1QDNA

Amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
201
structure length
189
Chain Sequence
MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the amino-terminal domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Fusion protein
molecule keywords PROTEIN (N-ETHYLMALEIMIDE SENSITIVE FUSION PROTEIN (NSF))
total genus 45
structure length 189
sequence length 201
chains with identical sequence B, C
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qdnA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qdnA02
5DYIA 1IW7D 1PQEA 3GTPA 3GTLA 2E2IA 4AOKB 2WB1A 4KDLA 4RV0A 5T5ID 3HU1A 4KO8A 2JA7A 2NVYA 2PJHB 3H0GA 5FTMA 1PYQA 1Y4ZA 1PT1A 2R93A 2VPYA 2JIOA 2IV2X 2NYAA 4CRYG 2E7ZA 2VUMA 2KI8A 1H5NA 1CR5A 1AW8B 1QCSA 3HU3A 4CRZA 3O5AA 2WAQA 3IR5A 3QQ7A 1EU1A 2JIPA 3IR6A 4AAYA 5FTJA 5GLFA 3OUGA 1PQHA 3GTMA 2E2HA 3TIWA 4KLNA 3QQ8A 4AZDA 2VPXA 5DYGA 2VPZA 1TMOA 3GTQA 1WCMA 3QC8A 1Q16A 1PT0A 4DMRA 1Y1WA 1PPYA 1FDOA 3DMRA 1E60A 1R9TA 2JA6A 1AA6A 1H0HA 2YUJA 1TWGA 1TWCA 2DMRA 2R92A 2JIQA 1TWAA 2PMZA 4D7ZB 1UHDA 4GA5A 3GTKA 1E5VA 1QDNA 5FTNA 5T5MD 5B6CA 3TM7B 1CZ5A 3CF2A 2B63A 1KQGA 1Y5IA 2V45A 1VC3B 1R27A 2JIMA 4CS0A 3GTGA 1WLFA 1TWHA 3QWZA 5C1BA 1Y1VA 3CQZA 1E18A 1E61A 4KODA 2VPWA 1ZC1A 1E32A 1YLEA 3FKIA 2NAPA 1R7RA 1SFOA 5EPPA 1KQFA 2YU9A 4AONB 1G8KA 3HKZA 1PQFA 3IR7A 2C45A 5FTLA 3PLXB 1SIWA 2EEOB 3ML1A 5FTKA 1I3QA 2NVXA 1DMRA 4AYBA 1CZ4A 3HU2A 2V3VA 1PYUB 3GTOA 1I50A 2R7ZA 1FDIA 1OGYA 1UHEA 2JIRA 2JA5A 1G8JA 1DMSA 4QIWA 1S3SA 1K83A 5C18A 2Y0SA 1TWFA 2JV2A 4GA6A 4KDIA 3GTJA 4C2MA
chains in the Genus database with same CATH superfamily
2QQSA 5DYIA 1I9GA 1IW7D 1PQEA 2PNWA 3X2IA 4ARCA 3GTPA 3GTLA 2E2IA 4AOKB 2YVLA 2KQAA 2WB1A 4KDLA 4RV0A 5T5ID 3HU1A 3FPRA 3BQBA 4KO8A 2JA7A 3LHDA 2O5JD 2NVYA 2PJHB 3H0GA 1L8FA 5FTMA 1PYQA 1N10A 1Y4ZA 1PT1A 2R93A 2VPYA 2JIOA 2IV2X 2NYAA 4ZM7A 4CRYG 2E7ZA 2VUMA 3ZJVA 2KI8A 1H5NA 5CCBA 1CR5A 1AW8B 1QCSA 3ENGA 3X2HA 1OA7A 3X2GA 3X2LA 3HU3A 4CRZA 3O5AA 2BE5D 3SUJA 2WAQA 3IR5A 3QQ7A 1EU1A 2JIPA 2PJJA 3IR6A 4AAYA 2MM0A 3X2KA 5FTJA 5GLFA 4JP7A 2XDPA 3X2NA 5ERGB 1BW3A 4FFTA 4UC4A 3OUGA 1PQHA 1YNND 2AE0X 3X2MA 3GTMA 5D6WA 4ARIA 2Q19X 3D30A 4L48A 3SUKA 1YNJD 2E2HA 2CW0D 1ZYRD 3TIWA 4KLNA 4JJOA 5GM9A 3QQ8A 3FPTA 