5CD1A

Structure of an asymmetric tetramer of human trna m1a58 methyltransferase in a complex with sah and trna3lys
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
288
structure length
281
Chain Sequence
SFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit
total genus 57
structure length 281
sequence length 288
chains with identical sequence D
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5cd1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5cd1A02
1N2XA 4DCGA 2R6ZA 1IXKA 1YFLA 3A7EA 3OFJA 5CIYA 2QYOA 3OFKA 4OQDA 3LX6A 1MHTA 3G2QA 4M38A 5EMMA 4FR0A 4IV8A 4KVZA 3SSNA 2JG3A 4V0QA 5K0BA 3HCFA 2NXEA 4RTJA 2IH5A 2GS9A 3PT9A 1PJZA 5HIJA 1X1BA 4GF5A 3EVAA 5KVAA 4RTOA 1P1BA 3EGEA 1JTFA 2XBMA 4ER5A 4YMGA 3O31A 4PGHA 1NW8A 4G56A 2IH2A 4HGYA 5F2OA 2WA1A 3NMUF 2EX4A 4GOMD 4RYLA 5EMJA 2G8NA 3GXOA 3KPYA 1L3IA 1JQDA 4GUAA 2KW5A 4PYMA 5CVJA 3ME5A 3UJDA 2ERCA 1EIZA 3UA4A 3LKDA 2I7CA 4EKIA 1KXZA 1I1NA 1BKYA 2OYRA 2Z6QA 2HTEA 3CKKA 2QRVB 2B78A 3KKZA 1R8YA 3SMQA 1NBHA 3GIWA 4YUWA 3ER9A 4Y30A 3DULA 3I9FA 1TPYA 1KPGA 3X0DA 4DZRA 5IKMA 4FT4A 3G88A 5FHQA 2AOXA 3AY0A 3TRKA 4X60A 5GIOE 5EVJA 3DR5A 3UJ9A 1P91A 5K0EA 1JQ3A 3TFWA 1KPHA 3G7UA 3NWBA 2PV0A 3LECA 5LQUA 5ICEA 3M4XA 2GLUA 2P1DA 3M6VA 3QOWA 1ZGAA 4FZVA 4EMSA 3R24A 3B7PA 3GGDA 2PXCA 4X41A 2K4MA 4PGGA 5EPEA 3GRVA 5G02A 3TMAA 4ER7A 3TOSA 1FP1D 3C0KA 3P2IA 3ANXA 4R8SA 2BR3A 3LHDA 5LQCA 1G60A 3PS9A 4EVIA 2JH8A 2PT9A 5CVEA 5DSXA 4E30A 1IM8A 1VIDA 3MB5A 1ORIA 2GB4A 5LQJA 3ORHA 2YXLA 1G8SA 4GOLD 3KU1A 5IH3A 1FP2A 4M37A 4QTUB 3VYWA 5FHRA 5K01A 4CXMA 1EG2A 2C7RA 3BGDA 3TKAA 3HCEA 3KQTA 3P8ZA 2FPOA 5D1HA 5ICFA 1NW5A 2EG5A 5LSAA 4IKPA 4RVGA 2PGXA 5T6BA 5DXAA 1FBNA 5E8RA 5T67A 5CD1A 3KQYA 3ER8A 3UJBA 2E5WA 3NVMB 3E05A 4QDJA 5K0FA 4MTLA 2CKDA 3EMBA 3MGGA 2B3TA 4E32A 1AQIA 1ZKDA 2P3LA 4PYIA 5HIMA 4PNEA 2VDVE 3C3YA 3FPHA 3DMHA 2FHPA 2AVDA 3RODA 2XYQA 1Q0TA 1YFJA 3OU7A 1XTPA 1SUIA 4YUXA 3EEYA 3LSTA 4E70A 5E9WA 1NV8A 1VLMA 1N7JA 5DSTA 5P8WA 2PJDA 4Z2YA 3G8BA 3HEMA 1JG4A 1F38A 1VBFA 1G38A 5K8VA 1DL5A 5LQKA 3D2LA 3C6MA 3B3FA 1NT2A 5FCDA 1G8AA 5K0NA 2PXAA 3FTEA 3DH0A 4BLUA 4EK9A 4DKJA 1G55A 1RI2A 2IH4A 2FCAA 3FZGA 4FS8A 3KQWA 4QQKA 3HCBA 2AOVA 4GC5A 2YTZA 4QPNA 5HEKA 5EEGA 4DQ0A 5F2KA 4PIMA 1SKMA 4E2XA 5EIFA 2OKCA 3DUWA 4BP1A 5GINE 3A27A 3KPJA 3UJ8A 2UYCA 3KHKA 4E31A 2Y1XA 5EHIA 4BP3A 2JHPA 5DPMA 4RVFA 5EKXA 5K0CA 3A26A 5EMLA 3HCAA 4AZWA 4RTKA 1VL5A 3DMFA 3GDHA 3NDJA 4QVKA 10MHA 4RTQA 5JUWA 2PX2A 4FP9A 1WY7A 4PYNA 3FUXA 3UA3A 1BHJA 5CVUA 5ERGB 4PYKA 4CKEA 5KQRA 3LGAA 1F3LA 3ELUA 1Q0SA 5GIPE 3DP7A 3JWGA 4MQ4A 2ZBRA 3NVKI 4LWPA 3BT7A 1KP9A 1P1CA 3KR1A 4HH4A 2I62A 3IYLW 1ZQ9A 2F8LA 4RTSA 4E2WA 5BXYA 3GRRA 4RTPA 1L3BA 1P39A 2CWWA 1NE2A 3BWYA 5E1DA 2PT6A 4XUEA 3HP7A 3M33A 3E7PA 1X19A 3ELDA 1JG1A 3KPUA 2Z6AA 2AZTA 3T7TA 2CL5A 3KR9A 5HOQA 1RJGA 3FTDA 1DUSA 5DT2A 3WSTA 4POOA 3R0QA 5BW5A 3PFHA 1FPQA 2ZVJA 4R6WA 3UWPA 3BWCA 2ZTHA 3IEIA 1QAOA 5EQJB 1KIAA 1UIRA 5EZQA 2AN5A 2ZCJA 2V7EA 2ZFUA 2I9KA 4KW7A 4ISCA 3FRIA 2VP3A 4RVDA 5CCXA 3G5LA 3G8AA 4AX8A 3CVOA 1MJFA 2UZ4A 3FPFA 4PYQA 2QE6A 3HNRA 3UJ7A 3ERCA 5EEHA 3SM3A 5FULA 1RI5A 2CMHA 2Y1WA 3U81A 4UOEA 3HTXA 2QM3A 3HM2A 3NDIA 4QPPA 3T0IA 2BH2A 3NW9A 3V8VA 2H1RA 3KQVA 1R8XA 4PCLA 5E2AA 3PFGA 5EG5A 1X1AA 3CJQA 1KHHA 3KPWA 4E2YA 2AOTA 3OCJA 2AOWA 3MERA 4ZTBA 3EVBA 1L1EA 3JWIA 5DLYA 2YR0A 3FPEA 3Q7EA 2AN3A 4XUDA 3TKYA 1NBIA 4K6MA 3A7DA 2WK1A 1TW2A 2IFTA 3NJRA 2UYQA 3K0BA 3R3HA 4X1OA 3OE4A 5DM2A 4KDCA 4NECA 1SQGA 2VDUE 3EMDA 1R74A 2P7HA 3QOXA 3SSMA 3THRA 3FPJA 2ZIGA 4OQEA 5DX0A 4AZSA 5GWXA 1AV6A 4KRGA 2AOUB 1IY9A 4QDKA 4E33A 3A4TA 4GC9A 2YXEA 3C3PA 3EVCA 3Q87B 4P58A 4U7TB 2H00A 3LKZA 3KQOA 2NP6A 2ORED 1X1DA 3B5IA 3CJRA 4P7FA 2PSSA 1M6EX 1PRYA 5FWAA 2QY6A 3G5TA 5D1NA 4R6XA 1T43A 2HWKA 4RTRA 2DULA 1R6AA 4YMHA 3G2MA 1INLA 4QTTB 1WZNA 3FPGA 1YB2A 3UJAA 5CCBA 1EJ0A 2AR0A 2BZGA 3R6TA 3KQPA 4HRAA 2ZIEA 1SUSA 4RTMA 2IDKA 3QV2A 9MHTA 4QQNA 3BKWA 2HR1A 4ATNA 2ZZKA 3DLCA 4LECA 4FSDA 5LQRA 3BGVA 3UJ6A 2QRVA 1I4WA 5H02A 5FUBA 2JHAA 2P3OA 2UYOA 3P2EA 5E8JA 5GP1A 2ZBQA 5C0OE 2P41A 3UBTA 4RTNA 2P35A 3M6XA 4H0NA 4DMGA 2IPXA 5LQNA 3ELWA 2HNKA 3OPNA 3LCUA 2GPYA 5DRYA 4AZVA 3FRHA 7MHTA 1NW3A 2O57A 1SQFA 2VZ9A 5DXJA 3SVZA 3KR0A 3PB3A 4YUVA 4GOOD 3R9XB 2GH1A 1JSZA 3MCTA 4A6EA 1QANA 3FUTA 3LBFA 3HCDA 5DM4A 5EKUA 3OU2A 3UJCA 3PTAA 2P7IA 3TM5A 5HIKA 1RI1A 2FRXA 2ZZMA 4HTFB 1XCJA 3T7SA 2JH9A 1HMYA 3GJYA 3VSEA 1XDUA 2IP2A 3CGGA 5CVDA 4PYJA 4YV1A 3GCZA 3MCZA 3LPMA 2I6GA 4PYLA 5LQAA 3NWEA 2N47A 3DTNA 3BXOA 1XXLA 1JQEA 3I5UA 3BZBA 1AF7A 1B42A 2O06A 5FTWA 3HA7A 1YUBA 4LWOA 2OXTA 4RTLA 1AQJA 1YZ3A 3IHTA 4HGZA 3O7WA 4OBWA 4CKCA 3P2KA 3I53A 4C08A 4YUYA 3TR6A 1M6YA 3FUVA 2HV9A 1H1DA 4FT2A 4PWYA 5FA8A 1XDZA 1UFKA 2PKWA 3E23A 2PLWA 4EQZA 1EAMA 3FYCA 1VQ1A 5JR3A 1O9HA 2O07A 2G72A 1YZHA 3HVKA 1D2CA 4QVGA 4RX1A 5HIIA 5M5BA 3H2BA 4KIFA 2V74B 1TW3A 5DTQA 4E2ZA 3EVEA 1O54A 2XVMA 3P9KA 4P7KA 2ONYA 4WVLA 5K03A 2VDWA 1SG9A 5DRTA 2G1PA 3CC8A 1OR8A 1D2HA 3DMGA 5B1SA 3GRZA 4DM3A 1D2GA 3PVCA 4R8RA 