1QDNA

Amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
201
structure length
189
Chain Sequence
MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fusion protein
molecule keywords PROTEIN (N-ETHYLMALEIMIDE SENSITIVE FUSION PROTEIN (NSF))
publication title Crystal structure of the amino-terminal domain of N-ethylmaleimide-sensitive fusion protein.
pubmed doi rcsb
source organism Cricetulus griseus
total genus 45
structure length 189
sequence length 201
chains with identical sequence B, C
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1999-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1qdnA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1qdnA02
1PQEA 3IR6A 3QQ7A 1TWAA 1R9TA 2JIOA 3CQZA 4KDIA 1H0HA 1FDIA 2R7ZA 3DMRA 1PYQA 1PYUB 1Y4ZA 1UHDA 2PJHB 1TWHA 4RV0A 1UHEA 4AAYA 3GTPA 1S3SA 1VC3B 5FTKA 1E61A 4CS0A 2JIRA 1I3QA 4QIWA 1KQGA 1E18A 3OUGA 3GTQA 1PQFA 2IV2X 4KO8A 3GTJA 3HU2A 2YUJA 3QWZA 2KI8A 5FTLA 2JIPA 2DMRA 1TMOA 3IR5A 1EU1A 3O5AA 3ML1A 2NAPA 1K83A 2JA5A 4GA5A 1CR5A 1WLFA 1H5NA 2E7ZA 5C1BA 5C18A 3HKZA 1SIWA 4AZDA 3IR7A 3PLXB 4KDLA 1IW7D 2JA6A 2JA7A 1PQHA 2JIMA 1DMSA 1TWFA 1Y1WA 1E5VA 2Y0SA 1CZ4A 1QCSA 1Y1VA 3QC8A 1I50A 2VPWA 4CRZA 1AA6A 2VUMA 3GTKA 4AONB 2JV2A 3H0GA 3TIWA 5T5MD 1TWCA 1AW8B 4C2MA 5GLFA 2NVXA 4D7ZB 1G8KA 5T5ID 2E2IA 1G8JA 4KLNA 1DMRA 4AYBA 1SFOA 3FKIA 3HU1A 4KODA 3GTOA 1WCMA 2JIQA 3GTLA 2R92A 1QDNA 1FDOA 1YLEA 1TWGA 2WB1A 4AOKB 1ZC1A 2V45A 1PT1A 2C45A 5FTMA 1PPYA 5EPPA 3TM7B 2V3VA 1OGYA 1PT0A 3GTMA 1Q16A 1R27A 2B63A 3CF2A 5DYIA 2NYAA 3HU3A 4DMRA 1R7RA 4GA6A 3QQ8A 1CZ5A 2PMZA 1Y5IA 3GTGA 2NVYA 5DYGA 5B6CA 2EEOB 2R93A 2E2HA 2VPXA 4CRYG 5FTJA 2VPYA 5FTNA 2VPZA 1KQFA 1E32A 2WAQA 1E60A 2YU9A
chains in the Genus database with same CATH superfamily
1PQEA 3IR6A 3QQ7A 2GF7A 2B25A 2QQSA 1BW3A 1TWAA 1R9TA 2WAQA 2Q1DX 2JIOA 3CQZA 4KDIA 3ZJVA 1H0HA 1OA7A 3FPTA 1FDIA 2R7ZA 3DMRA 1PYQA 1Y4ZA 1N10A 1PYUB 1UHDA 2PJHB 1HD5A 2GFAA 1TWHA 4RV0A 1UHEA 4AAYA 3GTPA 4CQNA 1S3SA 1VC3B 1ZYRD 1WC2A 5FTKA 4FERA 3X2KA 4ARIA 2QQRA 1E61A 4FFTA 3X2HA 4CS0A 2JIRA 1I3QA 4QIWA 1KQGA 1E18A 3FPUA 3OUGA 3GTQA 2A6HD 2KY9A 2G6GA 2BH0A 1PQFA 2IV2X 4KO8A 5D6YA 5H4UA 3GTJA 3HU2A 2YUJA 3QWZA 2HCZX 2KI8A 4AS1A 5FTLA 