1QDNA

Amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
201
structure length
189
Chain Sequence
MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the amino-terminal domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Fusion protein
molecule keywords PROTEIN (N-ETHYLMALEIMIDE SENSITIVE FUSION PROTEIN (NSF))
total genus 45
structure length 189
sequence length 201
chains with identical sequence B, C
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qdnA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qdnA02
2VPZA 1E32A 1TWGA 1FDIA 3QQ8A 1PQEA 1WCMA 1AW8B 4KODA 1DMRA 4AAYA 1PQHA 5T5ID 3TM7B 2JA5A 1PYQA 1H5NA 1G8JA 1Y1VA 1TWCA 1S3SA 4DMRA 2E2IA 1OGYA 2EEOB 5GLFA 1UHDA 4CRYG 1TMOA 2VUMA 1TWFA 4GA5A 4KO8A 1PQFA 3QC8A 1E60A 3H0GA 1FDOA 1E61A 4GA6A 1R7RA 1Q16A 1UHEA 4AONB 2NAPA 1PYUB 3IR5A 3OUGA 4AOKB 3GTPA 5DYGA 4QIWA 4KDLA 1G8KA 3ML1A 3IR7A 4AYBA 4D7ZB 2B63A 2NVYA 1E5VA 5FTNA 2JIRA 5FTJA 1Y4ZA 2R7ZA 2KI8A 2YU9A 3IR6A 2YUJA 3GTMA 1KQFA 3GTJA 2V3VA 1VC3B 2JIPA 1WLFA 2NYAA 4AZDA 1ZC1A 5FTLA 1H0HA 5FTKA 2C45A 1SFOA 2PJHB 1PT0A 2PMZA 2R92A 1PT1A 1EU1A 2Y0SA 3HKZA 2V45A 3HU3A 1Y5IA 2VPWA 4CRZA 1YLEA 2JA6A 2JV2A 3GTOA 3GTKA 2JIOA 1PPYA 1CR5A 3GTLA 2NVXA 4KLNA 5B6CA 1DMSA 1R9TA 2IV2X 2WAQA 1IW7D 4C2MA 3QWZA 3PLXB 3CQZA 4KDIA 2E2HA 1QCSA 1I3QA 1I50A 2VPXA 3GTQA 2VPYA 1AA6A 1Y1WA 4CS0A 1TWAA 1SIWA 5C1BA 2R93A 2WB1A 2JIQA 4RV0A 1R27A 3DMRA 3CF2A 3HU1A 5EPPA 3TIWA 1TWHA 2DMRA 3GTGA 3QQ7A 1KQGA 2JIMA 5C18A 2JA7A 1E18A 5FTMA 1QDNA 3O5AA 5T5MD 1K83A 1CZ5A 5DYIA 2E7ZA 1CZ4A 3HU2A 3FKIA
chains in the Genus database with same CATH superfamily
2VPZA 1E32A 1TWGA 1FDIA 3BQBA 5GLXA 1I9GA 3QQ8A 1PQEA 1WCMA 3M3GA 4AVRA 1AW8B 3LGAA 1YNND 4KODA 1DMRA 2PNWA 1PQHA 5T5ID 3TM7B 3X2NA 1PYQA 3X2OA 1H5NA 1G8JA 3X2KA 2JA5A 5CCXA 3ZJTA 1Y1VA 1TWCA 2Q1AX 1S3SA 4ARIA 4DMRA 2MM0A 2A69D 2E2IA 1OGYA 3SUKA 1ZYRD 2EEOB 2G6GA 4JP6A 2KY9A 5GLFA 5D6YA 2G5DA 2YVLA 1UHDA 4CRYG 1TMOA 2A6HD 2VUMA 5D6WA 1TWFA 4GA5A 4KO8A 3X2JA 4UC4A 4ZM7A 2B25A 1PQFA 3FPRA 3QC8A 1E60A 3H0GA 3FPTA 1FDOA 1E61A 2AE0X 4GA6A 3D30A 3SULA 1R7RA 1N10A 1Q16A 2PJJA 5CD1A 5CCBA 1UHEA 4AONB 2NAPA 1PYUB 1SMYD 3IR5A 3OUGA 4AOKB 3GTPA 5DYGA 4QIWA 1OA7A 2A68D 4KDLA 1HD5A 1G8KA 4AAYA 1YNJD 3ML1A 4JJOA 