1QDNA

Amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
201
structure length
189
Chain Sequence
MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (N-ETHYLMALEIMIDE SENSITIVE FUSION PROTEIN (NSF))
publication title Crystal structure of the amino-terminal domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Fusion protein
total genus 45
structure length 189
sequence length 201
chains with identical sequence B, C
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qdnA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qdnA02
2WB1A 2JA7A 3QC8A 1G8KA 2JA5A 3CF2A 3IR6A 3OUGA 1QDNA 2JV2A 1PT1A 2YU9A 4CRYG 1SFOA 4AYBA 1CZ4A 1OGYA 2R93A 2JIRA 3GTLA 2VPXA 1R27A 4KODA 1CR5A 1FDOA 1PPYA 3QQ8A 1QCSA 2JA6A 1PQHA 2VPWA 1DMRA 4RV0A 4DMRA 5C18A 1UHEA 4AZDA 1G8JA 5B6CA 2V45A 1E61A 2Y0SA 1H0HA 5FTLA 1KQFA 4QIWA 2C45A 5FTKA 3IR5A 3GTKA 1Y1VA 2DMRA 2WAQA 1YLEA 1TMOA 3QWZA 2IV2X 5C1BA 2KI8A 3GTGA 1TWGA 2PMZA 1Y4ZA 1R9TA 3QQ7A 4AOKB 3HU3A 1PYQA 1TWFA 2NYAA 4KO8A 3PLXB 1KQGA 2JIOA 4AAYA 1R7RA 1WLFA 1PQFA 4GA5A 2EEOB 3GTJA 1Y1WA 3CQZA 2E7ZA 3HU2A 1Y5IA 1AW8B 2VUMA 3HU1A 1FDIA 1TWAA 5FTNA 5T5MD 3ML1A 1H5NA 2NVXA 3HKZA 2VPZA 1WCMA 3TIWA 1TWCA 1I3QA 1E32A 1SIWA 2JIQA 4AONB 2E2HA 1E18A 2V3VA 3GTOA 4CRZA 1VC3B 1TWHA 1AA6A 2NAPA 5T5ID 1DMSA 2VPYA 1IW7D 3FKIA 1Q16A 3O5AA 4KDLA 3TM7B 2B63A 3GTMA 2NVYA 3GTQA 1CZ5A 3H0GA 5EPPA 1E60A 1S3SA 2JIMA 4C2MA 3DMRA 1E5VA 5DYIA 5FTJA 3GTPA 1PYUB 1I50A 1ZC1A 4KDIA 5DYGA 1PT0A 2PJHB 2R7ZA 4CS0A 2JIPA 1K83A 1UHDA 3IR7A 5GLFA 2YUJA 4D7ZB 2E2IA 1EU1A 1PQEA 2R92A 5FTMA 4GA6A 4KLNA
chains in the Genus database with same CATH superfamily
2WB1A 3ZJUA 4AS1A 2JA7A 3M3GA 3QC8A 1G8KA 2GAEA 2JA5A 4FFTA 3CF2A 3IR6A 3X2GA 3OUGA 1QDNA 3X2PA 2JV2A 2BH0A 1PT1A 2YU9A 2PI8A 4CRYG 1SFOA 4AYBA 1CZ4A 1OGYA 2R93A 2GF7A 3FPTA 2JIRA 3GTLA 2VPXA 1R27A 4ZM7A 3BQBA 4KODA 1CR5A 1FDOA 2Q18X 4JP6A 3SUKA 1PPYA 3LGAA 3QQ8A 1QCSA 2JA6A 2ENGA 1ZYRD 1PQHA 2VPWA 1DMRA 3CZBA 4RV0A 4DMRA 4NOHA 5C18A 1BW4A 1UHEA 3X2IA 1G8JA 4AZDA 5B6CA 4ARCA 2V45A 3X2OA 2O5JD 1E61A 2Y0SA 4AVRA 1H0HA 5FTLA 3FPRA 1KQFA 1BW3A 4QIWA 2A68D 2C45A 2KQAA 3X2MA 5FTKA 3IR5A 2PJJA 3GTKA 1Y1VA 2DMRA 1N10A 1YLEA 2WAQA 2Q1CX 1O54A 1HD5A 2PWYA 2Q1DX 1YNND 3MB5A 1TMOA 3QWZA 2IV2X 5C1BA 