4FG2A 2KQAA 2JIPA 2PI8A 5CD1A 2DMRA 2XDPA 1L8FA 1TMOA 3IR5A 1EU1A 3O5AA 5GM9A 4ZM7A 2O5JD 3ML1A 1I9GA 3FPRA 3LHDA 5ERGB 4AQ7A 2NAPA 2CW0D 1K83A 2JA5A 4GA5A 1CR5A 5D6WA 1WLFA 2BE5D 1H5NA 5CCBA 2E7ZA 5C1BA 5C18A 3HKZA 1SIWA 2A69D 3X2IA 4AZDA 3IR7A 3X2MA 3LGAA 3PLXB 3X2JA 2MM2A 4JJOA 4JP6A 4KDLA 1IW7D 2G5DA 1YNJD 2JA7A 1PQHA 4L48A 2JA6A 2JIMA 1DMSA 1TWFA 1Y1WA 2ENGA 2PNWA 1E5VA 2Y0SA 1CZ4A 1QCSA 1Y1VA 3QC8A 1I50A 2VPWA 4CRZA 4JS7A 3SUJA 1AA6A 2MM0A 2YVLA 5GLYA 2VUMA 3GTKA 4AONB 2JV2A 3ZJUA 3H0GA 3TIWA 2PWYA 5T5MD 1TWCA 1AW8B 2A6ED 2LW6A 3ENGA 5GLFA 4C2MA 1SMYD 3X2OA 2NVXA 2GAEA 4D7ZB 1YNND 5T5ID 2E2IA 1G8JA 4KLNA 1DMRA 1BW4A 4NOHA 4AYBA 1SFOA 3SUMA 2Q1AX 2PICA 4FG4A 3FKIA 4JP7A 3HU1A 4JCWA 3BQBA 4KODA 2Q19X 3GTOA 1WCMA 2JIQA 3GTLA 4ENGA 2R92A 3SUKA 1QDNA 3SULA 2AE0X 1FDOA 1YLEA 1TWGA 1OA9A 2WB1A 1ZC1A 3CZBA 5GLXA 2V45A 4AOKB 1PT1A 2A68D 3MB5A 2C45A 5FTMA 5EQJB 1PPYA 5EPPA 3TM7B 2V3VA 3X2LA 1OGYA 1PT0A 3GTMA 1Q16A 1R27A 2B63A 2Q18X 3CF2A 5DYIA 5CCXA 3ZJTA 2NYAA 3HU3A 3X2GA 4DMRA 1R7RA 4GA6A 3M3GA 3QQ8A 1CZ5A 3ZGZA 2PMZA 1Y5IA 3GTGA 3D30A 2NVYA 5DYGA 5B6CA 2EEOB 2R93A 3X2PA 2E2HA 2VPXA 4AVRA 3X2NA 4CRYG 5FTJA 4ARCA 2VPYA 1O54A 5D6XA 4FIBA 2PJJA 2Q1CX 5FTNA 2VPZA 1KQFA 1E32A 4UC4A 1G8KA 1E60A 2YU9A
chains in the Genus database with same CATH topology
1PQEA 3IR6A 3QQ7A 2GF7A 2B25A 2QQSA 1TWAA 1R9TA 2WAQA 2Q1DX 2JIOA 3CQZA 4KDIA 3ZJVA 1H0HA 3FPTA 1FDIA 2R7ZA 3DMRA 1PYQA 1Y4ZA 1PYUB 1UHDA 2PJHB 2GFAA 1TWHA 4RV0A 1UHEA 4AAYA 3GTPA 4CQNA 1S3SA 1VC3B 1ZYRD 5FTKA 4ARIA 2QQRA 1E61A 4CS0A 2JIRA 1I3QA 4QIWA 1KQGA 1E18A 3FPUA 3OUGA 3GTQA 2A6HD 2KY9A 2G6GA 1PQFA 2IV2X 4KO8A 5D6YA 3GTJA 3HU2A 2YUJA 3QWZA 2KI8A 4AS1A 5FTLA 2JIPA 2PI8A 5CD1A 2DMRA 2XDPA 1TMOA 3IR5A 1EU1A 3O5AA 2O5JD 1I9GA 3FPRA 3ML1A 3LHDA 4AQ7A 5ERGB 2NAPA 2CW0D 1K83A 2JA5A 4GA5A 1CR5A 5D6WA 1WLFA 2BE5D 1H5NA 5CCBA 2E7ZA 5C1BA 5C18A 3HKZA 1SIWA 2A69D 4AZDA 3IR7A 3LGAA 3PLXB 2MM2A 4KDLA 1IW7D 2G5DA 1YNJD 2JA7A 1PQHA 2JA6A 2JIMA 1DMSA 1TWFA 1Y1WA 2PNWA 1E5VA 2Y0SA 1CZ4A 1QCSA 1Y1VA 3QC8A 1I50A 2VPWA 4CRZA 1AA6A 2MM0A 2YVLA 2VUMA 3GTKA 4AONB 2JV2A 3ZJUA 3H0GA 3TIWA 2PWYA 5T5MD 1TWCA 1AW8B 2A6ED 2LW6A 4C2MA 5GLFA 1SMYD 2NVXA 2GAEA 4D7ZB 1YNND 5T5ID 2E2IA 1G8JA 4KLNA 