2XDPA 3IR7A 3X2HA 3X2MA 4AYBA 4D7ZB 2B63A 2NVYA 5ERGB 4ARCA 4ENGA 5D6XA 1E5VA 5FTNA 2PI8A 2JIRA 2BE5D 5FTJA 1Y4ZA 4JS7A 2R7ZA 2KI8A 2YU9A 3IR6A 2YUJA 3GTMA 4FFTA 3X2PA 1KQFA 1WC2A 5GLYA 3GTJA 2V3VA 1VC3B 2JIPA 1WLFA 3ZJUA 1ZC1A 2NYAA 4AZDA 5FTLA 1H0HA 5FTKA 2C45A 1SFOA 2PJHB 1O54A 2Q1DX 1PT0A 2HCZX 2Q19X 2PMZA 2R92A 1OA9A 1PT1A 3SUMA 1EU1A 2Y0SA 3HKZA 2Q18X 2V45A 4JCWA 3X2IA 3HU3A 4AS1A 1Y5IA 3LHDA 2VPWA 4CRZA 1YLEA 2JA6A 2Q1CX 4FIBA 2JV2A 3GTOA 1BW4A 3MB5A 3GTKA 2QQSA 2JIOA 1PPYA 1CR5A 3GTLA 3CZBA 2NVXA 4KLNA 5B6CA 1DMSA 1R9TA 2IV2X 2WAQA 1IW7D 1L8FA 3SUJA 2CW0D 5GM9A 3QWZA 4C2MA 3PLXB 2A6ED 2QQRA 2GF7A 3CQZA 3FPUA 4KDIA 4NOHA 2E2HA 1QCSA 2BH0A 1I3QA 1I50A 4FG2A 2PWYA 2VPXA 3ENGA 3GTQA 2O5JD 2VPYA 4L48A 1AA6A 1Y1WA 2MM2A 3ZJVA 2LW6A 4CS0A 3X2GA 5EQJB 1TWAA 1SIWA 5C1BA 2R93A 2WB1A 2JIQA 4RV0A 1R27A 3DMRA 3CF2A 3HU1A 5EPPA 3TIWA 1BW3A 2GFAA 1TWHA 2ENGA 2KQAA 4CQNA 2DMRA 3GTGA 3QQ7A 4FG4A 1KQGA 4AQ7A 2JIMA 5C18A 2JA7A 1E18A 2GAEA 4JP7A 5H4UA 5FTMA 3ZGZA 3X2LA 1QDNA 2PICA 3O5AA 4FERA 5T5MD 1K83A 1CZ5A 5DYIA 2E7ZA 1CZ4A 3HU2A 3FKIA
chains in the Genus database with same CATH topology
2VPZA 1E32A 1TWGA 1FDIA 3BQBA 1I9GA 3QQ8A 1PQEA 1WCMA 1AW8B 3LGAA 1YNND 4KODA 1DMRA 2PNWA 1PQHA 5T5ID 3TM7B 4AAYA 1PYQA 2JA5A 1H5NA 1G8JA 5CCXA 3ZJTA 1Y1VA 1TWCA 2Q1AX 1S3SA 4ARIA 4DMRA 2MM0A 2A69D 2E2IA 1OGYA 2KY9A 1ZYRD 2EEOB 2G6GA 5GLFA 5D6YA 2G5DA 2YVLA 1UHDA 4CRYG 1TMOA 2A6HD 2VUMA 5D6WA 1TWFA 4GA5A 4KO8A 4UC4A 2B25A 1PQFA 3FPRA 3QC8A 1E60A 3H0GA 3FPTA 1FDOA 1E61A 2AE0X 4GA6A 1R7RA 1Q16A 2PJJA 5CD1A 5CCBA 1UHEA 4AONB 2NAPA 1PYUB 1SMYD 3IR5A 3OUGA 4AOKB 3GTPA 5DYGA 4QIWA 2A68D 4KDLA 1G8KA 1YNJD 3ML1A 2XDPA 3IR7A 4AYBA 4D7ZB 5ERGB 2B63A 2NVYA 4ARCA 5D6XA 1E5VA 5FTNA 2PI8A 2JIRA 2BE5D 5FTJA 1Y4ZA 2R7ZA 2KI8A 2YU9A 3IR6A 2YUJA 3GTMA 1KQFA 3GTJA 2V3VA 1VC3B 2JIPA 1WLFA 3ZJUA 1ZC1A 2NYAA 4AZDA 5FTLA 1H0HA 5FTKA 2C45A 1SFOA 2PJHB 1O54A 2Q1DX 1PT0A 2Q19X 2PMZA 2R92A 1PT1A 1EU1A 2Y0SA 3HKZA 2Q18X 2V45A 3HU3A 4AS1A 1Y5IA 3LHDA 2VPWA 4CRZA 1YLEA 2JA6A 2Q1CX 4FIBA 2JV2A 3GTOA 3MB5A 3GTKA 2QQSA 2JIOA 1PPYA 1CR5A 3GTLA 3CZBA 2NVXA 4KLNA 5B6CA 1DMSA 1R9TA 2IV2X 2WAQA 1IW7D 2CW0D 4C2MA 3QWZA 2QQRA 3PLXB 2A6ED 2GF7A 3CQZA 3FPUA 4KDIA 4NOHA 2E2HA 1QCSA 1I3QA 1I50A 2PWYA 