2G70A 4GQBA 2BM8A 2OPBA 5CM2Z 3HVHA 5CVVA 2C7PA 2Q41A 3AJDA 2WA2A 4RV9A 2P40A 5EIWA 4OX9Y 2OB1A 2YVLA 3C6KA 2VS1A 1NW7A 3AWIA 2NYUA 3KPVA 3KQMA 5DWQA 3EGVA 4M36A 4OA5A 1O9GA 4WXHA 5K09A 4ER0A 2Z6UA 3PLAE 1QYRA 2IBTA 1SVUA 4X61A 2XVAA 1WXXA 2CMGA 2O05A 2FYTA 2OO3A 2YUIA 3BKXA 3HA3A 5U4XA 2PXXA 2PWPA 1RI4A 3M6UA 4Y2HA 4RVHA 3GNLA 3NTVA 2ZWAA 3BGIA 4DF3A 5FA5A 4OBXA 2IIPA 3DXZA 3UZUA 3IV6A 5EZSA 2OBFA 5BW4A 2BR5A 4A6DA 5K05A 1JG3A 3L8DA 1JSXA 4OA8A 1NW6A 3LDGA 3GWZA 2ZBPA 2FK8A 2YX1A 2AOUA 2ZWVA 4ER3A 3TQSA 2BR4A 1DCTA 1ZGJA 2ZIFA 4L7VA 4XUCA 4C4AA 5DX1A 5MHTA 5C1IA 2ZSUA 3OZSA 2PX8A 2XYRA 4HSGA 4YV2A 5KYGA 3V97A 4CWAA 5ICCA 4RSRA 2A14A 3CCFA 4IWNA 4HTFA 2IGTA 5DX8A 3THSA 3GO4A 3M70A 1R18A 3TLJA 5E1MA 2JHCA 5T64A 3KR2A 1XCLA 4CKBA 5EC8A 4U7PB 5E2BA 3SX0A 4PCAA 3FUWA 5K0JA 3LL7A 3FTCA 5HZMA 3MQ2A 5DM1A 4C07A 2AVNA 4BLVA 3G89A 2JJQA 5DM0A 2ZLBA 4FSXA 4C03A 1EQAA 4GOND 4KIGA 3HVJA 1VPTA 4AZTA 3LBYA 4XCXA 5GM2A 4BY9E 2ONZA 2H11A 3AXTA 3DXYA 3LCVB 2IBSA 3HCCA 2EFJA 3I64A 3UFBA 4YV0A 1NKVA 2ZULA 4MIKA 4F84A 4PINA 1RI3A 1VE3A 1VP3A 5CUQA 2YQZA 3GRUA 4PYOA 2ZZNA 1WG8A 4YUZA 4RWZA 3P71T 1RJEA 1ZG3A 4PIPA 2ZW9A 1NV9A 3MTEA 3T7RA 3TM4A 1M0EA 2EJTA 2YXDA 1X1CA 3EVZA 3OE5A 4P7GA 2G71A 5K0LA 3SXJA 4C06A 5BP7A 2NXJA 1KPIA 1EJ6A 3FYDA 3EEOA 3I58A 2BM9A 4DA4A 4JXJA 2C7OA 3VC1A 2AN4A 1JR4A 2GAFA 3HA5A 2NP7A 4F85A 3MHTA 4MHTA 4DCMA 5ICGA 3EVGA 3REOA 3VC2A 5GOZA 3F4KA 3RW9A 2OY0A 2PX5A 2NXCA 3MTIA 5EGSA 2XYVA 4X63A 3S68A 5HFJA 5FADA 5LR6A 2ADMA 3K6RA 3GRYA 3SSOA 1V39A 3EGIA 1QZZA 3EPPA 3FTFA 1KYZA 3B89A 5HILA 2PWYA 1JTEA 2DPMA 2LD4A 3EVDA 8MHTA 4PONA 1G6Q1 5E1BA 3TPZA 1WS6A 3P97A 1ORHA 1L3CA 2B9EA 1Z3CA 1XVAA 3G2PA 4IV0A 2PBFA 4KDRA 1RJDA 2NNWB 3A25A 4F86A 5K0GA 2AOTB 3B3GA 2R3SA 5EOVA 5DTMA 3B3JA 1RJFA 3P9NA 1WXWA 3FUUA 2EJUA 2IDJA 2OB2A 4CTKA 2UYHA 1QAQA 2ESRA 2P8JA 5E9QA 4O29A 2C7QA 2GA9A 3E8SA 3MAGA 2P3QA 3ELYA 5KS2A 3BWBA 1BC5A 2O0LA 4KWCA 5FQNA 3OU6A 4ER6A 3DLIA 1FJXA 5F2NA 1R00A 1UWVA 1Y8CA 1U2ZA 4B17A 4BLWA 4MWZA 2B25A 4GBED 3G2OA 3LDUA 5EMKA 5EHGA 2PVCA 1L9KA 5GM1A 3PX3A 4M7RA 3OZTA 4LG1A 1N7IA 3SGLA 4FGZA 3RIEA 4R05A 3PX2A 4HC4A 5E1OA 3DOUA 5FQOA 3EVFA 3JWJA 3BWMA 1XJ5A 2PY6A 2OZVA 3LCCA 3AXSA 1YF3A 2FK7A 1HNNA 2PX4A 3O4FA 5C9ZA 1KR5A 4HG2A 3SR4A 1JG2A 4GEKA 1VP9A 3OZRA 5E9JA 1QAMA 3GU3A 5DTRA 2B2CA 1KYWA 4C05A 3DXXA 4AUKA 2NXNA 1XDSA 3M6WA 3BUSA 4CTJA 3KQQA 4P7JA 1I9GA 3KQSA 4C04A 5KQSA 1ZHFA 3ID6C 1BOOA 3CBGA 5FWDA 3P9IA 3CJTA 2HMYB 3HVIA 4EKGA 3JWHA 4V0RA 3P9CA 3LDFA 2AS0A
chains in the Genus database with same CATH superfamily
2X6QA 2GTIA 3U7RA 3ELBA 1Y5MA 1FQJA 2QYOA 4FZJA 4QASA 1WPGA 2GKSA 2C84A 2FSSA 5JSYA 1WVIA 3PC3A 3E2IA 4OFXA 5EWLA 4G0ZA 5K0BA 4KB5A 3GNSA 3KV3O 5HWSA 3N5CA 1U8AA 3L8YA 1I2MA 2UDPA 2PZMA 6PFKA 5IDWA 1UC5B 2V5UA 3EC2A 3M6LA 4BNHA 2W4QA 4FNGA 3NO4A 1POWA 1XN1A 2VJLA 3CW2A 1O0BA 4FR2A 3OD5A 5PNTA 1IY1A 2AKYA 5A6VA 3GGCA 4BEBA 4K81B 3F6BX 2XMQA 5A9RA 2MMGA 2HNAA 2XI4A 2F3UA 3JVIA 2C8JA 3ABOB 4D97A 1NUUA 1O9BA 3C5CA 2QAIA 4S0XA 3AEKA 1E0KA 4XW2A 1KXZA 2BD0A 4FYVA 2NO9A 3B6KA 4TVOA 2HREA 1A7KA 1GR0A 1WWKA 3OIWA 5JQGF 4OK6A 1D9XA 1W4ZA 4FT4A 1OX6A 2I8LA 4NULA 2VDRB 2OAP1 3KKLA 4B3TB 3HNPA 5D6YA 2QTNA 3DAFA 1BDBA 5BOVA 2HCJB 4G41A 2H9IA 5K0EA 3BC1A 3KOMA 2IHKA 3TJRA 1A8UA 1E1LA 2BFAA 5NULA 2Z1MA 4IGFA 4X1KA 2QLMA 5IARA 3NWBA 3DAPA 3ZVLA 5GZ3A 2DCUA 4JL6A 1Z45A 1CFJA 1DG1G 2H7YA 1JIKA 1KRHA 2GLUA 1PVOA 2WP8J 3O91A 3RQIA 3SJZA 2ZPUA 4CE6A 2BONA 1GM5A 4NJMB 3QY9A 2OV2A 1FTSA 3WO1A 5CNMA 4MR8A 3PFBA 1P5FA 3HXQA 4G37A 4XA8A 5CK5A 5LQCA 3HHPA 2GUGA 2FRDA 4XGRA 1NM5C 1C7JA 2DX7A 2NU9A 5BYBA 4BAZA 5LN1A 2GGSA 4AMGA 4DR1B 2JANA 2LZ0A 7ABPA 2PMKA 4A0SA 4DANA 1HKUA 4BLQA 1XQYA 1DX9A 5L6LB 3KJGA 1A9TA 3W34A 2DLNA 4D9CA 4HADA 2Z8YA 2SNIE 3BGDA 1NXVA 3VKGA 3CN9A 1JIVA 3A2NA 4MR9A 3VR3D 3OA2A 1QHGA 5AW4A 4JT8A 4KXLA 1FVXA 1FX0B 1P2UA 1G41A 5BR8B 3IS3A 5CA1F 4II7A 4QEZA 5DNDA 3VPBA 1Z25A 2AL7A 1O87A 3D7SA 4S1NA 2JFOA 1M2VA 1MV5A 4J0DA 2Q49A 4QZVA 4OP2A 2HUNA 1JE0A 2XMBA 3PHIA 3O73A 2R751 3RODA 1Y98A 3UMSA 4X66B 3KZNA 5BW6B 3UGKA 3JU3A 5CH8A 2MINB 5CDHA 2QW1A 5AJYA 1ZD2P 1NV8A 4F9TA 1OLXA 4CM9A 3PR3A 4LDAA 1O1YA 2VDMB 4QOJA 2XXBA 2CLEB 3MT9A 4OMFG 2WVJA 3AP3A 4FGLA 5C7LO 3ZU6A 1PGQA 2F9MA 1QX3A 3NIGB 5I01A 4QU5A 3IP5A 1PG2A 4DIFA 4ARUA 4DKJA 1PV4A 3AC0A 3KS9A 1NIJA 3OZDA 1MW8X 3HCBA 1UR5A 5AVXA 3AM5A 3NHWA 4ZYVA 5IHPA 2EW2A 1L5QA 2VOJA 2WTNA 1C9KA 3W5IA 5A4DA 2E6KA 1U2RA 3IUSA 1P5ZB 1RXUA 5LPNA 1LNZA 3AJAA 2JVJA 1EEXB 1YV9A 3KHKA 4TN1A 5DNWA 1VDMA 1J70A 1H2ZA 3A26A 2NPIA 1ZOPA 3A1EA 3N0WA 3ODPA 4GR5A 4ACAA 4U6NA 3H42B 1E92A 4HMPA 3TS1A 3AHCA 3AKCA 4MOWA 4C2UA 1V8OA 4NYJQ 3G0IA 3BCUA 4RZQA 4UJ3A 1D1SA 1V9LA 1ZK2A 3FETA 3JAWA 4D8YA 2RGCA 5CVUA 5INTA 1U1FA 3AF5A 5BN4B 1EG7A 1AZSC 3A9TA 4GMFA 1Y8QB 4MQ4A 1V1MB 2W22A 1A5ZA 1GQQA 2FJUA 4IEFB 3BT7A 1Q1AA 2XOXA 3IYLW 2GD2A 3WJ7A 3ZIDA 2DFKB 3MUNA 5K4AA 4IDHA 4N3BA 3R0VA 4OOFA 2Q2QA 4DEXA 4RD2A 2CWWA 1G3IA 1RRKA 2IEAA 3Q41A 3PC7A 3GNTA 3K72B 4LV8B 5LKAA 1AK9A 3HP7A 2DOKA 1XLUA 2X3YA 2JB9A 