1DMRA 4NOHA 4AYBA 1SFOA 2Q1AX 2PICA 3FKIA 3HU1A 3BQBA 4KODA 2Q19X 3GTOA 1WCMA 2JIQA 3GTLA 2R92A 1QDNA 2AE0X 1FDOA 1YLEA 1TWGA 2WB1A 3CZBA 1ZC1A 4AOKB 2V45A 1PT1A 2A68D 3MB5A 2C45A 5FTMA 5EQJB 1PPYA 5EPPA 3TM7B 2V3VA 1OGYA 1PT0A 3GTMA 1Q16A 1R27A 2B63A 2Q18X 3CF2A 5DYIA 5CCXA 3ZJTA 2NYAA 3HU3A 4DMRA 1R7RA 4GA6A 3ZGZA 3QQ8A 1CZ5A 2PMZA 1Y5IA 3GTGA 2NVYA 5DYGA 5B6CA 2EEOB 2R93A 2E2HA 2VPXA 4CRYG 5FTJA 4ARCA 2VPYA 1O54A 5D6XA 4FIBA 2PJJA 2Q1CX 5FTNA 2VPZA 1KQFA 1E32A 4UC4A 1G8KA 1E60A 2YU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQE A;  3IR6 A;  3QQ7 A;  1TWA A;  1R9T A;  2JIO A;  3CQZ A;  4KDI A;  1H0H A;  1FDI A;  2R7Z A;  3DMR A;  1PYQ A;  1PYU B;  1Y4Z A;  1UHD A;  2PJH B;  1TWH A;  4RV0 A;  1UHE A;  4AAY A;  3GTP A;  1S3S A;  1VC3 B;  5FTK A;  1E61 A;  4CS0 A;  2JIR A;  1I3Q A;  4QIW A;  1KQG A;  1E18 A;  3OUG A;  3GTQ A;  1PQF A;  2IV2 X;  4KO8 A;  3GTJ A;  3HU2 A;  2YUJ A;  3QWZ A;  2KI8 A;  5FTL A;  2JIP A;  2DMR A;  1TMO A;  3IR5 A;  1EU1 A;  3O5A A;  3ML1 A;  2NAP A;  1K83 A;  2JA5 A;  4GA5 A;  1CR5 A;  1WLF A;  1H5N A;  2E7Z A;  5C1B A;  5C18 A;  3HKZ A;  1SIW A;  4AZD A;  3IR7 A;  3PLX B;  4KDL A;  1IW7 D;  2JA6 A;  2JA7 A;  1PQH A;  2JIM A;  1DMS A;  1TWF A;  1Y1W A;  1E5V A;  2Y0S A;  1CZ4 A;  1QCS A;  1Y1V A;  3QC8 A;  1I50 A;  2VPW A;  4CRZ A;  1AA6 A;  2VUM A;  3GTK A;  4AON B;  2JV2 A;  3H0G A;  3TIW A;  5T5M D;  1TWC A;  1AW8 B;  4C2M A;  5GLF A;  2NVX A;  4D7Z B;  1G8K A;  5T5I D;  2E2I A;  1G8J A;  4KLN A;  1DMR A;  4AYB A;  1SFO A;  3FKI A;  3HU1 A;  4KOD A;  3GTO A;  1WCM A;  2JIQ A;  3GTL A;  2R92 A;  1QDN A;  1FDO A;  1YLE A;  1TWG A;  2WB1 A;  4AOK B;  1ZC1 A;  2V45 A;  1PT1 A;  2C45 A;  5FTM A;  1PPY A;  5EPP A;  3TM7 B;  2V3V A;  1OGY A;  1PT0 A;  3GTM A;  1Q16 A;  1R27 A;  2B63 A;  3CF2 A;  5DYI A;  2NYA A;  3HU3 A;  4DMR A;  1R7R A;  4GA6 A;  3QQ8 A;  1CZ5 A;  2PMZ A;  1Y5I A;  3GTG A;  2NVY A;  5DYG A;  5B6C A;  2EEO B;  2R93 A;  2E2H A;  2VPX A;  4CRY G;  5FTJ A;  2VPY A;  5FTN A;  2VPZ A;  1KQF A;  1E32 A;  2WAQ A;  1E60 A;  2YU9 A; 
#chains in the Genus database with same CATH topology
