KXDA 3EW9A 3W2TA 2QY6A 1RAAA 3K8ZA 3EQ7A 3CUVA 1ISHA 5EPUA 2CNWA 1ZNWA 2VJDA 2GNPA 2UV8A 4YS6A 1AGYA 1AZTA 2NGRA 5B7PA 4B7CA 5LM3A 3N2LA 4MR9A 3NS7A 3IE2A 3Q9SA 3VKHA 1ILEA 3EGOA 2GHTA 2PS1A 1LDYA 4U6QA 5CDGA 1U8ZA 1EFCA 4KRFA 4FI3F 3EXHC 4RTOA 3KOWA 3OD5A 1TF2A 4FBMA 5F23A 2W2LD 4WK6A 3CG4A 5CH8A 4L1KA 2VYNA 5L3QA 1R6XA 1WY7A 3TE6A 4C76A 2W6JD 2ZPTX 4P9NA 1FU4A 3FXAA 4JIGA 1ECPA 5H83A 5KYXA 1KDTA 4LYAA 3AEKA 4Z9FA 2EFJA 2PXAA 2G0TA 1CNFA 1BMFA 1Y80A 3C8UA 4JENA 1E5VA 2C95A 1DQYA 1O1YA 2PBFA 2UKDA 2W6OA 2HUNA 1QFZA 2NU7B 3EFOB 4BP1A 1ZC4A 5A4JA 4MRAA 1M83A 1EVIA 2GNAA 2ORVA 5C1BA 3E03A 3NTUA 1UH5A 4E5KA 4O6VA 4YMTA 3EXHB 1DLJA 1S02A 3BREA 1KZ9A 4Q21A 5IM4A 4DZTA 1PDWA 1ZD9A 4XLZA 3GO4A 1SBQA 3MJFA 4O4IA 5KVAA 1VMEA 2J1LA 4OIFA 4XUDA 2AH5A 5EZ5A 1RI1A 3V7NA 4WN3A 3AFMA 2ODQA 2HEIA 1TO2E 5GV8A 3W6ZA 4CJXA 5KSYA 4Z4FA 2O8FA 5JI3E 4R0VA 3OCZA 4Q4AB 4W99A 4FOSA 1UXOA 4X6LA 3ZDAA 4BVLA 2FMUA 1E4EA 2UYGA 3MJHA 1RE0A 1C7JA 1SFRA 2OCBA 1N1EA 2ZWIA 3HZZA 4QSMA 5F52A 5ENVA 3RTCA 2QTAA 2O8EB 3GAMA 3PV0A 2NSJA 2OILA 3PL1A 3SEFA 3M33A 1XB2A 1X39A 4LOKA 5ESXA 4G41A 4J16C 1YDHA 1N5RA 2NM0A 3ILVA 4RGQA 5BUQA 2XZTA 5AI6A 1I7LA 3X1MA 3TIFA 1KPGA 1RRKA 3KZXA 3NAQA 4CIYA 3ZDCA 2E4AA 1Q1NA 2FGKA 2SBTA 3KKMA 3TQCA 2Y2VA 9ABPA 1QGDA 3TQQA 1F06A 4JGGA 3LVBA 4N7RA 3AVWA 2XJ4A 4X65B 1REQB 2Q8QA 2AE2A 3NVDA 2O3RA 3ROQA 5AJXA 1LX7A 1EBBA 5IVIA 3ZCQA 5FUMA 4GZLA 3ENKA 3B5JA 2Q27A 2EXXA 2R5NA 2G70A 2RCYA 2PLAA 3F3MA 3GDFA 3C7KA 3P32A 4Q19A 4DJEC 1TM4E 4K26A 5BSKA 1V1RA 1WHTA 1YQQA 5HPYB 1ZNYA 3CRNA 5KX5F 2VDPB 4D9HA 4DLTA 3LXXA 5KDOA 2HMYB 2Z08A 1YZ3A 2D06A 1R15A 2QTFA 2FFJA 2WD8A 3PKJA 3QPCA 