4GNRA 4RXTA 1X19A 3NWPA 1LNSA 3F6SA 1I0IA 2PMDA 3KPUA 5KAMA 1K88A 1ZK1A 1R6BX 1MA3A 4H35A 5DKFA 7REQB 2FPPB 2W2VA 4YAEA 4JUAA 4D7AA 1TO6A 5AM3A 2RCYA 3IPLA 5LB2A 2BELA 2DVMA 3S1SA 4V2IA 1M73E 1YR8A 2KMLA 5FTNA 1MO5A 4UHJA 5KYXB 4AY3A 4C88A 3OX1A 3SXUA 3Q12A 5HVNA 1II0A 4KAAA 1NOKA 4XVRA 5CCXA 5B30A 2WFMA 3GLTA 3QUBA 5JD4A 1XD9A 2B8JA 3MN1A 2UZ4A 5H70A 1JQLB 2IYQA 1QBKC 2Z95A 1Y6FA 3SM3A 3HRIA 1F5SA 2X9GA 3OBIA 4IIBA 1L8OA 5EQFA 1ISGA 1EX1A 3JQAB 3NW9A 2CZCA 4K03A 5AHWA 2JK1A 2WF8A 5AICA 4HATA 4NS4A 4JOSA 3LCRA 2OZPA 2PKXA 4BGDA 1YZKA 1SUCA 2H2AA 2YBDA 4EY4A 2EFCB 2HK7A 3ZVMA 2NVOA 4B4VA 1XDGA 1B41A 1NW4A 1PR2A 2Q2NA 3WL3A 4GBGA 4E13A 1WB5A 4NARA 1T9GS 3G13A 1KJZA 4LK3A 1ZN2A 1VDZA 4LS3A 5A9SA 3K1TA 3C3PA 3FFTA 4KODA 2P6NA 4KR6A 4JBGA 3V4SA 4CDMA 2EP7A 2XNKA 1ZH2A 3HV2A 4HTAA 4O2LA 4Q37A 3TW4A 4B5KA 1Z7EA 1ZMRA 2Z2IA 2I7XA 3B9BA 4MVJF 3TZ6A 3WP1B 3M9WA 5DHPA 3TSWA 1A9XA 2JFUA 3BG5A 3QITA 5JALA 1WZNA 2UZ1A 3BILA 3EB9A 2ZRBA 3EE6A 1WDLA 1GY8A 3KQPA 3KWLA 4TZTA 3WWZA 4YRCA 4R71A 4GRDA 2VF4X 4J8PA 1LLCA 2AFRA 4KXUA 2O6LA 3RH0A 3EIQA 4F4UA 4KEAA 4Q47A 4K6GA 4MWEA 5I4CA 2WM2A 4QLOA 2ZWPA 4RHYA 5FO0A 1CEQA 2ODWA 4X8MA 3VU3A 2JHAA 1T26A 2ZJ7A 1Y4SA 3P2EA 5C2JB 2OBBA 3GEGA 1ZP6A 1FK8A 3I9V6 5JCPA 1JWLA 3OQOA 2GF0A 4L75A 2CEKA 4X62B 2ID8A 4ZT7A 1RWKA 2FKNA 2JFBA 2D2IA 3ITNA 3MGAA 5LIPA 3ZPXA 2W48A 1IN8A 2ZRQA 4NABA 3HRKA 4XDHA 1FVOA 5EJGA 2GN8A 5SZJA 3O1HB 3VTKA 1PW7A 3ICVA 1IIRA 1J5PA 1HV8A 2R6DA 3A4VA 3IDQA 1BGXT 1O5IA 3LPCA 4G2TA 3CRW1 5H1YA 3B7WA 5JNTA 3KC2A 2POQX 4Z3DA 3ST7A 3GJYA 4FBLA 4U5QA 3PXGA 4LK2A 1OCEA 4MA0A 1I1QB 3I92A 1CY6A 4NZMA 1YBAA 3LK6A 4R31A 4RFLA 121PA 3EDRA 1TUGA 5KYWA 5KDDA 5AHOA 1I32A 1V45E 2QQEA 3GG9A 4EO7A 1XV5A 5CLGA 1E18A 1LK5A 4UNIA 1G9TA 1OIWA 4JIGA 1MPXA 1NR7A 3E9RA 3GELA 3LFUA 3RIXA 3D8NA 3E5MA 3M4YA 3WGQA 3BULA 5EESA 3IBGA 1N2OA 1P19A 2H4WA 1CJUC 2QM7A 3CLKA 1U8FO 1LV7A 2CNKA 1CUAA 3CX3A 3DQPA 3LP8A 2J9YB 4UE6A 4D96A 2KB0A 5K99A 4KREA 4UPEA 2JI6A 2GD1O 2YNMC 5D2CA 1YO6A 2XCQA 3E23A 3IDSA 5HZKA 5GOTA 4EQZA 3EFHA 4KXQA 3RUHA 3QTTA 4Z0PA 2IBMA 1CQJA 3QUCA 4HBGA 1Q74A 1MO4A 2PA0A 2QVCA 3KKPA 4TS9A 3FOZA 2GR9A 3S7TA 1K0UA 1Y33E 3ZV7A 1BMFA 1D2CA 1XF1A 3W2TA 1VJ5A 5M5BA 4TVKA 3EIFA 3W4JA 2FW1A 4LF8B 3JTMA 2H1LA 3T34A 2QPAA 4M49A 1LPBB 3PT5A 5D8DA 1C8BA 1P2GA 5K3OA 1TYCA 2W6ZA 4G9GA 4IDDA 1KMNA 1DRWA 1G9SA 1SG9A 2P6PA 4PSUA 2VYFA 4BEVA 4U1RA 4F72A 2ZI4A 3V80A 1L7EA 4A8PA 5HUQA 4BKRA 5K9ZA 2NYVA 2OO5C 2UZAA 1YR1A 4JLWA 3AVWA 1IZYA 1W96A 1FFWA 2QL6A 2VS1A 3KPVA 2H0AA 2JF0A 4ER0A 2BVNA 3UHOA 2DGDA 3VOAA 1DBVO 4M2LA 4QUKA 1KRXA 5EPPA 1GLVA 2FYTA 2I4OA 4E07A 4LXYA 4Q7QA 5A6SA 3M6UA 3KWMA 1TE2A 3RBAA 1OGYA 4OJKA 3NTVA 5HGJA 4H16A 1OPRA 1Z2CA 4HRVA 3BSFA 3GA7A 4OATA 5JFTA 3KZXA 3WLIA 1U28C 3DE0X 2GWRA 3KAPA 2PUEA 1TU0A 2R48A 5BW4A 2N46A 4ERNA 4JB3A 2LW6A 3FCXA 2PGDA 4BV8A 1FQWA 3E82A 4KR2A 3CUVA 2I67A 2ZI9A 2R87A 2PG3A 5KYWB 4XUCA 3UWOA 4A1FA 3IR7A 2KBFA 2AQIA 2P6UA 5GJCA 4BO6A 5KYGA 4HXYA 4WVFA 2IHBA 3FDZA 1QKJA 1OBCA 1G8FA 3IQEA 4RSRA 2YRFA 4R2WA 4A5SA 2PUBA 2GXSA 1FYVA 4Y2QA 3RRNA 1J20A 1TAQA 3CZ9A 5T64A 4CF4A 1NNEA 5F5LA 2QLLA 4KPGA 4F8EA 2QSJA 1RYBA 1YQQA 2ZR8A 5BWMA 4L85A 1HE3A 3LOQA 3F46A 3FTCA 2FZEA 4HWTA 5DN6A 5IH7A 3VUFA 4N76A 3INGA 2HFKA 4WKPA 5KDOA 4AW9A 1RBZA 2EARA 1SPXA 2GN2A 5FNVA 1FFBA 4IR7A 2YCLA 4CI9A 1FNMA 4PWZA 5IC4A 4MQMA 2FW0A 4BNDB 4PM4A 2LP4Y 3O74A 4EBFA 2HIMA 4ZV4A 4BY9E 2XNCA 2W6QA 1HSZA 2ZJ2A 4J0EA 2DWPA 1UJBA 1ZJZA 2HLDA 1N7HA 1KEVA 4YJHA 2APJA 4DLNA 3BVPA 1JXQA 1MT3A 1E77A 4YWHA 3D6AA 2GBCA 2ZRDA 2QVLA 1GNRA 3HXTA 2TECE 2B61A 3OX2A 4I50B 5AK6A 4EA6A 1ADCA 4JJGA 4KWIA 4DIEA 4TKVA 5HZGA 2QRPA 2VKTA 1PHRA 2VKQA 5AVKA 6Q21A 4C21A 4D5EA 3MJEA 4ZJPA 2PGAA 1Y9EA 3FGPA 3ODGA 2G71A 3QXSA 2C29D 1HEYA 4IJQA 3IIJA 5JCOA 3PI6A 2H85A 4DW8A 4EFLA 1MENA 2JFWA 4P4GA 1U0EA 5HK8A 1XO1A 2BMEA 2C31A 4MHTA 1NNSA 5TRTA 4FDTA 1CZRA 3M9LA 4PHHA 3FLBA 2PTHA 4HPJB 3OZ7A 2XHEA 4JKIA 5JXWA 3F4LA 1OFGA 2M6SA 1YRBA 3CTMA 2WMYA 3MTIA 1X8KA 2PJUA 3EOBI 4N54A 4NG5A 4XDYA 5FV4A 1B8OA 1HFWA 2B5VA 4MARA 4ND7A 3VISA 4GZLA 1KETA 1T29A 3DR3A 3CH6A 1KYZA 1V3VA 5AOBA 3GZJA 5HILA 1RYEA 4ON9A 3TRHA 2WHEA 2JDID 3TPCA 1USVA 3P97A 4TMWA 4GBJA 1R0CA 1LFDB 1A95A 1C41A 1OTXA 3A25A 3T6KA 2QUAA 5LYJA 4H3VA 2XUFA 3M8KA 1HKHA 2Z08A 4OU4A 4NZPA 3ZHTA 2C4MA 1S3SA 3ZHBA 5IVDA 1Z08A 1JSRA 1U5BB 3I1IA 1PJCA 1VHTA 1WXWA 2DBZA 2X5XA 2IPNA 2RH8A 3A4LA 3ADPA 3QJYA 4LZZA 4MAFA 1IK6A 3CCBA 5BNIA 1VMAA 1QTIA 3BPSA 2GA9A 3L6RA 2YUTA 3R7FA 1MEOA 5KEIA 3QX8A 1ZJYA 4FGKA 4ZJYA 1OT5A 1XQ1A 5ILQA 4BC1A 4KGXA 1MB9A 1FJXA 2CXHA 4QJBA 4IZOA 5KNDD 2WM3A 1W6RA 1DFGA 1OFUA 3C98A 2HBYA 4LJ6A 4B2YA 2IOFA 1SKYB 3HZZA 2IEBA 4R01A 1L9KA 2OM6A 2OMEA 2YV2A 3DE6X 4DT1B 3QGMA 2OLEA 1KYYA 4JVMA 4MA5A 3TGPA 4G5QA 3AF1A 4LZLA 5FLXA 2IY8A 2YYYA 4Q9HA 4QA9A 1U7UA 4RVNA 4G0PA 4MGZR 1RADA 3B9QA 1N3IA 3TMAA 5JDIA 1XXHA 1QP4A 4HDNA 4MVYA 3OT4A 2IQIA 5BMVB 1JZTA 3KXDA 4FMPA 2J3QA 3DWEX 4U9HS 5DU2A 3GPLA 3A6EA 2H7XA 3EGOA 3N0TA 1UPUA 3DWGA 2VAPA 3PK0A 1KSGA 4L2IA 3WYCA 