2A6HD 4FG4A 3M3GA 4AZDA 2VPXA 3FPUA 3SUMA 5CCXA 4FERA 5DYGA 2VPZA 4ENGA 2A68D 1TMOA 3GTQA 1WCMA 2QQRA 3QC8A 1Q16A 5H4UA 1PT0A 2G5DA 4JCWA 4AVRA 4DMRA 1Y1WA 4CQNA 1PPYA 1FDOA 3DMRA 3CZBA 1E60A 1R9TA 2JA6A 3LGAA 1AA6A 1H0HA 2YUJA 3MB5A 1TWGA 1TWCA 2DMRA 2R92A 3SULA 4AS1A 5EQJB 2JIQA 1TWAA 2PMZA 4D7ZB 1UHDA 4GA5A 3ZGZA 3GTKA 1E5VA 4JP6A 4NOHA 1O54A 1QDNA 5FTNA 5T5MD 5B6CA 3TM7B 1CZ5A 3CF2A 3X2OA 2B63A 2LW6A 1KQGA 2ENGA 1Y5IA 1HD5A 1VC3B 2V45A 2A6ED 1R27A 2JIMA 4CS0A 3GTGA 2Q18X 4AQ7A 1WLFA 1TWHA 3QWZA 5C1BA 5CD1A 1Y1VA 2PI8A 3CQZA 1E18A 1E61A 4KODA 2VPWA 1SMYD 1ZC1A 1E32A 1YLEA 3FKIA 5GLXA 2NAPA 3ZJUA 1R7RA 1SFOA 5EPPA 1KQFA 2YU9A 2KY9A 3ZJTA 2GAEA 4AONB 1G8KA 3HKZA 1PQFA 3IR7A 2C45A 5FTLA 3PLXB 1SIWA 4JS7A 2EEOB 3ML1A 5FTKA 1I3QA 2Q1CX 2BH0A 2NVXA 2Q1DX 1DMRA 4AYBA 1CZ4A 2MM2A 1BW4A 2Q1AX 2HCZX 3HU2A 3X2PA 2B25A 2V3VA 1PYUB 2PWYA 3GTOA 1I50A 2A69D 5D6XA 5GLYA 2R7ZA 1FDIA 1OGYA 1WC2A 1UHEA 2JIRA 2JA5A 5D6YA 1G8JA 2GFAA 1DMSA 4QIWA 2G6GA 1OA9A 2GF7A 1S3SA 1K83A 5C18A 2Y0SA 1TWFA 4FG2A 2JV2A 4GA6A 4KDIA 3GTJA 4C2MA 4FIBA 3X2JA 2PICA
chains in the Genus database with same CATH topology
2QQSA 5DYIA 1I9GA 1IW7D 1PQEA 2PNWA 4ARCA 3GTPA 3GTLA 2E2IA 4AOKB 2YVLA 2WB1A 4KDLA 4RV0A 5T5ID 3FPRA 3HU1A 3BQBA 4KO8A 2JA7A 3LHDA 2O5JD 2NVYA 2PJHB 3H0GA 5FTMA 1PYQA 1Y4ZA 1PT1A 2R93A 2VPYA 2JIOA 2IV2X 2NYAA 3ZJVA 4CRYG 2E7ZA 2VUMA 2KI8A 1H5NA 5CCBA 1CR5A 1AW8B 1QCSA 3HU3A 4CRZA 3O5AA 2BE5D 2WAQA 3IR5A 3QQ7A 1EU1A 2JIPA 2PJJA 3IR6A 4AAYA 2MM0A 5FTJA 5GLFA 2XDPA 5ERGB 4UC4A 3OUGA 1PQHA 1YNND 2AE0X 3GTMA 5D6WA 4ARIA 2Q19X 1YNJD 2E2HA 2CW0D 1ZYRD 3TIWA 4KLNA 3FPTA 3QQ8A 2A6HD 4AZDA 2VPXA 3FPUA 5CCXA 5DYGA 2VPZA 2A68D 1TMOA 3GTQA 1WCMA 2QQRA 3QC8A 1Q16A 1PT0A 2G5DA 4DMRA 1Y1WA 4CQNA 1PPYA 1FDOA 3DMRA 3CZBA 1E60A 1R9TA 2JA6A 3LGAA 1AA6A 1H0HA 2YUJA 3MB5A 1TWGA 1TWCA 2DMRA 2R92A 4AS1A 5EQJB 2JIQA 1TWAA 2PMZA 4D7ZB 1UHDA 4GA5A 3ZGZA 3GTKA 1E5VA 4NOHA 1O54A 1QDNA 5FTNA 5T5MD 5B6CA 3TM7B 1CZ5A 3CF2A 2B63A 2LW6A 1KQGA 1Y5IA 2V45A 1VC3B 2A6ED 1R27A 2JIMA 4CS0A 3GTGA 2Q18X 4AQ7A 1WLFA 1TWHA 3QWZA 5C1BA 5CD1A 1Y1VA 2PI8A 3CQZA 1E18A 1E61A 4KODA 2VPWA 1SMYD 1ZC1A 1E32A 1YLEA 3FKIA 2NAPA 3ZJUA 1R7RA 1SFOA 5EPPA 1KQFA 2YU9A 2KY9A 3ZJTA 2GAEA 4AONB 1G8KA 3HKZA 1PQFA 3IR7A 