4KBGA 5AXAA 1JYSA 4DUYB 1VYUA 4D44A 3CF4G 4YX9A 3GAZA 3BWDD 3N6RA 4D8VA 4W9MC 2WSMA 4RZHA 5CR9A 4B80A 1YKFA 4Q1AA 2HDWA 4AXBA 5JATA 3WIUA 4NRDA 4PZPA 5GPBA 3EUEA 1UT6A 4Q01A 1C81A 5TVGA 1XWFA 3CONA 3VR2D 4V0SA 4ND6A 3S3TA 3WLQA 4IAOA 2AFHB 1QZZA 1V37A 1CUJA 2PS9A 5IJZA 3L4BA 1W96A 2QTBA 1BMTA 3IDZA 3QWFA 4BO1A 4IKPA 2XGGA 2NU8A 4WDRA 3GRZA 5BYAA 3ZWAA 3D5QA 2L19A 2BDTA 4HDAA 3KPWA 3WRWA 4WJKB 1WR8A 4H7DA 4N82A 1A9RA 3EOAI 3MD0A 5ITZA 1Z6PA 2PKWA 2ZIFA 1GHTA 4WOKA 5FLEX 4EQZA 3RD5A 3UYLA 5F3WB 5DWQA 1O58A 2YRXA 3VVCA 2VAWA 2VHJA 1DJLA 2NADA 1L7VC 3SC2A 4D46A 5B3JC 5CB8A 1I6WA 3IAUA 1DDOA 4HXEB 1MTOA 2VLBA 5FL7A 1G5PA 2C54A 3ZCUA 3MWFA 1JFFA 5A4IS 1IZ8A 1KDZA 2NQ8A 2YZNA 4L5JA 1DT3A 1XZLA 2HAEA 3GH1A 2EARA 2H8GA 1U28C 3CZRA 4EA8A 5IJWA 5J40A 2ZOSA 4B7XA 3KZVA 4L8WB 1UM8A 5JWHA 1TJ5A 1UJ4A 4E0BA 2W5UA 3F8WA 4HNSA 2RGXA 4JJ6A 1E2JA 1MABB 2W00A 1CDZA 1AQJA 1QM5A 4G4GA 4TXHA 5JUWA 3RYHA 4JYBA 3RVDA 3AL2A 5DM0A 4DMRA 4QEZA 4U2KA 2DGDA 1E77A 3W1WA 3UMBA 5HJ2A 1VSVA 4KFSA 5EP2A 5ISMA 2VYCA 1NUSA 4ND5A 3BWEA 3OIVA 4PX9A 2FQQA 2BI8A 4DA7A 1KY5A 1RWKA 2XUQA 4H27A 1Z4MA 1Z0KA 4LZJA 1GA4A 3SM3A 3ANTA 4FGJA 2WIBA 1HOTA 4IEFB 4RPHA 4W7HA 5CW1A 3PEYA 1F8YA 4WL0A 4HYQA 3N70A 1CTQA 1UXJA 4U02A 3NB0A 1J5EB 2H63A 4RABA 2AI3A 2QQFA 1NM5A 2FUCA 2H3HA 4LXGA 3ZQ4A 2CHEA 2DKNA 2RHJA 4BJ1A 2Z5FA 4ZO4A 3TCKA 2EGUA 4ZT2A 1PJ4A 1ZHHA 4HAOA 1J90A 4OI0A 4BS9A 5E7JA 1HTTA 2X7HA 4IOJA 3KZKA 1DX9A 3G7NA 4RVFA 3E1SA 1FYFA 2XUAA 3DYBA 5DV9A 1N3BA 8AT1A 4BMZA 4PHGA 2XUHA 4CV0A 4PYRA 3JRWA 4WKCA 4PCLA 1LSJA 4A6XA 4CMEA 1XKQA 2DLNA 2YWFA 5JQGB 1NJ2A 3CO0S 3OIGA 1U7HA 4QL3A 4YAOA 1BMDA 4J7AA 2ZSHA 