2Y2UA 1U7HA 4UUOA 1JHRA 3OPXA 3TQTA 4K9QA 1GARA 2FE1A 2W37A 2DH5A 3QVKA 3UBMA 2HMYB 4OK3A 2Q3JA 1HK7A 2K2WA 1SPBS 3VO8A 5J1SB 1M2JA 3LDFA 2J6CA 1M6NA 4L78A 2UVDA 4M7PA 4LF9B 3Q4GA 3EMKA 1EESA 3ZJVA 2PUDA 2HRBA 3CZ5A 4NK5A 1WM1A 1KJJA 1E58A 3ZW7A 1WTCA 4LOJA 3DQQA 4YCAA 2C7VA 2IZ1A 3QYJA 5BWBA 3E15A 3RK0A 5D6NA 3K2EA 3QX7A 1DIOB 3FIUA 2G4CA 1XTTA 1UJ4A 2R25B 5JVDB 4GF5A 3H9BA 2G06A 1P1BA 1WP9A 3S29A 1RKVA 3WIOA 3CUWA 3Q9LA 2B92A 1O6CA 1KVQA 4YAIA 5JJ5A 1A7UA 1AN0A 3CT6A 2E1PA 3EGDB 2FG5A 3TVYA 2O3UA 3N9IA 7YASA 4L4YA 1HOXA 3BJIC 3GXOA 3JZFA 4ESEA 1MFPA 3HKBB 2ZYWX 4PYMA 5CVJA 1A0OA 1QFMA 3L1KA 3OSUA 3WHPA 2ATVA 3LNTA 3ZD9A 3UA4A 5IAAA 2HQOA 1QE5A 1MJGA 3ZCRA 1LNQA 3ZCQA 1BKYA 1DKPA 1L4NA 3CHYA 3CKKA 4FGJA 1WR8A 1Z0KA 1C5KA 2YICA 3JALA 3TZBA 3GW8A 1A9SA 2XZOA 4URYR 2VPXA 4HAWA 3VHLB 3HGQA 1QYIA 3A14A 4ARBA 5JT1A 4TQ9A 2AOXA 3H2SA 1GGHA 2I9PA 3O90A 3PGLA 4F3CA 1X6VA 4CIBA 3VR6A 3VR4H 4HNTA 4HN2A 1H8HD 1Z0UA 1CRZA 1UMDB 3QW4B 2FJ0A 5T4EA 3K9QO 5AKHA 4AKHA 4X20A 1GGVA 1YTLA 1HE4A 5FOVA 3RS4A 5JCOC 1RWMA 5LQUA 1J2EA 2WJZB 2EG9A 4MS1A 1GPBA 3PNOA 1I7SB 2HSEA 3HWRA 1QF6A 2A9RA 2V3VA 4BMNA 5I48A 2K7FA 1ZOLA 4PIVA 4R1LA 1JAYA 3I4FA 3ND9A 3UHAA 2QPOA 4RD0A 1PTJA 1QH1A 3ADBA 1G60A 4PFJA 2GYYA 1UINA 3BTUA 4JDPA 1NI5A 4DUGD 1OZHA 1S9HA 2QP3A 2R6HA 2AB0A 2R1TB 5CVEA 1TQ4A 1VIDA 3JQQA 1OIXA 3U9LA 1X8JA 4EW3A 3SR0A 2H1VA 3N75A 5FOUA 2BC9A 2OK7A 3GLVA 2QZ9A 3SDZA 3D2CA 2HSDA 3TKAA 4R8MA 4BGUA 3OE7D 1OKKA 1R6TA 3NB0A 1J25A 3QVGB 2R96A 4I4NA 4QDOA 4RMHA 1MP0A 3AINA 3DDHA 2JS7A 5L7YA 5E8RA 3QNUA 3P0RA 3EC1A 3EG9A 2F2TA 3X1DA 3AOGA 3IOEA 2IX3A 2GYWA 2XWJI 1QV7A 3AHIA 4GXTA 2DHQA 3EDYA 4RQBA 4CL8A 3HO1A 2X7JA 3RAJA 4PNEA 3C6QA 1TMYA 2W00A 1MFZA 1SU7A 3T4PA 4MVJA 3WZMA 2L82A 1RSZA 5CYGA 4D4MA 2WWGA 3CXUA 1WPQA 1G6HA 3WK7A 4QIHA 1APBA 2AFHB 2Q27A 1GUAA 2KX7A 3CLTC 3LZ6A 3ZQUA 1BX1A 1C7IA 2BF4A 1KJYA 2XB4A 2PJDA 4MAMA 4MMZB 1M1YE 5P8WA 1N9ZA 1QR2A 2R7LA 3LKVA 1KEZA 4D4LA 4UUMA 5BV2P 1KOLA 1F9AA 1HF3A 4N5NA 3GJTA 2ZU0C 1I9CA 3PDHA 3IAM6 5G4KB 4LRXA 1A72A 1RQGA 4JSRA 4C7VA 2M6KA 4X93A 1LTHR 4JEMA 2PX3A 5F7OA 2X4GA 3QU5A 3TLEA 2PQ2A 2J4CA 4FIDA 4DQ0A 1W36B 4HZIA 1Z74A 1K27A 2CMFA 4E2XA 3HN6A 1JJBA 2GN6A 2VPYA 1Y1RA 2D4HA 2IP4A 1S2DA 4BP1A 1CUEA 4A8JA 4FWTA 4PZLA 2QTCA 5FPYA 5ECWA 1X0XA 1DKMA 4JLSA 1SUAA 2WJHA 2G1KA 4QX6A 3BXGA 4DE5A 2P78A 4MV6A 1FSSA 1GTJ1 1SC1A 3FZYA 1XZKA 2F8MA 4GPD1 4WL0A 5EXXA 7GPBA 1WKCA 1TD1A 2JFHA 4YTEA 1E59A 5GIPE 3DZDA 1XFAA 4P0QB 3UKOA 5FAXA 1RJ9B 3DMDA 3GX1A 1KP9A 3PEUA 4XR4A 4HH4A 3CRRA 4YLYA 1R0RE 1VJGA 4Y2TA 5CFQA 3LUHA 2H2DA 2HU7A 4QUAA 4XUEA 3A4IA 1U1CA 5AJVB 2GM4A 3ZDBA 1CIPA 1N9KA 2XMRA 3ZOZA 4J6FA 4ZI7B 4JXZA 1GNVA 1VL0A 1U7ZA 1RJGA 1SR8A 2F3SA 2JK0A 5FJIA 4PVCA 4EYSA 2BZ1A 2DQ4A 1RM3A 2V54A 3A32A 2ZTVA 3I34X 1HFJA 3JASA 1NFQA 3EW9A 4ZVTA 1ZUWA 4X3OA 4Y6SA 3B1WA 3MWJA 4E5YA 5B36A 1G8YA 2ZCJA 4G0OA 4N03A 3LZCA 1SBHA 2WQ7A 4RY8A 3I76A 2ID7A 5TT0A 1UWKA 3RVOA 1SXJA 3LQFA 4BN5A 3ERCA 4WGFA 3Q7PA 1GPJA 1UT6A 1L7MA 5DGXA 4YRMA 4I55F 1QMGA 4QPPA 3V1NA 5KHOC 2WOJA 1MDFA 5E2AA 1OU0A 2OCGA 3QVJA 4ACBA 2IF2A 5A7HA 1YS7A 2PPVA 1RXIA 3JYNA 5TMPA 5J4LA 2IYPA 3HKEB 2ILVA 3CX6A 3U39A 5IDXA 5IK2A 1X1SA 3HB0A 4QQRA 3PHJA 4WOCA 3VX4A 3JS5A 3TKYA 1UMCB 2YQ5A 4LMRA 4MW9A 5KAPA 1YS1X 1HYHA 5CPFA 3PUYA 3V42A 5KWEA 2D2XA 3I61A 3HYTA 1NYTA 3QVUA 4QPCA 2ZIGA 4GPIB 1KK1A 3IUBA 1MC5A 1IY9A 2EGUA 3L77A 1NPDA 2HU2A 4W8GA 4WBNB 1V11A 5BYKA 1ZDMA 2G36A 3RGGA 2HHCA 3ACCA 3LHIA 3CJRA 3A58B 4RGVA 1TQ6A 4KQKA 4F6RB 4DR7B 2G88A 4TTSA 4EAQA 1D2MA 1IULA 2YVKA 3BMQB 4J1TA 5ALMA 1DKLA 1UEIA 4ZOLB 2V3WA 3ZHOA 1WLFA 1GZ7A 3EQ7A 3UAOA 5A9SB 5CR9A 4AJ2A 3K2BA 3HYSA 4WK4B 3LVFO 1E1RA 4WT7A 3ZV4A 4DJDC 4B6RA 1W49A 4KMOA 1ML4A 1KK0A 2BWJA 3ZV3A 3EZLA 4RO0A 4BX2A 2FFQA 2XCTB 3IFSA 4FI3C 4JUBA 4PZAA 5FUBA 5H4GA 2CCGA 2PK3A 1OYVA 4WBNF 1CHNA 2VRCD 4I5EA 1V1JA 1PJLA 1A4UA 3M6XA 1SA0B 4LRWA 2IPXA 2QNIA 3CLVA 4CT5A 4I2NA 1XYYA 4KXFB 5D3KA 4WY2A 1HNWB 2LCIA 3MS4A 1UMKA 1Z35A 3QLJA 1XCPA 2IU6A 3WHIA 1EIWA 2RCNA 3PB3A 4WKCA 5EXPA 4D43A 5AOCA 4W9RA 5JMTA 2XPCA 4YRAA 1E1QD 4GMHA 3BCHA 3OJLA 1A2OA 3WRXC 2BMVA 1NIPA 4TTTS 4JN6B 2JCXA 2Y2VA 4IMIB 1NXOA 3THYA 1XHLA 4EHFA 2EBHX 5K3FA 1NRWA 1XCJA 2G77B 1PFUA 1CS0A 1S0UA 3AR4A 1JN0A 3FX2A 1U7WA 2NO0A 3W2FA 1Z47A 2QRGA 2NXWA 4RLFA 3KOOA 3WLEA 3ZHSA 1E0AA 1NKTA 3UK6A 2DWQA 1FP6A 4DLAA 2GWHA 3OURA 1ABFA 4YJFB 1T5DX 4MUKA 3M0EA 3WL4A 1Q17A 3BZBA 1AS3A 1SOMA 1NFFA 2CXXA 3C1OA 3C97A 1JKJA 2XMGA 3L1UA 3Q88A 4ARZA 4N12A 2J33A 3JYPA 3ZIAD 2BSQA 1M8PA 2XWSA 1ZNYA 2YN4A 1T5SA 4F8JA 4OBWA 4CKCA 1WVMA 3N58A 2J9RA 2VJQA 4DKXA 3BH7A 2XUIA 3TOXA 4YUYA 2EX1A 3RRYA 1OD6A 2HV9A 3ISTA 4YYEA 4Z53A 3GY0A 1AXRA 3IAEA 1HWYA 2IZ5A 2PKWA 2ZWMA 3CUYA 2C97A 4B3MB 1JR3A 4ZT3A 3V48A 2X8JB 3AUKA 3EULA 4F5EA 2GZRA 4IIDA 1F0PA 1UC9A 2OC4A 4J7CA 5EUBA 5FL3A 3ZBPA 8ABPA 3JAWB 1K6IA 4RX1A 5EZ5A 4YP7A 3WK8A 2O8NA 3AETB 4DJTA 3NHSA 4V02A 1HDEA 1M1UA 2HO4A 1T2FA 4JJAA 4N40A 4NPAA 4RKYA 2A0UA 2FMUA 2FN8A 1VSBA 3A0UA 4BTLA 2A94A 4B4DA 2YRXA 1E60A 3EXAA 5K3CA 4Z9AA 