2VPXA 3GTQA 2O5JD 2VPYA 1AA6A 1Y1WA 2MM2A 3ZJVA 2LW6A 4CS0A 5EQJB 1TWAA 1SIWA 5C1BA 2R93A 2WB1A 2JIQA 4RV0A 1R27A 3DMRA 3CF2A 3HU1A 5EPPA 3TIWA 2GFAA 1TWHA 4CQNA 2DMRA 3GTGA 3QQ7A 1KQGA 4AQ7A 2JIMA 5C18A 2JA7A 1E18A 2GAEA 3ZGZA 5FTMA 1QDNA 2PICA 3O5AA 5T5MD 1K83A 1CZ5A 5DYIA 2E7ZA 1CZ4A 3HU2A 3FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPZ A;  1E32 A;  1TWG A;  1FDI A;  3QQ8 A;  1PQE A;  1WCM A;  1AW8 B;  4KOD A;  1DMR A;  4AAY A;  1PQH A;  5T5I D;  3TM7 B;  2JA5 A;  1PYQ A;  1H5N A;  1G8J A;  1Y1V A;  1TWC A;  1S3S A;  4DMR A;  2E2I A;  1OGY A;  2EEO B;  5GLF A;  1UHD A;  4CRY G;  1TMO A;  2VUM A;  1TWF A;  4GA5 A;  4KO8 A;  1PQF A;  3QC8 A;  1E60 A;  3H0G A;  1FDO A;  1E61 A;  4GA6 A;  1R7R A;  1Q16 A;  1UHE A;  4AON B;  2NAP A;  1PYU B;  3IR5 A;  3OUG A;  4AOK B;  3GTP A;  5DYG A;  4QIW A;  4KDL A;  1G8K A;  3ML1 A;  3IR7 A;  4AYB A;  4D7Z B;  2B63 A;  2NVY A;  1E5V A;  5FTN A;  2JIR A;  5FTJ A;  1Y4Z A;  2R7Z A;  2KI8 A;  2YU9 A;  3IR6 A;  2YUJ A;  3GTM A;  1KQF A;  3GTJ A;  2V3V A;  1VC3 B;  2JIP A;  1WLF A;  2NYA A;  4AZD A;  1ZC1 A;  5FTL A;  1H0H A;  5FTK A;  2C45 A;  1SFO A;  2PJH B;  1PT0 A;  2PMZ A;  2R92 A;  1PT1 A;  1EU1 A;  2Y0S A;  3HKZ A;  2V45 A;  3HU3 A;  1Y5I A;  2VPW A;  4CRZ A;  1YLE A;  2JA6 A;  2JV2 A;  3GTO A;  3GTK A;  2JIO A;  1PPY A;  1CR5 A;  3GTL A;  2NVX A;  4KLN A;  5B6C A;  1DMS A;  1R9T A;  2IV2 X;  2WAQ A;  1IW7 D;  4C2M A;  3QWZ A;  3PLX B;  3CQZ A;  4KDI A;  2E2H A;  1QCS A;  1I3Q A;  1I50 A;  2VPX A;  3GTQ A;  2VPY A;  1AA6 A;  1Y1W A;  4CS0 A;  1TWA A;  1SIW A;  5C1B A;  2R93 A;  2WB1 A;  2JIQ A;  4RV0 A;  1R27 A;  3DMR A;  3CF2 A;  3HU1 A;  5EPP A;  3TIW A;  1TWH A;  2DMR A;  3GTG A;  3QQ7 A;  1KQG A;  2JIM A;  5C18 A;  2JA7 A;  1E18 A;  5FTM A;  1QDN A;  3O5A A;  5T5M D;  1K83 A;  1CZ5 A;  5DYI A;  2E7Z A;  1CZ4 A;  3HU2 A;  3FKI A; 
#chains in the Genus database with same CATH topology
