1QDNA

Amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
201
structure length
189
Chain Sequence
b'MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (N-ETHYLMALEIMIDE SENSITIVE FUSION PROTEIN (NSF))
molecule tags Fusion protein
source organism Cricetulus griseus
publication title Crystal structure of the amino-terminal domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
total genus 45
structure length 189
sequence length 201
chains with identical sequence B, C
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qdnA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qdnA02
3ML1A 1ZC1A 2JA5A 4DMRA 1PQHA 1CR5A 4D7ZB 1Q16A 1TWAA 5DYGA 4KDLA 1PQEA 5FTLA 5C1BA 3H0GA 4KO8A 5B6CA 3HKZA 3GTLA 3GTPA 5GLFA 2E2HA 3TIWA 4AONB 1PYQA 2E7ZA 2VPWA 3GTQA 4AOKB 2PJHB 3QQ8A 4C2MA 1KQFA 2JA6A 1TWFA 1S3SA 3GTGA 2R7ZA 4AZDA 1K83A 2JV2A 1Y4ZA 1OGYA 3OUGA 1WCMA 3HU2A 4CS0A 1PQFA 1E32A 2V45A 3O5AA 1FDIA 3HU1A 1TMOA 1KQGA 3DMRA 1I50A 1CZ4A 2PMZA 3QC8A 2JIOA 1G8JA 2EEOB 3GTMA 1TWGA 1DMRA 4QIWA 1YLEA 1R9TA 2NVXA 2R93A 5DYIA 2R92A 3GTOA 1IW7D 4KODA 1I3QA 2NAPA 2B63A 2JIPA 1R7RA 2JIQA 2JIMA 3IR5A 2IV2X 3IR7A 4AAYA 3GTKA 1Y1WA 1E18A 1AW8B 2NYAA 3HU3A 3CF2A 5FTMA 1Y1VA 3FKIA 3PLXB 5FTNA 5C18A 1PYUB 1Y5IA 5EPPA 5FTJA 1E5VA 1E60A 1TWHA 2KI8A 1TWCA 2WAQA 2JIRA 1DMSA 1CZ5A 2C45A 2YU9A 1UHEA 5T5MD 2Y0SA 5T5ID 3QQ7A 4GA6A 1PPYA 4KDIA 1QCSA 1G8KA 1UHDA 1AA6A 4KLNA 5FTKA 2YUJA 1SIWA 4CRYG 1PT1A 2VPXA 1FDOA 1PT0A 2VUMA 3IR6A 2WB1A 2NVYA 4CRZA 2DMRA 3TM7B 3GTJA 2JA7A 1E61A 1VC3B 3QWZA 4RV0A 1R27A 4GA5A 2V3VA 1SFOA 1WLFA 3CQZA 1QDNA 2VPYA 1H0HA 2VPZA 4AYBA 2E2IA 1EU1A 1H5NA
chains in the Genus database with same CATH superfamily
3ML1A 3ZJUA 3X2LA 2PWYA 3X2OA 1ZC1A 2JA5A 3D30A 4DMRA 1PQHA 5D6WA 2Q1CX 1CR5A 5ERGB 5CD1A 4D7ZB 1Q16A 1TWAA 5DYGA 1BW4A 4KDLA 1PQEA 5FTLA 4JP7A 5C1BA 1SMYD 3H0GA 4KO8A 2GAEA 5B6CA 3HKZA 3CZBA 2KY9A 3GTLA 3GTPA 5GLFA 4CQNA 2E2HA 3TIWA 4AONB 4NOHA 2KQAA 1PYQA 2E7ZA 2VPWA 3GTQA 4AOKB 2PJHB 3QQ8A 4C2MA 1KQFA 2JA6A 3FPTA 3ZJTA 1TWFA 1OA7A 1S3SA 3SULA 3GTGA 4AZDA 2R7ZA 1K83A 2JV2A 2QQRA 2AE0X 1Y4ZA 1OGYA 1WCMA 3HU2A 3OUGA 4CS0A 1PQFA 1E32A 3MB5A 2V45A 2QQSA 2CW0D 2G5DA 3SUMA 3O5AA 1FDIA 3HU1A 2YVLA 1HD5A 1TMOA 1KQGA 3DMRA 4JP6A 1I50A 1CZ4A 5D6XA 2PMZA 