2FDXA 4GUDA 4L3OA 4AP9A 2RGNC 3DMGA 5KTTA 1C30A 1Y6GA 1SKUA 4CKBB 3IP1A 2A92A 4EL0A 1KI7A 4E11A 3U5TA 1DC4A 2QYSA 2BEUB 4WN9A 5CM8B 3RYIA 1J0BA 1UEXC 1KZ9A 4OX9Y 1T4GA 3C6KA 1YQEA 4YCDA 2BGKA 1E69A 4LGMA 4UTXA 2JRLA 1JDPA 3KE8A 3M82A 4RIGA 4X61A 5BMVA 1JDZA 3FF4A 4OFWA 2O05A 4HSEA 3FWNA 4ZOBA 3D0QA 3AFGA 5EFOA 5FORA 2CSXA 2Q1CX 1KI6B 1NC3A 5BQPA 4CKZA 1Z18A 4Q4JA 1O0CA 3GCXA 3S1AA 1Q0LA 1B93A 3K0KA 4HDSB 1LSSA 4X1KB 4MDYA 3ICOA 4PSDA 2QN9A 4KBFA 5B4VA 3K09C 3L8DA 4YIHA 4YNBA 1WVGA 1HQCA 3SQOA 1L1FA 3GJ5A 4IOJA 4BNMA 1MRZA 4ER3A 4B3IA 1NRXA 1C1HA 3FYHA 1XTUA 2D1QA 3NALA 4O4HA 3DW1X 4YREA 3NI2A 5FR2A 4YMIA 4QREA 3AHFA 2FPGB 1V9SA 4RZ3A 4HTFA 5BV7A 3FD8A 4KZPA 4NQZA 1R18A 2B8EA 1XALA 1JHZA 3DHWC 3ND6A 4G8CA 3QUAA 5E1MA 3JQFA 1W2GA 3H3JA 1TMOA 3NEAA 1S01A 1EXWA 5K0JA 3I42A 2MOKA 1KKLA 3PWSA 1RP1A 2DBRA 1Z0IA 4C07A 1T8SA 1IEVA 2CLIB 3PUVA 2HI0A 1XZJA 3LUGA 4J03A 3OHSX 1BFUA 1PCXA 1QLHA 4JH0A 3C43A 2AD1A 2V9CA 1YA6A 4C4RA 5IABA 1CF9A 2VQEB 3QKIA 2QMUA 4C0HA 3GFGA 3K15A 4PQGA 3GAMA 3N74A 4FU0A 4Q9LA 5CUQA 3OE1A 5AJUA 3SLKA 3ZWAA 1S3FA 3BAFA 1XCBA 2EFGA 4YMSA 3MTEA 2F4NA 4AJ9A 4DSTA 3ZXYA 4MQBA 3MLEA 2NXJA 1Z5NA 3H5AA 4EM6A 2BFEA 4KO1S 3VC1A 3AF4A 4XM0A 3NATA 4PEVA 4PTZA 5ICGA 4LYHA 3H6KA 3W3AD 4S04A 1J0DA 3W0LB 4F9GA 2QL5A 3BIXA 1AJEA 3WG9A 5ALGA 1NNUA 3UK2A 2YWDA 3Q0EA 1JFSA 3NG1A 5EGSA 2RGYA 4B44A 2G07A 1AM4D 4X63A 4I6GA 2IHYA 3GDGA 4KGVA 4MUBA 4LYGA 1SIOA 2BDUA 4I66A 1U99A 2O19A 3TQFA 1NPYA 4JJZA 1RHMA 2NUPA 3Q6MA 4EKDA 2DPMA 1IRXA 2J3HA 3ENZA 4WW0A 4ZRNA 1UODA 4L3VA 3P0JA 4N3CA 1RRCA 3EDOA 1J39A 3H5NA 1ULAA 4H1TA 2NZXA 2UVPB 3JQGB 1AKTA 1XVAA 4TTAA 3U31A 3WHLA 3DEFA 1UOOA 4E09A 4QARA 3QLTA 1BJKA 3L93A 1VFPA 1E7QA 1HI9A 1MXFA 1PL6A 2QT0A 2CJPA 4CTKA 3AVVA 1LA2A 3K92A 2ZVDA 3CLUD 1ZMOA 3D54D 3M4JA 3NTXA 2Q6IA 3VPGA 3H7IA 1LV8A 4CLRB 1KZ4A 1R4MA 4ME6A 2XH8A 1UK6A 1BC5A 2H9YA 3ANMA 4YN3A 4YDSA 1BH6A 3ET5A 2X3UA 3QX9A 3T3NA 1RHRA 3G5MA 2BGIA 3EEIA 3A70A 4CEHA 5KJEA 3NGXA 1CU1A 1DIGA 1YCFA 3OECA 5CA0A 3MJSA 1HSOA 1JNXX 1YCGA 3RUFA 4EGSA 4LRSB 1JF8A 3NCTA 4JOBA 4PSAA 2ZANA 4IDGA 3SGLA 1J5XA 5IC6A 3PYMA 4R05A 1Q77A 2AQ8A 2HHJA 3KBBA 4OP3A 1GG8A 3NM4A 5ESDA 5CHEA 2OZVA 3LCCA 1ECFA 4QXPA 5ESRA 3EXEB 2P9EA 5CURA 3D1JA 4YRKA 1JAZA 4Q3OA 5I51A 2Y4NA 3P52A 4RF4A 3HQ4O 1MOPA 2LGJA 3LC7O 3RYFB 4JKYA 3ILXA 2DETA 2QN1A 3DXXA 4MVJE 1N2ZA 4Y8VA 1BYUA 3MCAA 4F3RA 5CTJA 3Q7RA 1L5LA 2FN7A 2JVIA 3AP2A 4DJFC 2FEXA 3FB1A 3HZHA 1U0NA 1ZHFA 4XB6B 3F7MA 3RVDA 2P9TA 4X65B 3ETNA 4HXGA 1MVLA 4I14A 4B87A 1FLVA 3M9XA 4IUCS 4DBZA 4CM9D 5HX7A 4QFDA 2QAGA 3RFVA 1ZNQO 1H05A 1C2YA 2L19A 1GADO 2G0TA 3LX6A 1I2AA 3RUCA 3RT1A 4XD2A 1WBJB 2FQ1A 1HDRA 4KVZA 4FMDB 3K0HA 3JQEA 4ALMA 1AG9A 1GZHB 4KO4S 1R27A 1U7XA 1CIVA 1LI4A 3E9NA 1HTBA 3JVVA 3OOEA 4U7FA 4Z9XA 2CE2X 2NVWA 2V4MA 3OEED 2Y76A 5IJWA 2O5CA 3L7BA 1BXGB 1M1NA 2RAPA 4LY6A 2ZJ3A 5TPZA 1U80A 4FFWA 1JTFA 3MM4A 4BO5A 3V1LA 4TL9A 4ER5A 4PPQA 2PU7A 2W83A 3RSHA 4J1TC 4ID3A 1NU8A 5AVYA 4MGYR 5AK5A 2X9LA 1UP4A 3PXXA 4RYLA 3NH6A 1OA1A 5BOSB 5JXIA 2R8RA 3CZPA 4Z86A 1J5EB 3QK7A 3V4ZA 1ZUIA 3MCUA 3PC4A 5C5EA 1DKOA 2GEFA 2C2MA 5DGTA 5EZYB 5AK4A 5G0WA 1O5TA 2I7CA 4EKIA 1H1LB 3INYA 3OI7A 1SVSA 4G4SP 4RE5A 1EM6A 4XGIA 5GJVC 4JQOA 3E61A 2JGMA 1XJ0A 1R8YA 1TUEA 2X9QA 3HL4A 2QVYX 3K70C 1VGQA 2JFPA 3B1KA 4WTOA 3MW8A 1U6KA 2WIKA 2ZRCA 3QA9A 2F67A 5AI4A 4IPTA 1V47A 4HYQA 2I65A 5FO1A 4LQLA 1DLIA 2I3AA 1CDDA 1W88B 5ES4B 2RJNA 3COPA 4TLCA 5DOVA 4DMUB 1X1QA 1XHFA 5LZ9A 2EAUA 2P9QA 1DJOA 3NEYA 3M6VA 1XJQA 1ZGAA 3QU4A 4KQWA 1Z5WA 4X41A 4YRJA 4I4TA 3THYB 3NONA 2NUAB 4D4HA 2IQ5A 3JRWA 3Q9NA 5IAKA 1SXJC 1JHAA 1HM5A 1ZGHA 1URPA 2BR3A 1P44A 3DYBA 3QVWA 5DH9A 3WIVA 3K6SA 3FWYA 4D6YA 1IM8A 3PXUA 1OILA 4DJJA 2OOSA 2D1TA 1GNTA 3V7NA 3ANNA 3KU1A 4ZEOA 4QE3A 4DY4A 3WQQA 5HUHA 3VVBA 3K8ZA 3O2QB 2HM7A 1YJBA 3P8ZA 4MRAA 4EHJA 3ZHQA 4UNQA 1Z4KA 2W42A 5ALUA 2P5TB 3IRUA 3CUUA 4REQA 1HDZA 1FBNA 3RWBA 4EI7A 2K87A 4NSNA 3WISA 3HFRA 3NZEA 3UC9A 3LY9A 3MK31 4I8XA 5JG7A 4Z4QA 1RKQA 5E3IA 2RAFA 1GU7A 3Q7QA 2CVPA 3R0JA 4G07A 2OGZA 3BIJA 3L8FA 2ZYSA 4HLUC 3EMBA 4A5OA 4EMTA 1K3UB 1E4OA 5KKAA 1T1SA 4HAOA 1YK0A 4MKRA 4IJVA 4DC0A 3FPRA 3UH1A 2MM0A 3SXPA 2AG0A 3BCSA 3KKNA 4UVIA 5GV7A 3WNQA 2Q3MA 1YFJA 4WE3A 2PO7A 1B7GO 1ZMBA 3NKFA 2JBWA 3BICA 3F2VA 3BB3A 3H5IA 1FU8A 4G26A 3TW6A 3ZCUA 1VL8A 2MU1A 2QD4A 1AF4A 4BNTA 2BGWA 3B3FA 3G5AA 1Z0JA 3TZLA 3NNSA 1YZQA 3RDPA 1I8TA 3TTSA 5IM5A 3GOQA 3HXKA 1RPNA 2HRZA 1JIIA 1M5TA 5AHKA 5D3MA 4JYZA 1CUFA 1U04A 1T5TA 1EQUA 4YAOA 5HEKA 1DOHA 3P7MA 4PPNA 2PV7A 3I0MA 2XQGA 1N1GA 4KV7A 4GOXA 4RV5A 5G40A 2OC9A 2X0EA 3T38A 1M75A 1T36A 3DUWA 4K6OA 1YIOA 1X42A 3AK4A 1WUKS 1G1AA 4RTKA 4R2LA 3M5PA 3MWDB 3M83A 1NSTA 3RAGA 1WRBA 4PYNA 4B3XA 3UA3A 2OFWA 4EY5A 1TM1E 2W11A 2CC2A 1CR1A 2IYVA 2JFXA 2YZGA 1I14A 3ABZA 3LT4A 4M87A 2A1TR 2QL7A 2O7NA 3K94A 4HRYA 2VRWA 3JWGA 2JAPA 4NHOA 5K45A 3HXOA 3FYUC 2J4DA 3AILA 4LE2A 2G0AA 1T3SA 3IB3A 4OBBA 4MVJP 4UTPA 4ZK2A 5HR5A 2VH2A 1UKAA 2PLAA 4YLEA 5JAOA 3ZYCA 2Q6OA 3TDNA 1L3BA 2GCIA 4C4XA 3IERA 4NY1A 5REQA 1HE2A 