2C45A 5FTLA 3PLXB 1SIWA 2EEOB 3ML1A 5FTKA 1I3QA 2Q1CX 2Q1DX 2NVXA 1DMRA 4AYBA 1CZ4A 2MM2A 2Q1AX 3HU2A 2B25A 2V3VA 1PYUB 2PWYA 3GTOA 1I50A 2A69D 5D6XA 2R7ZA 1FDIA 1OGYA 1UHEA 2JIRA 2JA5A 5D6YA 1G8JA 2GFAA 1DMSA 4QIWA 2G6GA 2GF7A 1S3SA 1K83A 5C18A 2Y0SA 1TWFA 2JV2A 4GA6A 4KDIA 3GTJA 4C2MA 4FIBA 2PICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYI A;  1IW7 D;  1PQE A;  3GTP A;  3GTL A;  2E2I A;  4AOK B;  2WB1 A;  4KDL A;  4RV0 A;  5T5I D;  3HU1 A;  4KO8 A;  2JA7 A;  2NVY A;  2PJH B;  3H0G A;  5FTM A;  1PYQ A;  1Y4Z A;  1PT1 A;  2R93 A;  2VPY A;  2JIO A;  2IV2 X;  2NYA A;  4CRY G;  2E7Z A;  2VUM A;  2KI8 A;  1H5N A;  1CR5 A;  1AW8 B;  1QCS A;  3HU3 A;  4CRZ A;  3O5A A;  2WAQ A;  3IR5 A;  3QQ7 A;  1EU1 A;  2JIP A;  3IR6 A;  4AAY A;  5FTJ A;  5GLF A;  3OUG A;  1PQH A;  3GTM A;  2E2H A;  3TIW A;  4KLN A;  3QQ8 A;  4AZD A;  2VPX A;  5DYG A;  2VPZ A;  1TMO A;  3GTQ A;  1WCM A;  3QC8 A;  1Q16 A;  1PT0 A;  4DMR A;  1Y1W A;  1PPY A;  1FDO A;  3DMR A;  1E60 A;  1R9T A;  2JA6 A;  1AA6 A;  1H0H A;  2YUJ A;  1TWG A;  1TWC A;  2DMR A;  2R92 A;  2JIQ A;  1TWA A;  2PMZ A;  4D7Z B;  1UHD A;  4GA5 A;  3GTK A;  1E5V A;  1QDN A;  5FTN A;  5T5M D;  5B6C A;  3TM7 B;  1CZ5 A;  3CF2 A;  2B63 A;  1KQG A;  1Y5I A;  2V45 A;  1VC3 B;  1R27 A;  2JIM A;  4CS0 A;  3GTG A;  1WLF A;  1TWH A;  3QWZ A;  5C1B A;  1Y1V A;  3CQZ A;  1E18 A;  1E61 A;  4KOD A;  2VPW A;  1ZC1 A;  1E32 A;  1YLE A;  3FKI A;  2NAP A;  1R7R A;  1SFO A;  5EPP A;  1KQF A;  2YU9 A;  4AON B;  1G8K A;  3HKZ A;  1PQF A;  3IR7 A;  2C45 A;  5FTL A;  3PLX B;  1SIW A;  2EEO B;  3ML1 A;  5FTK A;  1I3Q A;  2NVX A;  1DMR A;  4AYB A;  1CZ4 A;  3HU2 A;  2V3V A;  1PYU B;  3GTO A;  1I50 A;  2R7Z A;  1FDI A;  1OGY A;  1UHE A;  2JIR A;  2JA5 A;  1G8J A;  1DMS A;  4QIW A;  1S3S A;  1K83 A;  5C18 A;  2Y0S A;  1TWF A;  2JV2 A;  4GA6 A;  4KDI A;  3GTJ A;  4C2M A; 
#chains in the Genus database with same CATH topology