 2VPZ A;  1E32 A;  1TWG A;  1FDI A;  3BQB A;  5GLX A;  1I9G A;  3QQ8 A;  1PQE A;  1WCM A;  3M3G A;  4AVR A;  1AW8 B;  3LGA A;  1YNN D;  4KOD A;  1DMR A;  2PNW A;  1PQH A;  5T5I D;  3TM7 B;  3X2N A;  1PYQ A;  3X2O A;  1H5N A;  1G8J A;  3X2K A;  2JA5 A;  5CCX A;  3ZJT A;  1Y1V A;  1TWC A;  2Q1A X;  1S3S A;  4ARI A;  4DMR A;  2MM0 A;  2A69 D;  2E2I A;  1OGY A;  3SUK A;  1ZYR D;  2EEO B;  2G6G A;  4JP6 A;  2KY9 A;  5GLF A;  5D6Y A;  2G5D A;  2YVL A;  1UHD A;  4CRY G;  1TMO A;  2A6H D;  2VUM A;  5D6W A;  1TWF A;  4GA5 A;  4KO8 A;  3X2J A;  4UC4 A;  4ZM7 A;  2B25 A;  1PQF A;  3FPR A;  3QC8 A;  1E60 A;  3H0G A;  3FPT A;  1FDO A;  1E61 A;  2AE0 X;  4GA6 A;  3D30 A;  3SUL A;  1R7R A;  1N10 A;  1Q16 A;  2PJJ A;  5CD1 A;  5CCB A;  1UHE A;  4AON B;  2NAP A;  1PYU B;  1SMY D;  3IR5 A;  3OUG A;  4AOK B;  3GTP A;  5DYG A;  4QIW A;  1OA7 A;  2A68 D;  4KDL A;  1HD5 A;  1G8K A;  4AAY A;  1YNJ D;  3ML1 A;  4JJO A;  2XDP A;  3IR7 A;  3X2H A;  3X2M A;  4AYB A;  4D7Z B;  2B63 A;  2NVY A;  5ERG B;  4ARC A;  4ENG A;  5D6X A;  1E5V A;  5FTN A;  2PI8 A;  2JIR A;  2BE5 D;  5FTJ A;  1Y4Z A;  4JS7 A;  2R7Z A;  2KI8 A;  2YU9 A;  3IR6 A;  2YUJ A;  3GTM A;  4FFT A;  3X2P A;  1KQF A;  1WC2 A;  5GLY A;  3GTJ A;  2V3V A;  1VC3 B;  2JIP A;  1WLF A;  3ZJU A;  1ZC1 A;  2NYA A;  4AZD A;  5FTL A;  1H0H A;  5FTK A;  2C45 A;  1SFO A;  2PJH B;  1O54 A;  2Q1D X;  1PT0 A;  2HCZ X;  2Q19 X;  2PMZ A;  2R92 A;  1OA9 A;  1PT1 A;  3SUM A;  1EU1 A;  2Y0S A;  3HKZ A;  2Q18 X;  2V45 A;  4JCW A;  3X2I A;  3HU3 A;  4AS1 A;  1Y5I A;  3LHD A;  2VPW A;  4CRZ A;  1YLE A;  2JA6 A;  2Q1C X;  4FIB A;  2JV2 A;  3GTO A;  1BW4 A;  3MB5 A;  3GTK A;  2QQS A;  2JIO A;  1PPY A;  1CR5 A;  3GTL A;  3CZB A;  2NVX A;  4KLN A;  5B6C A;  1DMS A;  1R9T A;  2IV2 X;  2WAQ A;  1IW7 D;  1L8F A;  3SUJ A;  2CW0 D;  5GM9 A;  3QWZ A;  4C2M A;  3PLX B;  2A6E D;  2QQR A;  2GF7 A;  3CQZ A;  3FPU A;  4KDI A;  4NOH A;  2E2H A;  1QCS A;  2BH0 A;  1I3Q A;  1I50 A;  4FG2 A;  2PWY A;  2VPX A;  3ENG A;  3GTQ A;  2O5J D;  2VPY A;  4L48 A;  1AA6 A;  1Y1W A;  2MM2 A;  3ZJV A;  2LW6 A;  4CS0 A;  3X2G A;  5EQJ B;  1TWA A;  1SIW A;  5C1B A;  2R93 A;  2WB1 A;  2JIQ A;  4RV0 A;  1R27 A;  3DMR A;  3CF2 A;  3HU1 A;  5EPP A;  3TIW A;  1BW3 A;  2GFA A;  1TWH A;  2ENG A;  2KQA A;  4CQN A;  2DMR A;  3GTG A;  3QQ7 A;  4FG4 A;  1KQG A;  4AQ7 A;  2JIM A;  5C18 A;  2JA7 A;  1E18 A;  2GAE A;  4JP7 A;  5H4U A;  5FTM A;  3ZGZ A;  3X2L A;  1QDN A;  2PIC A;  3O5A A;  4FER A;  5T5M D;  1K83 A;  1CZ5 A;  5DYI A;  2E7Z A;  1CZ4 A;  3HU2 A;  3FKI A; 