2A69D 3QC8A 2JIOA 1I9GA 3LGAA 1G8JA 3ZJVA 2EEOB 2MM2A 1YNND 3GTMA 1TWGA 1ZYRD 1DMRA 2BH0A 1YLEA 4QIWA 2A6ED 2PI8A 3X2HA 1R9TA 2R93A 2NVXA 5DYIA 2R92A 3GTOA 1IW7D 2GF7A 2Q1DX 4KODA 1WC2A 4JS7A 1I3QA 2NAPA 4AVRA 2B63A 1O54A 5CCBA 2JIPA 1R7RA 2JIQA 2JIMA 4FG4A 3IR5A 2IV2X 3IR7A 4FG2A 4AAYA 3GTKA 4FERA 1Y1WA 1E18A 4FFTA 1AW8B 3LHDA 2NYAA 3HU3A 3CF2A 3M3GA 1Y1VA 2BE5D 3FKIA 2A6HD 3PLXB 5FTMA 5FTNA 3FPRA 5C18A 2Q18X 1PYUB 1Y5IA 5EPPA 4FIBA 5FTJA 2MM0A 2PNWA 1E5VA 3X2PA 3FPUA 2HCZX 4ARCA 1E60A 1TWHA 2PJJA 2KI8A 1TWCA 2WAQA 2JIRA 2A68D 1DMSA 1CZ5A 2C45A 3X2MA 2YU9A 1OA9A 1UHEA 5T5MD 4L48A 4ENGA 2Q1AX 2Y0SA 5T5ID 3QQ7A 4GA6A 2O5JD 1PPYA 3BQBA 5CCXA 4KDIA 1QCSA 1G8KA 4AQ7A 3ZGZA 1UHDA 1AA6A 4KLNA 5FTKA 3SUKA 2YUJA 1SIWA 1YNJD 4JCWA 1N10A 3X2KA 4CRYG 2ENGA 1PT1A 2VPXA 4UC4A 2PICA 1FDOA 1PT0A 4AS1A 2VUMA 3X2IA 3IR6A 2WB1A 2NVYA 4CRZA 2DMRA 5H4UA 3TM7B 2XDPA 4JJOA 5D6YA 3GTJA 3X2GA 2LW6A 2JA7A 1L8FA 3SUJA 1E61A 1VC3B 3QWZA 4RV0A 1BW3A 2B25A 1R27A 4GA5A 2G6GA 2V3VA 2Q19X 5GM9A 1SFOA 2GFAA 1WLFA 5EQJB 3CQZA 4ARIA 1QDNA 3X2JA 2VPYA 1H0HA 2VPZA 4AYBA 3ENGA 5GLYA 2E2IA 4ZM7A 5GLXA 3X2NA 1EU1A 1H5NA
chains in the Genus database with same CATH topology
3ML1A 3ZJUA 2PWYA 1ZC1A 2JA5A 4DMRA 1PQHA 5D6WA 2Q1CX 1CR5A 5ERGB 5CD1A 4D7ZB 1Q16A 1TWAA 5DYGA 4KDLA 1PQEA 5FTLA 5C1BA 1SMYD 3H0GA 4KO8A 2GAEA 5B6CA 3HKZA 3CZBA 2KY9A 3GTLA 3GTPA 5GLFA 4CQNA 2E2HA 3TIWA 4AONB 4NOHA 1PYQA 2E7ZA 2VPWA 3GTQA 4AOKB 2PJHB 3QQ8A 4C2MA 1KQFA 2JA6A 3FPTA 3ZJTA 1TWFA 1S3SA 3GTGA 2R7ZA 4AZDA 2QQRA 1K83A 2JV2A 4FIBA 2AE0X 1Y4ZA 1OGYA 1WCMA 3HU2A 3OUGA 4CS0A 1PQFA 1E32A 3MB5A 2V45A 2QQSA 2CW0D 2G5DA 3O5AA 1FDIA 3HU1A 2YVLA 1TMOA 1KQGA 3DMRA 1I50A 5D6XA 1CZ4A 2PMZA 2A69D 3QC8A 2JIOA 1I9GA 3LGAA 1G8JA 3ZJVA 2EEOB 2MM2A 1YNND 3GTMA 1TWGA 1ZYRD 1DMRA 4QIWA 1YLEA 1R9TA 2A6ED 2PI8A 2NVXA 2R93A 5DYIA 2R92A 3GTOA 1IW7D 2GF7A 2Q1DX 4KODA 1I3QA 2NAPA 2B63A 1O54A 5CCBA 2JIPA 1R7RA 2JIQA 2JIMA 3IR5A 2IV2X 3IR7A 4AAYA 3GTKA 1Y1WA 1E18A 3LHDA 1AW8B 2NYAA 3HU3A 3CF2A 5FTMA 1Y1VA 2BE5D 3FKIA 2A6HD 3PLXB 5CCXA 5FTNA 3FPRA 5C18A 2Q18X 1PYUB 1Y5IA 5EPPA 5FTJA 2MM0A 2PNWA 1E5VA 3FPUA 4ARCA 1E60A 1TWHA 2PJJA 2KI8A 1TWCA 2WAQA 2JIRA 2A68D 1DMSA 1CZ5A 2C45A 2YU9A 2Q1AX 1UHEA 5T5MD 2Y0SA 5T5ID 3QQ7A 4GA6A 2O5JD 1PPYA 