2KI8A 2YVLA 4JCWA 2A6ED 3GTGA 1TWGA 2PMZA 1Y4ZA 1R9TA 3QQ7A 4AOKB 3HU3A 1PYQA 1TWFA 2LW6A 2NYAA 4KO8A 4CQNA 4UC4A 3PLXB 1KQGA 2JIOA 4AAYA 3ZJTA 1R7RA 1WLFA 1OA9A 2PICA 2PNWA 1PQFA 3D30A 3SULA 5D6YA 3X2KA 4GA5A 2EEOB 4FERA 3X2LA 3GTJA 1Y1WA 5CCBA 4JP7A 3CQZA 2E7ZA 3HU2A 3ZJVA 1Y5IA 2G5DA 1AW8B 1OA7A 2Q19X 2VUMA 4ARIA 3HU1A 1FDIA 1TWAA 5FTNA 5T5MD 2MM0A 2QQSA 3ML1A 4JS7A 1H5NA 2NVXA 1L8FA 3ZGZA 3HKZA 3LHDA 2Q1AX 2VPZA 1WCMA 2KY9A 3TIWA 1TWCA 1I3QA 1E32A 1SIWA 2JIQA 4AONB 5GM9A 2E2HA 1E18A 1SMYD 3FPUA 2A6HD 2V3VA 3GTOA 1YNJD 1I9GA 5CCXA 4CRZA 1VC3B 2G6GA 1TWHA 5H4UA 1AA6A 5EQJB 2NAPA 5T5ID 5ERGB 1DMSA 2QQRA 2VPYA 3ENGA 1IW7D 3SUMA 3FKIA 1Q16A 3O5AA 4KDLA 3TM7B 2B63A 3GTMA 2NVYA 3GTQA 1CZ5A 2XDPA 2BE5D 3H0GA 5GLYA 5EPPA 4FIBA 1E60A 1S3SA 2JIMA 4C2MA 3DMRA 5CD1A 4AQ7A 1E5VA 2CW0D 5DYIA 5FTJA 3GTPA 3X2JA 5D6XA 1PYUB 1I50A 5D6WA 3X2HA 1ZC1A 1WC2A 2AE0X 4JJOA 4KDIA 5DYGA 1PT0A 2PJHB 5GLXA 2GFAA 4FG4A 3X2NA 2R7ZA 2B25A 4CS0A 2JIPA 4FG2A 1K83A 2MM2A 1UHDA 3IR7A 5GLFA 2YUJA 2A69D 4ENGA 3SUJA 4D7ZB 2HCZX 2E2IA 1EU1A 4L48A 1PQEA 2R92A 5FTMA 4GA6A 4KLNA
chains in the Genus database with same CATH topology
2WB1A 3ZJUA 4AS1A 2JA7A 3QC8A 1G8KA 2GAEA 2JA5A 3CF2A 3IR6A 3OUGA 1QDNA 2JV2A 1PT1A 2YU9A 2PI8A 4CRYG 1SFOA 4AYBA 1CZ4A 1OGYA 2R93A 2GF7A 3FPTA 2JIRA 3GTLA 2VPXA 1R27A 3BQBA 4KODA 1CR5A 1FDOA 2Q18X 5D6YA 3LGAA 1PPYA 3QQ8A 1QCSA 2JA6A 1ZYRD 1PQHA 2VPWA 1DMRA 3CZBA 4RV0A 4DMRA 4NOHA 5C18A 1UHEA 4AZDA 1G8JA 5B6CA 4ARCA 2V45A 2O5JD 1E61A 2Y0SA 1H0HA 5FTLA 3FPRA 1KQFA 4QIWA 2A68D 2C45A 5FTKA 3IR5A 2PJJA 3GTKA 1Y1VA 2DMRA 2WAQA 1YLEA 2Q1CX 1O54A 3MB5A 2PWYA 2Q1DX 1YNND 1TMOA 3QWZA 2IV2X 5C1BA 2KI8A 2YVLA 2A6ED 3GTGA 1TWGA 2PMZA 1Y4ZA 1R9TA 3QQ7A 4AOKB 3HU3A 1PYQA 1TWFA 2LW6A 2NYAA 4KO8A 4CQNA 4UC4A 3PLXB 1KQGA 2JIOA 4AAYA 3ZJTA 1R7RA 1WLFA 2PICA 2PNWA 1PQFA 4GA5A 2EEOB 3GTJA 1Y1WA 5CCBA 3CQZA 2E7ZA 3HU2A 3ZJVA 1Y5IA 2G5DA 1AW8B 2Q19X 2VUMA 4ARIA 3HU1A 1FDIA 1TWAA 5FTNA 5T5MD 2MM0A 2QQSA 3ML1A 1H5NA 2NVXA 3ZGZA 3HKZA 3LHDA 2Q1AX 2VPZA 1WCMA 2KY9A 3TIWA 1TWCA 1I3QA 1E32A 1SIWA 2JIQA 4AONB 2E2HA 1E18A 1SMYD 3FPUA 2A6HD 2V3VA 3GTOA 1YNJD 1I9GA 5CCXA 4CRZA 1VC3B 2G6GA 1TWHA 1AA6A 5EQJB 2NAPA 5T5ID 5ERGB 1DMSA 2QQRA 2VPYA 1IW7D 3FKIA 1Q16A 3O5AA 4KDLA 3TM7B 