 2QQS A;  5DYI A;  1I9G A;  1IW7 D;  1PQE A;  2PNW A;  3X2I A;  4ARC A;  3GTP A;  3GTL A;  2E2I A;  4AOK B;  2YVL A;  2KQA A;  2WB1 A;  4KDL A;  4RV0 A;  5T5I D;  3HU1 A;  3FPR A;  3BQB A;  4KO8 A;  2JA7 A;  3LHD A;  2O5J D;  2NVY A;  2PJH B;  3H0G A;  1L8F A;  5FTM A;  1PYQ A;  1N10 A;  1Y4Z A;  1PT1 A;  2R93 A;  2VPY A;  2JIO A;  2IV2 X;  2NYA A;  4ZM7 A;  4CRY G;  2E7Z A;  2VUM A;  3ZJV A;  2KI8 A;  1H5N A;  5CCB A;  1CR5 A;  1AW8 B;  1QCS A;  3ENG A;  3X2H A;  1OA7 A;  3X2G A;  3X2L A;  3HU3 A;  4CRZ A;  3O5A A;  2BE5 D;  3SUJ A;  2WAQ A;  3IR5 A;  3QQ7 A;  1EU1 A;  2JIP A;  2PJJ A;  3IR6 A;  4AAY A;  2MM0 A;  3X2K A;  5FTJ A;  5GLF A;  4JP7 A;  2XDP A;  3X2N A;  5ERG B;  1BW3 A;  4FFT A;  4UC4 A;  3OUG A;  1PQH A;  1YNN D;  2AE0 X;  3X2M A;  3GTM A;  5D6W A;  4ARI A;  2Q19 X;  3D30 A;  4L48 A;  3SUK A;  1YNJ D;  2E2H A;  2CW0 D;  1ZYR D;  3TIW A;  4KLN A;  4JJO A;  5GM9 A;  3QQ8 A;  3FPT A;  2A6H D;  4FG4 A;  3M3G A;  4AZD A;  2VPX A;  3FPU A;  3SUM A;  5CCX A;  4FER A;  5DYG A;  2VPZ A;  4ENG A;  2A68 D;  1TMO A;  3GTQ A;  1WCM A;  2QQR A;  3QC8 A;  1Q16 A;  5H4U A;  1PT0 A;  2G5D A;  4JCW A;  4AVR A;  4DMR A;  1Y1W A;  4CQN A;  1PPY A;  1FDO A;  3DMR A;  3CZB A;  1E60 A;  1R9T A;  2JA6 A;  3LGA A;  1AA6 A;  1H0H A;  2YUJ A;  3MB5 A;  1TWG A;  1TWC A;  2DMR A;  2R92 A;  3SUL A;  4AS1 A;  5EQJ B;  2JIQ A;  1TWA A;  2PMZ A;  4D7Z B;  1UHD A;  4GA5 A;  3ZGZ A;  3GTK A;  1E5V A;  4JP6 A;  4NOH A;  1O54 A;  1QDN A;  5FTN A;  5T5M D;  5B6C A;  3TM7 B;  1CZ5 A;  3CF2 A;  3X2O A;  2B63 A;  2LW6 A;  1KQG A;  2ENG A;  1Y5I A;  1HD5 A;  1VC3 B;  2V45 A;  2A6E D;  1R27 A;  2JIM A;  4CS0 A;  3GTG A;  2Q18 X;  4AQ7 A;  1WLF A;  1TWH A;  3QWZ A;  5C1B A;  5CD1 A;  1Y1V A;  2PI8 A;  3CQZ A;  1E18 A;  1E61 A;  4KOD A;  2VPW A;  1SMY D;  1ZC1 A;  1E32 A;  1YLE A;  3FKI A;  5GLX A;  2NAP A;  3ZJU A;  1R7R A;  1SFO A;  5EPP A;  1KQF A;  2YU9 A;  2KY9 A;  3ZJT A;  2GAE A;  4AON B;  1G8K A;  3HKZ A;  1PQF A;  3IR7 A;  2C45 A;  5FTL A;  3PLX B;  1SIW A;  4JS7 A;  2EEO B;  3ML1 A;  5FTK A;  1I3Q A;  2Q1C X;  2BH0 A;  2NVX A;  2Q1D X;  1DMR A;  4AYB A;  1CZ4 A;  2MM2 A;  1BW4 A;  2Q1A X;  2HCZ X;  3HU2 A;  3X2P A;  2B25 A;  2V3V A;  1PYU B;  2PWY A;  3GTO A;  1I50 A;  2A69 D;  5D6X A;  5GLY A;  2R7Z A;  1FDI A;  1OGY A;  1WC2 A;  1UHE A;  2JIR A;  2JA5 A;  5D6Y A;  1G8J A;  2GFA A;  1DMS A;  4QIW A;  2G6G A;  1OA9 A;  2GF7 A;  1S3S A;  1K83 A;  5C18 A;  2Y0S A;  1TWF A;  4FG2 A;  2JV2 A;  4GA6 A;  4KDI A;  3GTJ A;  4C2M A;  4FIB A;  3X2J A;  2PIC A; 