2FQWA 2YJZA 1H42A 3D2BA 3M33A 3OOJA 1QIIA 2CNLA 4G1VA 4PYRA 4S1WA 2ADFA 3UC5A 4B7UA 1Y8RA 4P53A 1RLMA 2GZ2A 4G0WA 2R84A 4ZVPA 1TLFA 4KI0A 3SHVA 4EW2A 3UWPA 4BFTA 3BQBA 3S40A 4C4PA 4V1CI 4LYEA 5FT9A 2AXEA 3QFSA 2Q5EA 1ZRMA 4KJXA 1U7DA 4ISCA 1YVPA 1S6YA 2WWTA 3LXUX 3OUUA 4G01B 4TZ6A 2BAGA 2JCVA 1MJFA 3CVOA 3AESA 4UUAA 5IEBA 3SBXA 2JLBA 1JZSA 5I7VA 5CNJA 5GAJA 3UJ7A 1GVHA 4HXEB 4MGHA 5DYWA 2Y1WA 2FFJA 2QRZA 1EH5A 2RKOA 3QH4A 4GRAA 4HQLA 2NO6A 1OOEA 2DKFA 2HV8A 2R86A 1I1OA 2PL1A 3GIDA 3QKWA 3V8VA 4LXUA 3DJYA 2O1SA 4I55B 5H68A 3I5XA 2VUIB 3KPWA 3PCXA 4JCCA 4QGGA 3RLFA 3WMGA 4NE2A 5K8CA 1QCSA 1TMGE 2IHVA 3FM9A 2A5GA 4TRMA 4XZ3A 1BTOA 1GDDA 3PXCX 3F3MA 3OO0A 1PJ2A 3PQCA 1KTIA 2IODA 4BWGA 1YR6A 1TM5E 4KV9A 3S2FA 1NE7A 3AT1A 1EHYA 4GI5A 2V7GA 3MJ4A 2I87A 4JP1A 3K0BA 2JIRA 1JA1A 4U2DA 5JWHA 1IHYA 1ENZA 1QKKA 4IQGA 1H9BA 2NO1A 1BS2A 1KDTA 1UMDA 1ZLXA 4HHEA 4JT2A 4K05A 1YT5A 3THRA 4E5UA 5JV5A 5LMUB 2FEKA 3ZHZA 3ZVRA 4CLEA 1YMQA 3DPIA 4MVJM 1FLAA 3UMRA 5KTOA 2C95A 1G3UA 1H2BA 2FKAA 5AJTA 3KAQA 1UBLS 4C9BA 4QUDA 4Y0NA 5KVSA 4R6XA 1GGMA 4AG5A 1NP6A 3B9RA 1KFKB 2ZS8A 3FPGA 3I2FA 4G1FA 4KBYA 1EJ0A 4XOUA 1WD5A 4ZVRA 3WDLA 1EI9A 3N2GA 2ALJA 4N0MA 4URZR 3RJ5A 2H52A 4TMFA 4MP8A 3TSYA 4B4UA 5I7UA 1VMIA 9MHTA 3B8HA 3I6ZA 3GEPA 4LECA 4PXSA 4N39A 5JJBA 2BRUA 2KI5A 1CLUA 2FWJA 1NQUA 1KEEA 1SXGA 3PUXA 1DINA 4GECA 5PGMA 2J6HA 2P41A 1P2TA 3EH1A 3D5EA 4DLRA 3UBTA 1ULBA 1TIKA 3C8ZA 5AKLA 2ZJAA 3T3EA 3QLVA 4WLNA 5E3JA 2F3RA 2WYIA 4DUZB 1L4KA 2AZDA 2JH3A 3HFSA 3L0BA 1JSZA 2FV8A 1VB3A 4F2PA 2VP4A 5A2QA 4RZXA 1MAUA 3B7GA 3KFLA 3IJPA 4LNHA 1CZKA 1MC8A 2H3EA 4FOLA 1GPLA 4DILA 2VTBB 4TQAA 3SYNA 2A1UB 4MPPA 3TYXA 2Z8YM 2XQFA 4FHZA 1F6WA 1KJNA 2EZ9A 3CKLA 4PHTA 4M1OA 1W48A 4JITA 3GH3A 2IIBA 2TYSB 2P1ZA 2OO5A 1KMQA 4KYIB 3JRNA 4JIMA 1A2QA 4P0TA 2W8ZA 3GBSA 5LXTF 3X2EA 1FU4A 3BXOA 4BVGA 4WZAA 4QXQA 4ZHQB 3T5AA 4I1RA 2HLDD 4MV1A 1TCUA 2B1GA 2XR1A 4PG7A 4UBOA 3IUNA 4NESA 3WKBA 4CHGA 2BEWA 1D4OA 3DJFA 4LXXA 2X23A 3ZH2A 4DPMA 4E22A 1CVLA 1E9SA 2VT7A 3AR6A 3C6YA 2UV8A 3GVHA 3LQKA 1ACJA 3OLQA 3Q2KA 4TLBA 5CB4A 2Q1WA 4UQOA 2JAXA 4C6SA 1ZW6A 3TSAA 2IGBA 3W6ZA 2Z98A 1OU4A 2W6JD 4MUYA 4X9XA 2ZI7A 3OC0A 4Q4HB 4FMDF 4PZPA 4HX2A 1E1MA 1C50A 3NTLA 1GV1A 2C20A 4BKOA 3OM9A 5C8YF 3OPQA 2DPLA 2I66A 1X80A 5IVPA 3AERA 2VAMA 3CNNA 4L4XA 3UN1A 3BZWA 4KTTE 3C6ZA 2YWCA 3OCWA 1TW3A 1PNOA 4H3HB 4YA6A 4DSNA 1DG9A 2H4YA 2P5UA 3WLQA 3MRXA 4MHSA 3VKVA 3ZJ4A 2VCHA 1DBPA 1JLRA 4BKMA 3RVNA 1JLLA 1PTKA 5FF9A 5B5SA 1GZDA 2IXGA 1K8RA 3IGFA 2AN9A 4EPVA 5AW0A 2JL1A 5D84A 3RU3A 3PJDA 1IBLB 3RS7A 1OWPA 2BM8A 5FTJA 1TB4A 3LWDA 4C7OA 1GKIA 3AJDA 4WK6A 5M34A 2WG1A 2BFFA 4S05A 1G98A 1Y7HA 2XUGA 3NHRA 3EN0A 3MRVA 4C4OA 4OA5A 3Q11A 5T57A 2GK4A 4WERA 5MN6A 4J7UA 4HFNA 4HMQA 1XZEA 4QJ4A 4W8HA 3NRCA 5FUMA 1E8MA 5FUWA 3GGOA 4HDNB 5EQTA 1RAIA 3HA3A 3GHYA 4BJ1A 3EWAA 1Z5GA 4DTCA 2XXJA 1M34A 5DFAA 2WAOA 4N7MA 1NJ1A 3KAKA 4BMCA 3AHDA 2WQ6A 4KAFA 2IIPA 3BMCA 4OAQA 4JSYA 4DSZA 2ATCA 4Q6BA 1V0JA 1VKNA 2Q6TA 1UOEA 1KI2A 1P8AA 3T3MB 3LDGA 3KYDB 3P2YA 1E2MA 1KI1A 2AOUA 4J6EA 3X1KA 4OYRA 3NX4A 2WMDA 3JAKB 1TTTA 3GUYA 3A4NA 5MHTA 4BFWA 4D82A 4Z0TA 1I5EA 3CWQA 2DG2A 3CZQA 5DULA 1YB5A 2BRUC 2VLBA 1CZ4A 3IAFA 2Y1EA 1DRUA 4IZIA 3M1YA 4N4AA 1KMHB 4P80A 3VJMA 4BYGA 3ZJYA 1ZCBA 1N6OA 1FSFA 2BKXA 3RBXA 1IJFA 4UCQA 1U5BA 3LVBA 4EB0A 1M8JA 3OF5A 3GOHA 2FPSA 1G19A 5DM1A 3RIMA 1CUVA 4YJ3F 4OHKA 1GPDG 2DQSA 3BMNB 4BL5A 4G5SA 1YZFA 4H3SA 1SU8A 3EFOB 1ZC1A 4FE4A 3IIEA 4FSXA 3VO2A 1KZ7B 3HI6A 3NWJA 4DHEA 3SG0A 4YRZA 4OJNA 1JHYA 4MQLA 1LJLA 4J0QA 4PR0A 1W34A 2QLJA 1LRJA 3A1NA 3BD9A 3CSSA 3CUKA 2GZMA 1EWQA 1B8UA 2PUHA 4J7XA 4PINA 4QRDA 4DV3B 3AGPA 4HDRB 4TPKA 3AP1A 3VR5H 3ITEA 2YHAA 4OIMA 4WCDA 8ATCA 1NURA 2YYAA 4PIPA 5CB4F 3D4LA 3VAAA 5I7FA 3QF4A 3SXJA 4CNQA 1XZBA 4Y1RA 4XD7D 5D5PA 4CGZA 1BMDA 2FW8A 4R41A 5B64A 4F93B 1EFTA 3CPJB 4X20B 2AN4A 1QBGA 2JNWA 2H4JA 5HDBB 4L50A 3MHTA 2QAJA 4MS4B 5KC9A 3EQZA 2RHHA 3JATA 3U7HB 5I8WA 1VL1A 1ZFNA 3ITKA 4IQFA 1W30A 2QB5A 4JHLA 5IXYA 1A2BA 2VBIA 3DQZA 4EHAA 1ESZA 5GVSA 1E6CA 2EDAA 3KJFA 1Y8AA 4EVSA 4FQ5A 2FA9A 1T6ZA 4NMWA 3L4JA 1KO1A 2OP1A 3P0EA 4FLMA 1I3OA 2QQSA 2WZBA 3OIDA 4ZXFA 4R2IA 1L5MA 5AM2A 5F23A 4O6VA 5KNLA 5L3VA 1MJNA 2Y0DA 4ZALA 1H8HA 3UANA 3FHLA 2NO7A 3G2PA 4D92A 5HJEA 5K0GA 5DWDA 1PR3A 2NNWB 2ZITA 3ZXIA 1W85A 3GJ6A 4KPUB 3RSOA 2CLHB 3GRAA 1CXZA 4DVGA 1OFUX 5TMEA 4BQFA 3BFPA 3Q98A 3B3JA 5A5GA 1HH4A 3KD3A 1GFIA 1KEWA 2P8JA 2YXNA 3ZDYB 1BJTA 1K89A 1MX3A 1R4ZA 1QFJA 3E8SA 1X2EA 1L1QA 1AKRA 2OG1A 2PS0A 4R1NA 4XIYA 3CSUA 2CEAA 5E2IA 4URUR 5JE8A 5BPFA 1I4LD 5CNIA 2EFHB 4EG8A 3FDZB 4LHWA 1UBNA 3B13B 1L6RA 1EB9A 3BHNA 2FEOA 4H0FA 1FIUA 1KF0A 3G2OA 3LDUA 4QOFA 1N2EA 1YZLA 4EHNA 3OT5A 2IPOA 1M8KA 4ZDJA 1QRTA 2VIIA 2WU4A 2VAWA 5AP9A 4UQLA 2COEA 3C3EA 1D0VA 3AZOA 3VPHA 1OSNA 3DOUA 4ZQHA 2C07A 2BI4A 2LCQA 3VYTB 4UREA 1O8CA 1V4BA 2FK7A 1RZVA 1SXPA 4N9WA 2DWUA 1UXHA 1KDVA 2PJHB 3S99A 1GPAA 2WIBA 4DS3A 4CHTA 1M0SA 3ETLA 1FUUA 5TS2A 5A3RA 1YU9A 3ZD8A 9ATCA 3TE6A 2BEVB 4O4IF 4IDQA 4DYDA 4CTJA 2WEKA 