2B63A 3GTMA 2NVYA 3GTQA 1CZ5A 2XDPA 2BE5D 3H0GA 5EPPA 4FIBA 1E60A 1S3SA 2JIMA 4C2MA 3DMRA 5CD1A 4AQ7A 1E5VA 2CW0D 5DYIA 5FTJA 3GTPA 5D6XA 5D6WA 1PYUB 1I50A 1ZC1A 2AE0X 4KDIA 5DYGA 1PT0A 2PJHB 2GFAA 2R7ZA 2B25A 4CS0A 2JIPA 1K83A 2MM2A 1UHDA 3IR7A 5GLFA 2YUJA 2A69D 4D7ZB 2E2IA 1EU1A 1PQEA 2R92A 5FTMA 4GA6A 4KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 A;  2JA7 A;  3QC8 A;  1G8K A;  2JA5 A;  3CF2 A;  3IR6 A;  3OUG A;  1QDN A;  2JV2 A;  1PT1 A;  2YU9 A;  4CRY G;  1SFO A;  4AYB A;  1CZ4 A;  1OGY A;  2R93 A;  2JIR A;  3GTL A;  2VPX A;  1R27 A;  4KOD A;  1CR5 A;  1FDO A;  1PPY A;  3QQ8 A;  1QCS A;  2JA6 A;  1PQH A;  2VPW A;  1DMR A;  4RV0 A;  4DMR A;  5C18 A;  1UHE A;  4AZD A;  1G8J A;  5B6C A;  2V45 A;  1E61 A;  2Y0S A;  1H0H A;  5FTL A;  1KQF A;  4QIW A;  2C45 A;  5FTK A;  3IR5 A;  3GTK A;  1Y1V A;  2DMR A;  2WAQ A;  1YLE A;  1TMO A;  3QWZ A;  2IV2 X;  5C1B A;  2KI8 A;  3GTG A;  1TWG A;  2PMZ A;  1Y4Z A;  1R9T A;  3QQ7 A;  4AOK B;  3HU3 A;  1PYQ A;  1TWF A;  2NYA A;  4KO8 A;  3PLX B;  1KQG A;  2JIO A;  4AAY A;  1R7R A;  1WLF A;  1PQF A;  4GA5 A;  2EEO B;  3GTJ A;  1Y1W A;  3CQZ A;  2E7Z A;  3HU2 A;  1Y5I A;  1AW8 B;  2VUM A;  3HU1 A;  1FDI A;  1TWA A;  5FTN A;  5T5M D;  3ML1 A;  1H5N A;  2NVX A;  3HKZ A;  2VPZ A;  1WCM A;  3TIW A;  1TWC A;  1I3Q A;  1E32 A;  1SIW A;  2JIQ A;  4AON B;  2E2H A;  1E18 A;  2V3V A;  3GTO A;  4CRZ A;  1VC3 B;  1TWH A;  1AA6 A;  2NAP A;  5T5I D;  1DMS A;  2VPY A;  1IW7 D;  3FKI A;  1Q16 A;  3O5A A;  4KDL A;  3TM7 B;  2B63 A;  3GTM A;  2NVY A;  3GTQ A;  1CZ5 A;  3H0G A;  5EPP A;  1E60 A;  1S3S A;  2JIM A;  4C2M A;  3DMR A;  1E5V A;  5DYI A;  5FTJ A;  3GTP A;  1PYU B;  1I50 A;  1ZC1 A;  4KDI A;  5DYG A;  1PT0 A;  2PJH B;  2R7Z A;  4CS0 A;  2JIP A;  1K83 A;  1UHD A;  3IR7 A;  5GLF A;  2YUJ A;  4D7Z B;  2E2I A;  1EU1 A;  1PQE A;  2R92 A;  5FTM A;  4GA6 A;  4KLN A; 
#chains in the Genus database with same CATH topology