3BQBA 4KDIA 1QCSA 1G8KA 4AQ7A 3ZGZA 1UHDA 1AA6A 4KLNA 5FTKA 2YUJA 1SIWA 1YNJD 4CRYG 1PT1A 2VPXA 4UC4A 2PICA 1FDOA 1PT0A 4AS1A 2VUMA 3IR6A 2WB1A 2NVYA 4CRZA 2DMRA 3TM7B 2XDPA 5D6YA 3GTJA 2LW6A 2JA7A 1E61A 1VC3B 3QWZA 4RV0A 2B25A 1R27A 4GA5A 2G6GA 2V3VA 2Q19X 2GFAA 1SFOA 5EQJB 1WLFA 3CQZA 4ARIA 1QDNA 2VPYA 1H0HA 2VPZA 4AYBA 2E2IA 1EU1A 1H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML1 A;  1ZC1 A;  2JA5 A;  4DMR A;  1PQH A;  1CR5 A;  4D7Z B;  1Q16 A;  1TWA A;  5DYG A;  4KDL A;  1PQE A;  5FTL A;  5C1B A;  3H0G A;  4KO8 A;  5B6C A;  3HKZ A;  3GTL A;  3GTP A;  5GLF A;  2E2H A;  3TIW A;  4AON B;  1PYQ A;  2E7Z A;  2VPW A;  3GTQ A;  4AOK B;  2PJH B;  3QQ8 A;  4C2M A;  1KQF A;  2JA6 A;  1TWF A;  1S3S A;  3GTG A;  2R7Z A;  4AZD A;  1K83 A;  2JV2 A;  1Y4Z A;  1OGY A;  3OUG A;  1WCM A;  3HU2 A;  4CS0 A;  1PQF A;  1E32 A;  2V45 A;  3O5A A;  1FDI A;  3HU1 A;  1TMO A;  1KQG A;  3DMR A;  1I50 A;  1CZ4 A;  2PMZ A;  3QC8 A;  2JIO A;  1G8J A;  2EEO B;  3GTM A;  1TWG A;  1DMR A;  4QIW A;  1YLE A;  1R9T A;  2NVX A;  2R93 A;  5DYI A;  2R92 A;  3GTO A;  1IW7 D;  4KOD A;  1I3Q A;  2NAP A;  2B63 A;  2JIP A;  1R7R A;  2JIQ A;  2JIM A;  3IR5 A;  2IV2 X;  3IR7 A;  4AAY A;  3GTK A;  1Y1W A;  1E18 A;  1AW8 B;  2NYA A;  3HU3 A;  3CF2 A;  5FTM A;  1Y1V A;  3FKI A;  3PLX B;  5FTN A;  5C18 A;  1PYU B;  1Y5I A;  5EPP A;  5FTJ A;  1E5V A;  1E60 A;  1TWH A;  2KI8 A;  1TWC A;  2WAQ A;  2JIR A;  1DMS A;  1CZ5 A;  2C45 A;  2YU9 A;  1UHE A;  5T5M D;  2Y0S A;  5T5I D;  3QQ7 A;  4GA6 A;  1PPY A;  4KDI A;  1QCS A;  1G8K A;  1UHD A;  1AA6 A;  4KLN A;  5FTK A;  2YUJ A;  1SIW A;  4CRY G;  1PT1 A;  2VPX A;  1FDO A;  1PT0 A;  2VUM A;  3IR6 A;  2WB1 A;  2NVY A;  4CRZ A;  2DMR A;  3TM7 B;  3GTJ A;  2JA7 A;  1E61 A;  1VC3 B;  3QWZ A;  4RV0 A;  1R27 A;  4GA5 A;  2V3V A;  1SFO A;  1WLF A;  3CQZ A;  1QDN A;  2VPY A;  1H0H A;  2VPZ A;  4AYB A;  2E2I A;  1EU1 A;  1H5N A; 
#chains in the Genus database with same CATH topology