#chains in the Genus database with same CATH homology
 2VPZ A;  1E32 A;  1TWG A;  1FDI A;  3BQB A;  1I9G A;  3QQ8 A;  1PQE A;  1WCM A;  1AW8 B;  3LGA A;  1YNN D;  4KOD A;  1DMR A;  2PNW A;  1PQH A;  5T5I D;  3TM7 B;  4AAY A;  1PYQ A;  2JA5 A;  1H5N A;  1G8J A;  5CCX A;  3ZJT A;  1Y1V A;  1TWC A;  2Q1A X;  1S3S A;  4ARI A;  4DMR A;  2MM0 A;  2A69 D;  2E2I A;  1OGY A;  2KY9 A;  1ZYR D;  2EEO B;  2G6G A;  5GLF A;  5D6Y A;  2G5D A;  2YVL A;  1UHD A;  4CRY G;  1TMO A;  2A6H D;  2VUM A;  5D6W A;  1TWF A;  4GA5 A;  4KO8 A;  4UC4 A;  2B25 A;  1PQF A;  3FPR A;  3QC8 A;  1E60 A;  3H0G A;  3FPT A;  1FDO A;  1E61 A;  2AE0 X;  4GA6 A;  1R7R A;  1Q16 A;  2PJJ A;  5CD1 A;  5CCB A;  1UHE A;  4AON B;  2NAP A;  1PYU B;  1SMY D;  3IR5 A;  3OUG A;  4AOK B;  3GTP A;  5DYG A;  4QIW A;  2A68 D;  4KDL A;  1G8K A;  1YNJ D;  3ML1 A;  2XDP A;  3IR7 A;  4AYB A;  4D7Z B;  5ERG B;  2B63 A;  2NVY A;  4ARC A;  5D6X A;  1E5V A;  5FTN A;  2PI8 A;  2JIR A;  2BE5 D;  5FTJ A;  1Y4Z A;  2R7Z A;  2KI8 A;  2YU9 A;  3IR6 A;  2YUJ A;  3GTM A;  1KQF A;  3GTJ A;  2V3V A;  1VC3 B;  2JIP A;  1WLF A;  3ZJU A;  1ZC1 A;  2NYA A;  4AZD A;  5FTL A;  1H0H A;  5FTK A;  2C45 A;  1SFO A;  2PJH B;  1O54 A;  2Q1D X;  1PT0 A;  2Q19 X;  2PMZ A;  2R92 A;  1PT1 A;  1EU1 A;  2Y0S A;  3HKZ A;  2Q18 X;  2V45 A;  3HU3 A;  4AS1 A;  1Y5I A;  3LHD A;  2VPW A;  4CRZ A;  1YLE A;  2JA6 A;  2Q1C X;  4FIB A;  2JV2 A;  3GTO A;  3MB5 A;  3GTK A;  2QQS A;  2JIO A;  1PPY A;  1CR5 A;  3GTL A;  3CZB A;  2NVX A;  4KLN A;  5B6C A;  1DMS A;  1R9T A;  2IV2 X;  2WAQ A;  1IW7 D;  2CW0 D;  4C2M A;  3QWZ A;  2QQR A;  3PLX B;  2A6E D;  2GF7 A;  3CQZ A;  3FPU A;  4KDI A;  4NOH A;  2E2H A;  1QCS A;  1I3Q A;  1I50 A;  2PWY A;  2VPX A;  3GTQ A;  2O5J D;  2VPY A;  1AA6 A;  1Y1W A;  2MM2 A;  3ZJV A;  2LW6 A;  4CS0 A;  5EQJ B;  1TWA A;  1SIW A;  5C1B A;  2R93 A;  2WB1 A;  2JIQ A;  4RV0 A;  1R27 A;  3DMR A;  3CF2 A;  3HU1 A;  5EPP A;  3TIW A;  2GFA A;  1TWH A;  4CQN A;  2DMR A;  3GTG A;  3QQ7 A;  1KQG A;  4AQ7 A;  2JIM A;  5C18 A;  2JA7 A;  1E18 A;  2GAE A;  3ZGZ A;  5FTM A;  1QDN A;  2PIC A;  3O5A A;  5T5M D;  1K83 A;  1CZ5 A;  5DYI A;  2E7Z A;  1CZ4 A;  3HU2 A;  3FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...