3JQAB 3BSYA 4OBWA 1EE1A 3A9SA 4II7A 4Y6OA 1YUBA 3TLKA 4KVGA 4L3VA 4CN9A 1MO5A 5BR8B 1OMOA 1KAMA 1X7XB 4O33A 3TUIC 4BO9A 2F62A 4XYGA 3RAGA 3CX6A 1JEEA 3IMGA 2ENWA 1VPLA 3ND6A 4N3BA 3TAXA 1X7HA 3D3NA 3GZTB 3IAAA 1YK0A 4QAJA 1VL6A 1GU7A 1VXOA 1EJBA 4I2NA 1VE5A 2EX4A 4QE3A 1Q21A 3TZQA 5L9AA 4EIWA 1T2DA 2ZJAA 3H04A 3JVUA 3QOFA 3ICEA 1O5TA 5E1OA 1FB5A 2XWQA 2OQVA 3OIFA 4I50F 5JYDA 1RI5A 3PPWA 1YZHA 4NYJR 1BDBA 3TKYA 1XDWA 2Q45A 4WAUA 4LSGA 4H2DA 3RS5A 4LA4A 1H94A 1FLAA 5ALUA 1JEJA 1ZW6A 1Y4SA 3VR3D 3VTZA 3DDWA 3IPRA 1VBFA 3D4NA 3WWCA 1VE7A 2FP4B 4REQA 1IQ0A 4KN8A 2NVBA 2BE9A 4B47A 1H2EA 1I3LA 3DT6A 2GJ8A 1A72A 2I7XA 2RC5A 3FKJA 3ZV7A 4ARUA 1Z07A 3V4LA 3T94A 2JARA 5ELXA 4BPBA 2RHCA 5D3MB 4DUPA 2Q0QA 4Y6SA 4EI9A 1ZITA 4LS3A 4DLZA 1T8WA 1IM5A 5AI0A 4C5AA 3RNOA 2EBHX 1Z3CA 2EJVA 4LC1A 1ZK3A 2WFZA 2C7PA 1B23P 1U8AA 4TX1A 2DTDA 2OBLA 3JWEA 1AUOA 1A5TA 1WPRA 4ES6A 4WN9B 2XXAB 3S2ZA 4KRGA 3HLYA 4MICA 1CQPA 3H6HA 1JF8A 1TOAA 2F43A 4ZMRA 4B4OA 4W8GA 3VH3A 2IQIA 4BCBA 2QRUA 4B74A 4Z1OA 4KDFA 2MJLA 1Q74A 1DXQA 1U2QA 1TRHA 1X14A 5EZYF 4HADA 2XBLA 3VKVA 5ITZB 1UBSB 2I2AA 3NHAA 1T0IA 3GLFB 1Q7TA 1XAGA 2OT3B 3MWKA 4JU9A 3Q6NA 2GGSA 3JALB 4M1WA 2DH6A 1B6SA 3FZEA 3B60A 1Y7IA 4ZD6A 2KSQA 5DSTA 5HFAA 5JFOA 3U17A 3B51X 5HUQA 4FBGA 3G8CA 4CLRB 3LQQA 3L7LA 3T3EA 4S24A 1DKQA 1VSTA 3OE5A 4O4JB 4F4DA 1V25A 3A6GA 5FWYB 1WW8A 4OMDA 4NCBA 2QE6A 2VRWA 2IYVA 4AICA 1Z5VA 2RFLA 4YPFA 1ENOA 3U4CA 1E5XA 1XMPA 2I99A 4DQVA 3MFYA 4KXNA 5DNUA 1XZQA 5CDSA 5CT9A 5IKEA 2IIPA 1PS9A 1B4DA 3CZ9A 1YUNA 3NGLA 1JJIA 1JNXX 2MIIA 1EVQA 2GCOA 2JEZA 1T6YA 1K97A 3INTA 4MR7B 1Y81A 1OA1A 5IAOA 3MTEA 2IV3A 5EJGA 2Q3MA 2ATIA 