 3ML1 A;  3ZJU A;  3X2L A;  2PWY A;  3X2O A;  1ZC1 A;  2JA5 A;  3D30 A;  4DMR A;  1PQH A;  5D6W A;  2Q1C X;  1CR5 A;  5ERG B;  5CD1 A;  4D7Z B;  1Q16 A;  1TWA A;  5DYG A;  1BW4 A;  4KDL A;  1PQE A;  5FTL A;  4JP7 A;  5C1B A;  1SMY D;  3H0G A;  4KO8 A;  2GAE A;  5B6C A;  3HKZ A;  3CZB A;  2KY9 A;  3GTL A;  3GTP A;  5GLF A;  4CQN A;  2E2H A;  3TIW A;  4AON B;  4NOH A;  2KQA A;  1PYQ A;  2E7Z A;  2VPW A;  3GTQ A;  4AOK B;  2PJH B;  3QQ8 A;  4C2M A;  1KQF A;  2JA6 A;  3FPT A;  3ZJT A;  1TWF A;  1OA7 A;  1S3S A;  3SUL A;  3GTG A;  4AZD A;  2R7Z A;  1K83 A;  2JV2 A;  2QQR A;  2AE0 X;  1Y4Z A;  1OGY A;  1WCM A;  3HU2 A;  3OUG A;  4CS0 A;  1PQF A;  1E32 A;  3MB5 A;  2V45 A;  2QQS A;  2CW0 D;  2G5D A;  3SUM A;  3O5A A;  1FDI A;  3HU1 A;  2YVL A;  1HD5 A;  1TMO A;  1KQG A;  3DMR A;  4JP6 A;  1I50 A;  1CZ4 A;  5D6X A;  2PMZ A;  2A69 D;  3QC8 A;  2JIO A;  1I9G A;  3LGA A;  1G8J A;  3ZJV A;  2EEO B;  2MM2 A;  1YNN D;  3GTM A;  1TWG A;  1ZYR D;  1DMR A;  2BH0 A;  1YLE A;  4QIW A;  2A6E D;  2PI8 A;  3X2H A;  1R9T A;  2R93 A;  2NVX A;  5DYI A;  2R92 A;  3GTO A;  1IW7 D;  2GF7 A;  2Q1D X;  4KOD A;  1WC2 A;  4JS7 A;  1I3Q A;  2NAP A;  4AVR A;  2B63 A;  1O54 A;  5CCB A;  2JIP A;  1R7R A;  2JIQ A;  2JIM A;  4FG4 A;  3IR5 A;  2IV2 X;  3IR7 A;  4FG2 A;  4AAY A;  3GTK A;  4FER A;  1Y1W A;  1E18 A;  4FFT A;  1AW8 B;  3LHD A;  2NYA A;  3HU3 A;  3CF2 A;  3M3G A;  1Y1V A;  2BE5 D;  3FKI A;  2A6H D;  3PLX B;  5FTM A;  5FTN A;  3FPR A;  5C18 A;  2Q18 X;  1PYU B;  1Y5I A;  5EPP A;  4FIB A;  5FTJ A;  2MM0 A;  2PNW A;  1E5V A;  3X2P A;  3FPU A;  2HCZ X;  4ARC A;  1E60 A;  1TWH A;  2PJJ A;  2KI8 A;  1TWC A;  2WAQ A;  2JIR A;  2A68 D;  1DMS A;  1CZ5 A;  2C45 A;  3X2M A;  2YU9 A;  1OA9 A;  1UHE A;  5T5M D;  4L48 A;  4ENG A;  2Q1A X;  2Y0S A;  5T5I D;  3QQ7 A;  4GA6 A;  2O5J D;  1PPY A;  3BQB A;  5CCX A;  4KDI A;  1QCS A;  1G8K A;  4AQ7 A;  3ZGZ A;  1UHD A;  1AA6 A;  4KLN A;  5FTK A;  3SUK A;  2YUJ A;  1SIW A;  1YNJ D;  4JCW A;  1N10 A;  3X2K A;  4CRY G;  2ENG A;  1PT1 A;  2VPX A;  4UC4 A;  2PIC A;  1FDO A;  1PT0 A;  4AS1 A;  2VUM A;  3X2I A;  3IR6 A;  2WB1 A;  2NVY A;  4CRZ A;  2DMR A;  5H4U A;  3TM7 B;  2XDP A;  4JJO A;  5D6Y A;  3GTJ A;  3X2G A;  2LW6 A;  2JA7 A;  1L8F A;  3SUJ A;  1E61 A;  1VC3 B;  3QWZ A;  4RV0 A;  1BW3 A;  2B25 A;  1R27 A;  4GA5 A;  2G6G A;  2V3V A;  2Q19 X;  5GM9 A;  1SFO A;  2GFA A;  1WLF A;  5EQJ B;  3CQZ A;  4ARI A;  1QDN A;  3X2J A;  2VPY A;  1H0H A;  2VPZ A;  4AYB A;  3ENG A;  5GLY A;  2E2I A;  4ZM7 A;  5GLX A;  3X2N A;  1EU1 A;  1H5N A; 