3DDZX 4KVGA 3IMFA 3AJEA 5DHAA 1B1AA 5IG2A 2GO7A 1QVWA 1RQ7A 5HF8A 2LKDA 3FBTA 3U6KA 1QPZA 1COWD 1EWYA 4K87A 1YB4A 1EYZA 5FTMA 2VF8A 1CRLA 5ECGC 1WHTA 4D9EA 1E6MA 1QIMA 1T8RA 3DG9A 1L5FA 3MB8A 5BWCA 2D6FA 1B26A 5AWFC 4J0CA 2QGNA 3B51X 3ZCSA 4MEAA 3W04A 1T24A 2VDWB 3CLTD 2VPIA 5DGIA 3W7BA 4B35A 4R5HA 4ZCQA 1ODJA 4RDCA 4YRQA 4P08A 1L7BA 1DXQA 2VL7A 2FSUA 3T1YB 2CBGA 1OX4B 5JFGA 1X1BA 1E79D 2AIRA 3CWZA 4FN5A 3QLUC 3WSWA 5IT5A 5JLJA 4NMMA 3Q15C 3QI2A 1MJ5A 4QYIA 3O31A 4HNHA 3PX7A 1BCRB 5DNVA 3UMBA 1M5RA 1L4YA 1JU4A 3HBAA 1IWOA 3O47A 4M8SA 4P3PA 1YRAA 3B6IA 3CZCA 3R2JA 4KYUA 2WTEA 3N2GB 1F8UA 4X64B 3UJDA 5JYEA 1QYWA 2PBLA 3IILA 4LY3A 3LTNC 4U8HA 5AOAA 1KERA 5DK6A 1F8GA 1I1NA 1VJTA 3N0VA 2Z6QA 2B78A 3WS7A 4JYAB 3K1JA 5J40A 4Y30A 2R8EA 1KPGA 3X0DA 3ROEA 3W6OA 4F2WA 4RK6A 3PSHA 1OC4A 2DF8A 4WDQA 1IXYA 3RASA 2Z3ZA 3GLHE 1H2FA 4B76A 4P32A 3AUSA 5JSZB 1EBUA 1OGIA 1NJGA 1SQ6A 2B1IA 4CV0A 2D5BA 5HCUA 2Y0EA 2I76A 1YIAA 2C4NA 3HUDA 3K32A 3R3UA 5ICEA 3GDFA 2YHUA 3HWSA 4OYHA 3GFOA 4TT3D 1TJ3A 3KQNA 4G5RA 5C81A 3P20A 3CA8A 1YC2A 1PK7A 2UZ0A 2Y66A 1MVNA 1WV1A 2GPBA 3ANXA 3FVTA 2QE7A 3HSKA 3OX4A 4FW9A 4R8SA 5FXMA 3DV0A 1UMBA 4RHUA 3GEBA 4U2FA 1VG8A 1WL8A 4L9WA 1XZCA 2Z09A 3S2UA 5BYAA 1XLWA 2O20A 2Y6UA 1WBBA 3GP3A 4KK4A 4KFRA 4B46A 5IT4A 1Z88A 3H2HA 2RHCA 1T6YA 1T3ZA 2VN8A 4KIUA 4DCVA 4OQYA 2FX5A 1FP2A 3L8MA 1FTQA 1O8BA 1DT3A 5AQEA 5FHRA 3ZGNA 5DGCA 1C7ZA 3HCEA 1FUEA 4EA9A 3C3XA 1T3TA 1YRWA 2Y93A 1E9AA 2WY2D 2VK4A 3FVQA 1AB6A 4B8WA 1XP8A 5KPDA 3RVQA 5CD1A 2C57A 2E21A 3HU5A 5DGHA 2D13A 4YVFA 3RVMA 3ADKA 4J29A 4WQMA 3DL0A 2RK3A 4WZBA 4BECA 5A5EA 4YHBA 3MGGA 3NDPA 2FXIA 1GQRA 1A9YA 4IIFA 3RV4A 4Q9AA 3JX9A 3PNBA 3PWZA 4F1WA 3R3XA 1M2HA 4FFRA 4M1MA 2TS1A 3IALA 3KT3A 1DIHA 2VRBA 1ODSA 2EP5A 5EI5A 3QSYA 3C39A 1W35A 3LX5A 1IVNA 3GUCA 1U1IA 4AO7A 4DV4B 4EFMA 5I7EA 4ZRMA 4AIRA 5BWLA 1HLDA 1OA0A 4YI5A 3ROXA 1RYMA 2I2XB 2HA5A 2DTXA 2FWIA 1IN1A 2D5CA 2X58A 4X84A 3IKJA 4JASB 3V7UA 4CIVA 3AYXB 3NGMA 2H4XA 2JLYA 3LX4A 5ENVA 4FCVA 3FDFA 1UJ6A 1UFRA 4JLBA 5UKDA 3SZMA 1E64A 4M83A 4EJSC 4U63A 5ECDA 2JZOA 2AXNA 3BFXA 4TV8F 4G09A 5AI8A 1K7XB 3SS7X 1K6MA 4E31A 2V6MA 4RVFA 1CUWA 5IDVA 5ARCA 3QELA 1O03A 1FXWF 1XMXA 4NQRA 2V3CC 1MIHA 4MGEA 2FEWB 2VO1A 2ID4A 3E18A 1E3SA 1TVMA 4B7XA 2AZMA 1H6AA 3W8RA 2Y6VA 3J80A 3NEJA 1DJPA 1ORDA 4XYLA 5JNVA 1W4CA 3HWX1 3M6MD 4HNRA 4ZAZA 4QLAA 1P1CA 3E35A 1L1RA 5IJ0A 4DEYA 4E2WA 1QZTA 3DOJA 3GQVA 2WJ3A 4HX9A 1K7CA 1QO0D 3TAXA 3P27A 3BX1A 3LWNA 5KYUA 1U1GA 4AB1A 5JZBA 3PGKA 1P81A 3PP8A 1J09A 5HMLA 2HCRA 1V9CA 1WDTA 4KGZA 1Q1QA 4D26A 5C5DA 5GJBA 1JHDA 2O8DB 3ESRA 4Z1MA 4XVCA 1OXSC 5DT2A 3WSTA 3R0QA 4O33A 2C94A 4CEIA 3ZY5A 4W7HA 4AULA 1U1EA 2AFIE 1LTQA 1FYFA 3QOFA 2HRQA 4PX5A 1OLUA 1UIRA 1X1RA 4I7EA 4ID9A 4O2AF 1U4NA 4ODIA 2JGDA 4OQ4A 2P2YA 4RVDA 4BJHB 1PK8A 1WW8A 2AH5A 3H9UA 4JC8A 4OMDA 4TQUS 5LVAA 2R6R1 4BVLA 4ABYA 4BLOA 2PUWA 2BFMA 1YL6A 1UBGA 2P4HX 1IK4A 3FWZA 1JEEA 3KEGA 2BM0A 3OLCX 4KFUA 5JOQA 2C77A 1R8XA 2WAMA 2X0JA 1SCNE 3K9GA 3PFGA 4LRTB 4DRXB 4UE2A 1J9EA 4OL0A 1E2HA 2R65A 4GX5A 3OMWA 1CR6A 4ND5A 2GXUA 2SCUA 4I9NA 3MINB 3OCCA 2WABA 4P3XA 4B48A 3D02A 3L1JA 2O54A 3GRPA 1TW2A 5B7PA 3RO7A 5KSPA 2B82A 3AHHA 3GK3A 2DMRA 1NU6A 3K7EA 1SQGA 4KH1A 3RTEA 1XQ9A 3IR6A 4PGMA 3QMVA 4W5NA 2WHQA 3SSMA 1HDIA 1W93A 2HRRA 2WM9B 3FPJA 4FW8A 4MVJI 3T7AA 4CQJA 5JC8A 2D7JA 1RBQA 1S7GA 1JNYA 4EAAA 1NF8A 2C4VA 2FHSA 1BEUB 2CDCA 2EWMA 2XIQA 1R9NA 3OG9A 4RM2A 4AC9A 1TDJA 2E55A 1Y1TA 2YIVX 4Q9KA 4ICIA 3GH1A 1Z15A 4Y0AA 5FWAA 3UV7A 5J4VA 1EDDA 4A0HA 4A6PA 1XTBA 3A11A 2PMEA 2VOEA 3ZG6A 2OORC 1RHJA 5HKAA 3V3TA 1B0ZA 3FR8A 4ETWA 3PQ7A 2OLJA 4N18A 4U2CA 5ALJA 5BQ5A 4FXOA 3HJRA 4N0EA 3ESDA 4ATNA 1QFYA 5ALTA 1CJSA 3BGVA 4RPCA 3LLVA 1H2XA 1I4WA 2BV3A 2IU3A 3TW8B 2P3OA 2ETVA 3TBKA 5K4GA 4EYQA 1N0HA 3EC7A 3GLGA 3CPHA 3U49A 4D9IA 1KK2A 3C3YA 1GXSB 3EXFA 4JA0A 3LCUA 4M9QA 5DRYA 3C16C 1Q2UA 3SC4A 5KWIA 2QD1A 2LIPA 3KR0A 2HC9A 1NMYA 4GSKA 3IQZA 5BY2A 1N33B 4R16A 4S0ZA 3W8DA 3ZQKA 5JI2E 2AFIA 3C1UA 1PL8A 4Q21A 1GZ5A 1VB5A 4L9AA 2VK8A 1XG5A 1B2RA 2H4HA 1D8TA 2AYZA 4QXRA 4IGAA 3ESCA 4D2IA 2RKWA 1KO5A 3DM5A 5K3DA 3V6MA 4FYHA 2ECQA 2LE0A 1TK9A 4CODB 1N5OX 4YV1A 1ZI6A 2D0IA 4G0XA 1LRLA 1R0ZA 3MCZA 1E6LA 2ZYHA 3VAZA 5EJ5A 2VYVA 4A26A 1H8EA 4KIWA 5ALSA 1TUIA 1DFIA 1ZRHA 5KPJA 1YFZA 2O06A 1E96A 3WL7A 1DXOA 6AT1A 3QWIA 4ED9A 2XX3A 4MI9A 2JGRA 1VJCA 3AW9A 4RTLA 5HKKA 2ZT8A 2VQFB 1RZRA 3ICCA 3C24A 4O4IB 2FXVA 2RGXA 4HGZA 4RPIA 2LRHA 3BTVA 3IP9A 4DWJA 2M32A 4FDVA 3OAAA 3WDMA 4W4TA 2R5NA 3MC1A 1GD1O 2C0CA 3E9DA 1OFIA 2IVFA 2R85A 4ZMSA 3G6KA 4YJGB 3WFJA 3WWCA 3U4IA 3TGLA 2W8BB 1NQWA 2CL7X 2FEAA 1WLYA 2CCJA 2WTXA 2Y9PB 3GNQA 3NHZA 3QUSA 1LLFA 4P0PB 5CP8A 1S4MA 2YWGA 4GH5A 4K9OA 1IONA 5FKJA 1NOJA 4CLRA 4FTWA 2PMCA 3V46A 1QVAA 4GLLA 3F3KA 4OU5A 2V74B 1X14A 4LBZA 4A2QA 4L5JA 4C6TB 1PYGA 4WRRA 5DNEA 3GF4A 3U60B 1RFLA 2XXAB 3BRSA 2EWWA 2Q0XA 4B73A 2QV7A 2HDNB 1SOVA 1HE5A 5TJHA 2G1JA 4AQ7A 3N39C 1TQ8A 4DM3A 1E89A 5SY6A 2J7PA 1D2GA 4FMCF 4R8RA 2G70A 1CJMA 2W2KB 2WOOA 2ZETA 4KX5A 5J2UA 2J41A 