1XLTA 2F1IA 4YYZA 1VJCA 2O1WA 2CHQA 3U81A 2IU3A 1U7UA 3JZIA 5B6PA 3UXMA 3VVBA 3C6BA 3DTYA 3HEBA 1R5BA 4ND1A 3VZQA 4ALMA 4AP9A 1D4ZA 3OFVA 1EESA 4GR4A 1TZBA 3IA2A 3TBKA 5HIMA 3LIPA 4TLMB 4DAOA 1U3VA 1QSGA 3DE3X 2W43A 3ONEA 4BV3A 3E7FA 2XTZA 2VSQA 3IXLA 3LVFO 4RQTA 4EG6A 4X9XA 2OYRA 2ASEA 2ZJ4A 4FWBA 4RKRA 2QRMA 5H02A 5D6OA 2ONCA 4COOA 5A1JA 4YPOA 4KLNA 3W8RA 3Q1KA 4RMJA 3ESQA 3DBRA 4TSFD 4Y1GA 3CEPB 3VOSA 3HCOA 2FWMX 4TROA 4OHKA 621PA 4MUMA 3LLMA 4N12A 1BCSA 2B1JA 3AETA 4GH5A 2FPLA 4UM5A 2J0UB 1W34A 3KJIA 4EFKA 2ZJ2A 2FPMA 2AX4A 3HU5A 3QYFA 4UTVA 5JPCA 5JDCA 3AOEA 3PWSA 2OCLA 3FPTA 1Q7EA 3A4TA 2BRUA 4BQFA 2XRFA 3ZYZA 3ZHSA 5C18A 1H85A 4YJ3F 5E6UA 1RQNA 3QU2A 1KFEB 1IZYA 2P40A 2AT1A 1T8PA 1N1MA 4L6IA 5SZJA 3RKRA 1EG2A 3P0FA 1YQ9A 2QB5A 2ORYA 1R0BA 3G5LA 4JLVA 1UKAA 2P2ZA 4CIXA 1NVUQ 3Q3GE 1UAYA 1NVGA 2O4CA 2H31A 2AG6A 4W63A 3IAM6 5SZIA 1NSFA 4GI2A 1AHIA 1GARA 2VTKA 1UDRA 3MWGA 3Q87B 4IBOA 3X1YA 5LQDA 1MJFA 4BMYA 2E49A 2WJHA 3SQLA 1C7IA 2O8VA 2X42A 3GZNB 4KXWA 1JR6A 1A04A 2PKCA 3FW1A 3MELA 1SURA 3BL5A 1EP1B 3EDRA 4GZ3A 1ID8A 4XH9B 2CV2A 2B7CA 3X43A 5JEEA 5HIJA 4EW2A 2R8OA 4NBRA 4E5YA 1N7HA 4ZODA 2RIRA 1Q0PA 4M0DA 4UOEA 1A2KC 1KYWA 1ZD3A 2FAXA 2G88A 3L8ZA 1HE5A 4ZT5A 5EJMA 4NSNA 3DZKA 3R23A 4BIMA 1XP5A 1SOWA 2XUIA 2JLYA 1GM5A 4F72A 2C4WA 1AKYA 4MDEA 4UAJA 2JFXA 3IAS1 2PG3A 4ZJUA 1A8PA 2EFYA 1SBIA 2PQ2A 4W1RA 4HAXA 2W4IA 3AR2A 3WIDA 4E5VA 1CZKA 3D59A 3HABA 4PSCA 4WADA 4LTNA 3PIDA 3WHPA 4HDNA 5LA6F 3URKA 2OAGA 3RIGA 5IJ9B 2Z6QA 2AW3A 1EKXA 4PTYA 1S0UA 2JK0A 4HCJA 1NY6A 2NNLD 3H9GA 1XA0A 2UZAA 4MV6A 2FEMA 5DP1A 5FBVB 8ABPA 1K8RA 1IQUA 2GM9A 3SWWA 2WVAA 2F8SA 4QXQA 