 2WB1 A;  3ZJU A;  4AS1 A;  2JA7 A;  3M3G A;  3QC8 A;  1G8K A;  2GAE A;  2JA5 A;  4FFT A;  3CF2 A;  3IR6 A;  3X2G A;  3OUG A;  1QDN A;  3X2P A;  2JV2 A;  2BH0 A;  1PT1 A;  2YU9 A;  2PI8 A;  4CRY G;  1SFO A;  4AYB A;  1CZ4 A;  1OGY A;  2R93 A;  2GF7 A;  3FPT A;  2JIR A;  3GTL A;  2VPX A;  1R27 A;  4ZM7 A;  3BQB A;  4KOD A;  1CR5 A;  1FDO A;  2Q18 X;  4JP6 A;  3SUK A;  1PPY A;  3LGA A;  3QQ8 A;  1QCS A;  2JA6 A;  2ENG A;  1ZYR D;  1PQH A;  2VPW A;  1DMR A;  3CZB A;  4RV0 A;  4DMR A;  4NOH A;  5C18 A;  1BW4 A;  1UHE A;  3X2I A;  1G8J A;  4AZD A;  5B6C A;  4ARC A;  2V45 A;  3X2O A;  2O5J D;  1E61 A;  2Y0S A;  4AVR A;  1H0H A;  5FTL A;  3FPR A;  1KQF A;  1BW3 A;  4QIW A;  2A68 D;  2C45 A;  2KQA A;  3X2M A;  5FTK A;  3IR5 A;  2PJJ A;  3GTK A;  1Y1V A;  2DMR A;  1N10 A;  1YLE A;  2WAQ A;  2Q1C X;  1O54 A;  1HD5 A;  2PWY A;  2Q1D X;  1YNN D;  3MB5 A;  1TMO A;  3QWZ A;  2IV2 X;  5C1B A;  2KI8 A;  2YVL A;  4JCW A;  2A6E D;  3GTG A;  1TWG A;  2PMZ A;  1Y4Z A;  1R9T A;  3QQ7 A;  4AOK B;  3HU3 A;  1PYQ A;  1TWF A;  2LW6 A;  2NYA A;  4KO8 A;  4CQN A;  4UC4 A;  3PLX B;  1KQG A;  2JIO A;  4AAY A;  3ZJT A;  1R7R A;  1WLF A;  1OA9 A;  2PIC A;  2PNW A;  1PQF A;  3D30 A;  3SUL A;  5D6Y A;  3X2K A;  4GA5 A;  2EEO B;  4FER A;  3X2L A;  3GTJ A;  1Y1W A;  5CCB A;  4JP7 A;  3CQZ A;  2E7Z A;  3HU2 A;  3ZJV A;  1Y5I A;  2G5D A;  1AW8 B;  1OA7 A;  2Q19 X;  2VUM A;  4ARI A;  3HU1 A;  1FDI A;  1TWA A;  5FTN A;  5T5M D;  2MM0 A;  2QQS A;  3ML1 A;  4JS7 A;  1H5N A;  2NVX A;  1L8F A;  3ZGZ A;  3HKZ A;  3LHD A;  2Q1A X;  2VPZ A;  1WCM A;  2KY9 A;  3TIW A;  1TWC A;  1I3Q A;  1E32 A;  1SIW A;  2JIQ A;  4AON B;  5GM9 A;  2E2H A;  1E18 A;  1SMY D;  3FPU A;  2A6H D;  2V3V A;  3GTO A;  1YNJ D;  1I9G A;  5CCX A;  4CRZ A;  1VC3 B;  2G6G A;  1TWH A;  5H4U A;  1AA6 A;  5EQJ B;  2NAP A;  5T5I D;  5ERG B;  1DMS A;  2QQR A;  2VPY A;  3ENG A;  1IW7 D;  3SUM A;  3FKI A;  1Q16 A;  3O5A A;  4KDL A;  3TM7 B;  2B63 A;  3GTM A;  2NVY A;  3GTQ A;  1CZ5 A;  2XDP A;  2BE5 D;  3H0G A;  5GLY A;  5EPP A;  4FIB A;  1E60 A;  1S3S A;  2JIM A;  4C2M A;  3DMR A;  5CD1 A;  4AQ7 A;  1E5V A;  2CW0 D;  5DYI A;  5FTJ A;  3GTP A;  3X2J A;  5D6X A;  1PYU B;  1I50 A;  5D6W A;  3X2H A;  1ZC1 A;  1WC2 A;  2AE0 X;  4JJO A;  4KDI A;  5DYG A;  1PT0 A;  2PJH B;  5GLX A;  2GFA A;  4FG4 A;  3X2N A;  2R7Z A;  2B25 A;  4CS0 A;  2JIP A;  4FG2 A;  1K83 A;  2MM2 A;  1UHD A;  3IR7 A;  5GLF A;  2YUJ A;  2A69 D;  4ENG A;  3SUJ A;  4D7Z B;  2HCZ X;  2E2I A;  1EU1 A;  4L48 A;  1PQE A;  2R92 A;  5FTM A;  4GA6 A;  4KLN A; 