#chains in the Genus database with same CATH homology
 2QQS A;  5DYI A;  1I9G A;  1IW7 D;  1PQE A;  2PNW A;  4ARC A;  3GTP A;  3GTL A;  2E2I A;  4AOK B;  2YVL A;  2WB1 A;  4KDL A;  4RV0 A;  5T5I D;  3FPR A;  3HU1 A;  3BQB A;  4KO8 A;  2JA7 A;  3LHD A;  2O5J D;  2NVY A;  2PJH B;  3H0G A;  5FTM A;  1PYQ A;  1Y4Z A;  1PT1 A;  2R93 A;  2VPY A;  2JIO A;  2IV2 X;  2NYA A;  3ZJV A;  4CRY G;  2E7Z A;  2VUM A;  2KI8 A;  1H5N A;  5CCB A;  1CR5 A;  1AW8 B;  1QCS A;  3HU3 A;  4CRZ A;  3O5A A;  2BE5 D;  2WAQ A;  3IR5 A;  3QQ7 A;  1EU1 A;  2JIP A;  2PJJ A;  3IR6 A;  4AAY A;  2MM0 A;  5FTJ A;  5GLF A;  2XDP A;  5ERG B;  4UC4 A;  3OUG A;  1PQH A;  1YNN D;  2AE0 X;  3GTM A;  5D6W A;  4ARI A;  2Q19 X;  1YNJ D;  2E2H A;  2CW0 D;  1ZYR D;  3TIW A;  4KLN A;  3FPT A;  3QQ8 A;  2A6H D;  4AZD A;  2VPX A;  3FPU A;  5CCX A;  5DYG A;  2VPZ A;  2A68 D;  1TMO A;  3GTQ A;  1WCM A;  2QQR A;  3QC8 A;  1Q16 A;  1PT0 A;  2G5D A;  4DMR A;  1Y1W A;  4CQN A;  1PPY A;  1FDO A;  3DMR A;  3CZB A;  1E60 A;  1R9T A;  2JA6 A;  3LGA A;  1AA6 A;  1H0H A;  2YUJ A;  3MB5 A;  1TWG A;  1TWC A;  2DMR A;  2R92 A;  4AS1 A;  5EQJ B;  2JIQ A;  1TWA A;  2PMZ A;  4D7Z B;  1UHD A;  4GA5 A;  3ZGZ A;  3GTK A;  1E5V A;  4NOH A;  1O54 A;  1QDN A;  5FTN A;  5T5M D;  5B6C A;  3TM7 B;  1CZ5 A;  3CF2 A;  2B63 A;  2LW6 A;  1KQG A;  1Y5I A;  2V45 A;  1VC3 B;  2A6E D;  1R27 A;  2JIM A;  4CS0 A;  3GTG A;  2Q18 X;  4AQ7 A;  1WLF A;  1TWH A;  3QWZ A;  5C1B A;  5CD1 A;  1Y1V A;  2PI8 A;  3CQZ A;  1E18 A;  1E61 A;  4KOD A;  2VPW A;  1SMY D;  1ZC1 A;  1E32 A;  1YLE A;  3FKI A;  2NAP A;  3ZJU A;  1R7R A;  1SFO A;  5EPP A;  1KQF A;  2YU9 A;  2KY9 A;  3ZJT A;  2GAE A;  4AON B;  1G8K A;  3HKZ A;  1PQF A;  3IR7 A;  2C45 A;  5FTL A;  3PLX B;  1SIW A;  2EEO B;  3ML1 A;  5FTK A;  1I3Q A;  2Q1C X;  2Q1D X;  2NVX A;  1DMR A;  4AYB A;  1CZ4 A;  2MM2 A;  2Q1A X;  3HU2 A;  2B25 A;  2V3V A;  1PYU B;  2PWY A;  3GTO A;  1I50 A;  2A69 D;  5D6X A;  2R7Z A;  1FDI A;  1OGY A;  1UHE A;  2JIR A;  2JA5 A;  5D6Y A;  1G8J A;  2GFA A;  1DMS A;  4QIW A;  2G6G A;  2GF7 A;  1S3S A;  1K83 A;  5C18 A;  2Y0S A;  1TWF A;  2JV2 A;  4GA6 A;  4KDI A;  3GTJ A;  4C2M A;  4FIB A;  2PIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...