1WG8A 4U39A 1FFEA 4LYDA 2IE0A 2ODEA 1OFUA 1XTTA 2CNKA 3UW1A 2N46A 5FLXA 3BFKA 1T5TA 5BY2A 4ASUA 3H1TA 4QOHA 3THWB 3IEUA 1W8DA 2O2IA 1H3EA 1SVMA 3QIAA 1KEKA 5HILA 5EXXA 1L4EA 4L6CA 1RRMA 2VWQA 5KWVA 5TIIA 4XR4A 4TL8A 5ILOA 2P79A 1QKJA 4KQIA 4F06A 3OLCX 3OJWA 3QIVA 2QVLA 3T5GA 1UBMS 3DOUA 3UJHA 5BXYA 5KOHB 4DCJA 4INPA 1SKMA 2BMWA 3PEUA 4QICA 4EHHA 5J4LA 2R79A 3UPDA 3UXEA 3VHQA 4BE7B 3RE1A 4K88A 5I6DA 2VH1A 4CETA 2H1IA 1EQ2A 3IP5A 1TC2A 1YQUA 3H6GA 3HVUA 5EKXA 2UZIR 2XECA 3RIHA 4UUNA 4KKXB 2X6QA 1Q14A 1E2HA 1D3AA 1ZJ4A 4XB1A 1Z4IA 1EBFA 1Z4OA 2W2NA 1TIKA 2FI1A 3FRJA 2P2GA 3GY0A 3VHXB 3T7JA 3GFTA 3AB3A 2VC2B 3OQ1A 4KQMA 1H23A 4LJLA 1QB8A 3PI6A 5J5VA 4LCBA 4GLBA 3ML1A 1K8XB 5GADl 3K72B 4ARZA 1YZLA 1MAWA 4NCXA 5KYWA 2NUTB 3B3GA 3ZHXA 1WM1A 2ZYHA 5B58T 3L0SA 1UFKA 5CLFA 5E9AA 2BE7A 2GT1A 3OE4A 4DA8A 5IC5A 1V6CA 3E53A 1T8RA 3D31A 2Z2IA 5B1HA 5HTOA 2UZ4A 1Z2EA 1G3QA 3JU3A 3COSA 3M7IA 1UC9A 3IQIX 4G8JA 1TLTA 2YVUA 3F9IA 3NT2A 2CV1A 3SLKA 3IO5A 4C03A 1Z2AA 4IDFA 1KMCA 4XGKA 1XDZA 3B78A 2BLLA 4GO1A 2AOUA 1H8ED 4G0QA 4XWGA 5BMVB 1XX6A 2CLMB 3CN9A 3K53A 3M2TA 1V7QA 3PEEA 1CZ4A 4ZEVA 1BG6A 1YDWA 4ZTZB 3PF8A 2BSXA 1ZXBA 4E1BA 1MUUA 2TYSB 2NOAA 1H2YA 3K70B 2P0AA 3ISJA 1J24A 3M6LA 5LYJB 2QPTA 4YJFA 1XMJA 3EGDA 2H2IA 4N8EA 1CEQA 4BLRA 1QDLB 4CLXA 3ZY5A 1ZUNA 3MCVA 5I51A 2ID7A 3WX0A 4PQRA 1Z4KA 4TN5A 1FX1A 1M2HA 4RPIA 4RM3A 4L8FA 4DMMA 3CGGA 3OZEA 4JLJA 5CAEB 3VSAA 3AJEA 2PY6A 1XQXA 3WHLA 1KSJA 4NESA 2A9PA 4PPNA 1P0QA 3AUSA 1XQVA 1ZIYA 3R20A 1H3FA 1RKQA 4WXPA 3LWDA 5G40A 1I1NA 4TVOA 4ZCPA 2V8OA 3EBPA 2Z5VA 1E7MA 1SXGA 1K3UB 4WFKA 1GFWA 1XD8A 1K6XA 4XIGS 1N2CE 1LLDA 2DETA 4YGYA 3ZD8A