#chains in the Genus database with same CATH homology
 3ML1 A;  3ZJU A;  2PWY A;  1ZC1 A;  2JA5 A;  4DMR A;  1PQH A;  5D6W A;  2Q1C X;  1CR5 A;  5ERG B;  5CD1 A;  4D7Z B;  1Q16 A;  1TWA A;  5DYG A;  4KDL A;  1PQE A;  5FTL A;  5C1B A;  1SMY D;  3H0G A;  4KO8 A;  2GAE A;  5B6C A;  3HKZ A;  3CZB A;  2KY9 A;  3GTL A;  3GTP A;  5GLF A;  4CQN A;  2E2H A;  3TIW A;  4AON B;  4NOH A;  1PYQ A;  2E7Z A;  2VPW A;  3GTQ A;  4AOK B;  2PJH B;  3QQ8 A;  4C2M A;  1KQF A;  2JA6 A;  3FPT A;  3ZJT A;  1TWF A;  1S3S A;  3GTG A;  2R7Z A;  4AZD A;  2QQR A;  1K83 A;  2JV2 A;  4FIB A;  2AE0 X;  1Y4Z A;  1OGY A;  1WCM A;  3HU2 A;  3OUG A;  4CS0 A;  1PQF A;  1E32 A;  3MB5 A;  2V45 A;  2QQS A;  2CW0 D;  2G5D A;  3O5A A;  1FDI A;  3HU1 A;  2YVL A;  1TMO A;  1KQG A;  3DMR A;  1I50 A;  5D6X A;  1CZ4 A;  2PMZ A;  2A69 D;  3QC8 A;  2JIO A;  1I9G A;  3LGA A;  1G8J A;  3ZJV A;  2EEO B;  2MM2 A;  1YNN D;  3GTM A;  1TWG A;  1ZYR D;  1DMR A;  4QIW A;  1YLE A;  1R9T A;  2A6E D;  2PI8 A;  2NVX A;  2R93 A;  5DYI A;  2R92 A;  3GTO A;  1IW7 D;  2GF7 A;  2Q1D X;  4KOD A;  1I3Q A;  2NAP A;  2B63 A;  1O54 A;  5CCB A;  2JIP A;  1R7R A;  2JIQ A;  2JIM A;  3IR5 A;  2IV2 X;  3IR7 A;  4AAY A;  3GTK A;  1Y1W A;  1E18 A;  3LHD A;  1AW8 B;  2NYA A;  3HU3 A;  3CF2 A;  5FTM A;  1Y1V A;  2BE5 D;  3FKI A;  2A6H D;  3PLX B;  5CCX A;  5FTN A;  3FPR A;  5C18 A;  2Q18 X;  1PYU B;  1Y5I A;  5EPP A;  5FTJ A;  2MM0 A;  2PNW A;  1E5V A;  3FPU A;  4ARC A;  1E60 A;  1TWH A;  2PJJ A;  2KI8 A;  1TWC A;  2WAQ A;  2JIR A;  2A68 D;  1DMS A;  1CZ5 A;  2C45 A;  2YU9 A;  2Q1A X;  1UHE A;  5T5M D;  2Y0S A;  5T5I D;  3QQ7 A;  4GA6 A;  2O5J D;  1PPY A;  3BQB A;  4KDI A;  1QCS A;  1G8K A;  4AQ7 A;  3ZGZ A;  1UHD A;  1AA6 A;  4KLN A;  5FTK A;  2YUJ A;  1SIW A;  1YNJ D;  4CRY G;  1PT1 A;  2VPX A;  4UC4 A;  2PIC A;  1FDO A;  1PT0 A;  4AS1 A;  2VUM A;  3IR6 A;  2WB1 A;  2NVY A;  4CRZ A;  2DMR A;  3TM7 B;  2XDP A;  5D6Y A;  3GTJ A;  2LW6 A;  2JA7 A;  1E61 A;  1VC3 B;  3QWZ A;  4RV0 A;  2B25 A;  1R27 A;  4GA5 A;  2G6G A;  2V3V A;  2Q19 X;  2GFA A;  1SFO A;  5EQJ B;  1WLF A;  3CQZ A;  4ARI A;  1QDN A;  2VPY A;  1H0H A;  2VPZ A;  4AYB A;  2E2I A;  1EU1 A;  1H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...