1SXJB 4WWHA 2AX4A 3D5QA 1DWUA 3JVUA 1EZ1A 5FI3A 3ROFA 2VTBA 1WMSA 2W6PA 3CIFA 1N8SA 4RV9A 1UXJA 5CBPB 2WE8A 2YVLA 2O2EA 4KO3S 2XTMA 3QEMB 1YCDA 1TVKB 5KYNA 1QYRA 2QMHA 2RGDA 5AI6A 3I6MA 1FMJA 2CSUA 3JASB 3KSMA 3CEMA 2KJQA 4G0MA 5I47A 3PQEA 3QOYA 4C4TA 5EXSA 3IKVA 1G63A 2VHVA 4FZ3A 1P1JA 4AP5A 1QK5A 1XRNA 1MVOA 5AK0A 3SXUB 4S24A 1KVTA 1NQ5A 2VJOA 3UNXA 2FMIA 2VR1A 1ZCFA 2C03A 1JG7A 2H5JA 2BR5A 4JQCA 5TNXA 4DFDA 4QXOA 3E9CA 4RUKA 5CU7A 1ND5A 1UOPA 1T3LA 3V00A 4MQ5A 5LMZA 1G20E 1ZGJA 4RXMA 4WNIA 2EX0A 1BE0A 5DV9A 1OAAA 2GJAA 1E79A 4G4IA 4MA4A 4UHEA 1U3WA 5HE8A 1NOIA 1MAWA 2HSGA 2OMKA 3DC2A 3B1YA 4BGVA 4CVNA 5EAIA 4P2GA 2ZRAA 1J42A 3D2AA 1JBKA 1JLHA 1ESDA 4I08A 4LY9A 4ZCLA 5H83A 4LC9A 3A9UA 4KN8A 4RCVA 3L7JA 3HH8A 1F8FA 2A0YA 1LI5A 5E2BA 2K5UA 5AW9A 2OV3A 4KFCA 1YZTA 3FY4A 1RC1A 3IBSA 3P32A 1E2BA 3LXMA 1O6BA 1MQSA 1RLIA 1PS9A 1QDUA 2EOAA 3F6YA 4HQ0A 1TZKA 2Q9AA 4P38A 3TF5A 3J7TA 4D44A 1F1BA 1PKEA 3HKDA 3HU2A 4KIGA 5K2MA 3HVJA 4IP0A 1O94C 3U3ZA 4ENSA 4ROSA 1VPTA 3VOTA 2VSQA 4FOTA 3KALA 1Z39A 3LBYA 4WBSA 5GM2A 4NFSA 3DWFA 3T5TA 4CT4B 4E1AA 4WUVA 1WMFA 3IH5A 4F3KA 1UKBA 4IH4A 1ZM4A 4ZVLA 3NDRA 2FWPA 5DCLA 4XIJA 2OGTA 4D3XA 2GM9A 1N6PA 5KOJB 2ZZNA 2WSLA 2WWWA 1UT8A 2FR8C 4P83A 1GRRA 1SKYE 3ED1A 4F4FA 1X0VA 3OM1A 1NFRA 4QUGA 5TPZD 3B1ZA 1JW9B 2QTVA 2J0UA 3C7KA 1C1DA 3M3PA 3NBAA 1M2EA 1X1CA 1G4AE 3O4VA 5TMDA 1T91A 4YRSA 1VI6A 5A03A 3FYDA 4PX2A 1EMDA 2BM9A 4RH0A 3O3NB 3MOIA 4MGKR 4EH1A 1OWMA 4BN4A 1E7SA 4EF5A 3EG5A 1QYXA 1Y6QA 3F9RA 2BL4A 2EIXA 2OCDA 2IXAA 2D59A 4A10A 1UQTA 3REQB 1VECA 1J6UA 3AEZA 3BXPA 1MOZA 2NXCA 2AGVA 1JFFA 5FWYA 1NI3A 4ZYTA 3NIFB 2HHAA 2YMLA 3Q3JB 1GGKA 1CQWA 4R3NA 2CCKA 1T6NA 2WTMA 4L8GA 5ALRA 3MYYA 3TNFA 3PNLA 4IXNA 4G1MB 4NYIQ 4TMVA 4TL6A 4W1QA 4MYDA 2G6TA 4JBWA 2CNBA 4GPZA 1B14A 1YDEA 3AG5A 1FA9A 3FI0A 3MBIA 2E7ZA 1YFLA 1LDBA 3T3OA 1RJDA 3A9CA 3AVUA 1D1QA 5L53A 2WD9A 1QB7A 2FSVA 3DZFA 3T7KA 4Z1OA 1YMVA 2ZB7A 4KLZA 2NU8B 4D4IA 3SC6A 4WLVA 1VBNA 1Q12A 5I7OA 1DEAA 2F00A 3RUIA 4DBLE 1B3RA 4R1TA 2QSYA 1N77A 1K1EA 3NHYA 3AF0A 3OKPA 3ZNQA 4MYRA 3IQGX 2HADA 2QBYB 5KS2A 2J6IA 3A4YA 3CZRA 4Q16A 1V96A 3EUAA 1P72A 3SJ7A 2RHGB 1KZ1A 1OLUB 2V8OA 1PFGA 3NOXA 4CL2A 1M1XB 2LKCA 4HFRA 1FQKA 2I03A 2J46A 3AR7A 2GPTA 3SS8A 4Z3OA 2VXOA 3RYTC 1ZWKA 5KJFA 2Q5LA 4LG1A 1ZK0A 4FGZA 1EHIA 1KI4A 1QNFA 2J07A 4NG4A 2F1KA 2J45A 3BE5A 4FFPA 2IOQA 1JPNA 1SVOA 3TUIC 4EPRA 4RLQA 3LWBA 1DBSA 2BMWA 4IWXA 4Y9UA 1MXHA 3F7TA 4JEIA 4BMOB 5IMSA 3ONDA 4K9KA 2ZUTA 2DY1A 3PQFA 4BX3A 4PAWA 4JP2A 1PUJA 1EP1B 1T10A 1AKQA 1TC1A 3SLRA 1ND6A 1UPTA 4ND8A 3T35A 5IJ9B 2DFLA 3NT4A 3PDJA 2O59A 2CXNA 3GROA 5AM1A 1CEEA 5IKOA 1CRPA 1QGZA 2F90A 2UUAB 1ECCA 4HQOA 1OXVA 1RYYA 3BERA 2BFDA 4KSCA 1Z5OA 4GM4A 5CYFA 3WE7A 4EG3A 4TTIA 2BZSA 2CHEA 2DEUA 3MTGA 4RH3A 2OV8A 5HHTA 1OC2A 1YS2X 5B3AA 4CM8B 3ZJUA 1TX4B 5G4LA 4D3YA 4DCGA 2C82A 4AWXA 1CZ5A 2IYEA 3HXPA 3OP1A 2G5GX 4IBOA 1T36B 1BCSB 1H8ED 1QC5B 2BBTA 4IZ6A 3ZDEA 3ZDCA 3SSNA 1J22A 4BMXA 3AR9A 1WCIA 2IV2X 5HA5A 2EKLA 1W44A 1Y3DE 1J8MF 1GQSA 3Q40A 1K3FA 2QM0A 3BOSA 3VOBA 3NOOA 1CJBA 4RE6A 3WNZA 2PD3A 5HTOA 1IYZA 3BFJA 3TW0A 1KYXA 1ZW1A 3MCVA 4BNUA 2WPNA 2EKDA 3G1WA 4G56A 4NU5A 3ZWWA 1VI2A 4FDAA 3Q6NA 4GOMD 5BSVA 5EMJA 3ACBA 4U0KA 3F67A 4TV9F 3OIGA 1ST3A 4IXWA 4XX0B 3HJNA 4LYJA 5SZKB 1FF9A 1SRRA 2BCGY 4RF5A 4W9NA 5DCYA 4Q0MA 4F04A 3CE9A 2ZIUB 3ESXA 3MXOA 4ZOQI 2DT8A 3AHGA 1HYBA 3FAKA 5ALDA 4DMFA 2AFHA 1Z6YA 4NKRA 2CMKA 1AUQA 2GJKA 3H75A 2VHUA 4DLKA 3FTNA 3E1SA 3GPBA 4M8KA 4AJNA 4MWCA 1DC3A 3T5PA 4MUGA 5TQ2B 1QFSA 1MU0A 1Z0AA 3OTGA 3R5SA 4PLPA 3PFCA 2EV9A 2ZR0A 2E3JA 4NYMR 4NNJA 3OJWA 4NC9A 3UWSA 4DA7A 4QT4A 3RG2A 1KOGA 1T5BA 4XWAA 1LZLA 2DXIA 2O14A 2ZAMA 3GCDA 1YKFA 2FB9A 2JBHA 4LDZA 2ZM6B 3DBVO 2G3YA 1C4OA 1IY2A 1E63A 2PLNA 4KQJA 3ZTTA 4IH1A 3V32A 3UCFA 4BWVA 2X0KA 4Y6OA 3EK2A 4OXIA 4NOJA 3UUGA 1IOVA 6ADHA 1Q7EA 4S1VA 1MQAA 2GN1A 3MD9A 2A3RA 4J1NA 3ND8A 3OPMA 2OBLA 3JQPA 2ID9A 2IS4A 1D6NA 4OI1A 3G5UA 2H2WA 2XF2A 3R7AA 5SICE 1B8VA 4CMIB 1K06A 5LP6F 2G40A 2QV0A 3EBOA 2N1BA 1YK1A 3IHKA 4YASA 3DEHA 4GX2A 4NV0A 2HRDA 4DSAA 1QZ3A 3RC7A 1V7PC 3I45A 3TXYA 4C89A 4G1CA 1AKMA 1DMSA 3KSZO 4RZUA 1KVRA 4HQFA 1U2GC 3TLAA 3KWJA 3RIGA 1GL6A 1HBJA 1MB2A 2PMFA 1GNLA 1PAUA 3BL8A 4LYDA 4QEDA 1NXTA 3ZE6A 2D8MA 1YB1A 2QI9F 2VF5X 3C4VA 1TI7A 5AIBA 1JXOA 3R5FA 3BEOA 2PLRA 3GBPA 2ZI6A 3RAFC 2PIAA 2IITA 3ZY6A 1PGJA 1U90A 3GLKA 1QHYA 2ZUWA 2ONJA 1ZH8A 1D6JA 2H08A 3O82A 4B4KA 5LP6B 1PBTA 1SUDA 4RIEA 1N2CB 2QZZA 1VE7A 4IXTA 4N8EA 4XX1A 4DLLA 1OXTA 3VDQA 3QEMA 4O8ZA 5EUCA 5FH9A 1CYDA 1ZU5A 1EUCB 2REQB 2ZJ6A 5A4IS 2ZXUA 1SXQA 1O97D 1QCCA 1VPVA 1XP5A 3DH0A 4G8DA 2MJLA 2NO5A 1NQXA 3FZGA 4X00A 3NQ41 3NRJA 4LXHA 4YCLA 1PSWA 5FIUA 1CJKC 1T2NA 4DDVA 4CTMA 4CUZA 2GLTA 4Z7NB 4ZGBA 1Q7TA 2YZKA 2JCGA 2PCLA 3N8GA 4PTLA 4XDGA 2C2GA 4FEEA 1J0CA 1A5SB 2Y1XA 4L1KA 5J63A 4B32A 1N2SA 1NAIA 2NPOA 3HCAA 2HA7A 4CT0A 5IXJA 2ZB4A 1DAGA 10MHA 2Y4OA 4AP6A 2BFCB 2Q50A 5E6SB 2B98A 3FGNA 2VT6A 1SUFA 2XD4A 4KE8A 1Q6ZA 3MUEA 5ERGB 4LSWA 4RS3A 3ROKA 4Z9FA 2YS6A 3ZXUB 5AUPB 2F1JA