#chains in the Genus database with same CATH homology
 2WB1 A;  3ZJU A;  4AS1 A;  2JA7 A;  3QC8 A;  1G8K A;  2GAE A;  2JA5 A;  3CF2 A;  3IR6 A;  3OUG A;  1QDN A;  2JV2 A;  1PT1 A;  2YU9 A;  2PI8 A;  4CRY G;  1SFO A;  4AYB A;  1CZ4 A;  1OGY A;  2R93 A;  2GF7 A;  3FPT A;  2JIR A;  3GTL A;  2VPX A;  1R27 A;  3BQB A;  4KOD A;  1CR5 A;  1FDO A;  2Q18 X;  5D6Y A;  3LGA A;  1PPY A;  3QQ8 A;  1QCS A;  2JA6 A;  1ZYR D;  1PQH A;  2VPW A;  1DMR A;  3CZB A;  4RV0 A;  4DMR A;  4NOH A;  5C18 A;  1UHE A;  4AZD A;  1G8J A;  5B6C A;  4ARC A;  2V45 A;  2O5J D;  1E61 A;  2Y0S A;  1H0H A;  5FTL A;  3FPR A;  1KQF A;  4QIW A;  2A68 D;  2C45 A;  5FTK A;  3IR5 A;  2PJJ A;  3GTK A;  1Y1V A;  2DMR A;  2WAQ A;  1YLE A;  2Q1C X;  1O54 A;  3MB5 A;  2PWY A;  2Q1D X;  1YNN D;  1TMO A;  3QWZ A;  2IV2 X;  5C1B A;  2KI8 A;  2YVL A;  2A6E D;  3GTG A;  1TWG A;  2PMZ A;  1Y4Z A;  1R9T A;  3QQ7 A;  4AOK B;  3HU3 A;  1PYQ A;  1TWF A;  2LW6 A;  2NYA A;  4KO8 A;  4CQN A;  4UC4 A;  3PLX B;  1KQG A;  2JIO A;  4AAY A;  3ZJT A;  1R7R A;  1WLF A;  2PIC A;  2PNW A;  1PQF A;  4GA5 A;  2EEO B;  3GTJ A;  1Y1W A;  5CCB A;  3CQZ A;  2E7Z A;  3HU2 A;  3ZJV A;  1Y5I A;  2G5D A;  1AW8 B;  2Q19 X;  2VUM A;  4ARI A;  3HU1 A;  1FDI A;  1TWA A;  5FTN A;  5T5M D;  2MM0 A;  2QQS A;  3ML1 A;  1H5N A;  2NVX A;  3ZGZ A;  3HKZ A;  3LHD A;  2Q1A X;  2VPZ A;  1WCM A;  2KY9 A;  3TIW A;  1TWC A;  1I3Q A;  1E32 A;  1SIW A;  2JIQ A;  4AON B;  2E2H A;  1E18 A;  1SMY D;  3FPU A;  2A6H D;  2V3V A;  3GTO A;  1YNJ D;  1I9G A;  5CCX A;  4CRZ A;  1VC3 B;  2G6G A;  1TWH A;  1AA6 A;  5EQJ B;  2NAP A;  5T5I D;  5ERG B;  1DMS A;  2QQR A;  2VPY A;  1IW7 D;  3FKI A;  1Q16 A;  3O5A A;  4KDL A;  3TM7 B;  2B63 A;  3GTM A;  2NVY A;  3GTQ A;  1CZ5 A;  2XDP A;  2BE5 D;  3H0G A;  5EPP A;  4FIB A;  1E60 A;  1S3S A;  2JIM A;  4C2M A;  3DMR A;  5CD1 A;  4AQ7 A;  1E5V A;  2CW0 D;  5DYI A;  5FTJ A;  3GTP A;  5D6X A;  5D6W A;  1PYU B;  1I50 A;  1ZC1 A;  2AE0 X;  4KDI A;  5DYG A;  1PT0 A;  2PJH B;  2GFA A;  2R7Z A;  2B25 A;  4CS0 A;  2JIP A;  1K83 A;  2MM2 A;  1UHD A;  3IR7 A;  5GLF A;  2YUJ A;  2A69 D;  4D7Z B;  2E2I A;  1EU1 A;  1PQE A;  2R92 A;  5FTM A;  4GA6 A;  4KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...