 1PQE A;  3IR6 A;  3QQ7 A;  2GF7 A;  2B25 A;  2QQS A;  1BW3 A;  1TWA A;  1R9T A;  2WAQ A;  2Q1D X;  2JIO A;  3CQZ A;  4KDI A;  3ZJV A;  1H0H A;  1OA7 A;  3FPT A;  1FDI A;  2R7Z A;  3DMR A;  1PYQ A;  1Y4Z A;  1N10 A;  1PYU B;  1UHD A;  2PJH B;  1HD5 A;  2GFA A;  1TWH A;  4RV0 A;  1UHE A;  4AAY A;  3GTP A;  4CQN A;  1S3S A;  1VC3 B;  1ZYR D;  1WC2 A;  5FTK A;  4FER A;  3X2K A;  4ARI A;  2QQR A;  1E61 A;  4FFT A;  3X2H A;  4CS0 A;  2JIR A;  1I3Q A;  4QIW A;  1KQG A;  1E18 A;  3FPU A;  3OUG A;  3GTQ A;  2A6H D;  2KY9 A;  2G6G A;  2BH0 A;  1PQF A;  2IV2 X;  4KO8 A;  5D6Y A;  5H4U A;  3GTJ A;  3HU2 A;  2YUJ A;  3QWZ A;  2HCZ X;  2KI8 A;  4AS1 A;  5FTL A;  4FG2 A;  2KQA A;  2JIP A;  2PI8 A;  5CD1 A;  2DMR A;  2XDP A;  1L8F A;  1TMO A;  3IR5 A;  1EU1 A;  3O5A A;  5GM9 A;  4ZM7 A;  2O5J D;  3ML1 A;  1I9G A;  3FPR A;  3LHD A;  5ERG B;  4AQ7 A;  2NAP A;  2CW0 D;  1K83 A;  2JA5 A;  4GA5 A;  1CR5 A;  5D6W A;  1WLF A;  2BE5 D;  1H5N A;  5CCB A;  2E7Z A;  5C1B A;  5C18 A;  3HKZ A;  1SIW A;  2A69 D;  3X2I A;  4AZD A;  3IR7 A;  3X2M A;  3LGA A;  3PLX B;  3X2J A;  2MM2 A;  4JJO A;  4JP6 A;  4KDL A;  1IW7 D;  2G5D A;  1YNJ D;  2JA7 A;  1PQH A;  4L48 A;  2JA6 A;  2JIM A;  1DMS A;  1TWF A;  1Y1W A;  2ENG A;  2PNW A;  1E5V A;  2Y0S A;  1CZ4 A;  1QCS A;  1Y1V A;  3QC8 A;  1I50 A;  2VPW A;  4CRZ A;  4JS7 A;  3SUJ A;  1AA6 A;  2MM0 A;  2YVL A;  5GLY A;  2VUM A;  3GTK A;  4AON B;  2JV2 A;  3ZJU A;  3H0G A;  3TIW A;  2PWY A;  5T5M D;  1TWC A;  1AW8 B;  2A6E D;  2LW6 A;  3ENG A;  5GLF A;  4C2M A;  1SMY D;  3X2O A;  2NVX A;  2GAE A;  4D7Z B;  1YNN D;  5T5I D;  2E2I A;  1G8J A;  4KLN A;  1DMR A;  1BW4 A;  4NOH A;  4AYB A;  1SFO A;  3SUM A;  2Q1A X;  2PIC A;  4FG4 A;  3FKI A;  4JP7 A;  3HU1 A;  4JCW A;  3BQB A;  4KOD A;  2Q19 X;  3GTO A;  1WCM A;  2JIQ A;  3GTL A;  4ENG A;  2R92 A;  3SUK A;  1QDN A;  3SUL A;  2AE0 X;  1FDO A;  1YLE A;  1TWG A;  1OA9 A;  2WB1 A;  1ZC1 A;  3CZB A;  5GLX A;  2V45 A;  4AOK B;  1PT1 A;  2A68 D;  3MB5 A;  2C45 A;  5FTM A;  5EQJ B;  1PPY A;  5EPP A;  3TM7 B;  2V3V A;  3X2L A;  1OGY A;  1PT0 A;  3GTM A;  1Q16 A;  1R27 A;  2B63 A;  2Q18 X;  3CF2 A;  5DYI A;  5CCX A;  3ZJT A;  2NYA A;  3HU3 A;  3X2G A;  4DMR A;  1R7R A;  4GA6 A;  3M3G A;  3QQ8 A;  1CZ5 A;  3ZGZ A;  2PMZ A;  1Y5I A;  3GTG A;  3D30 A;  2NVY A;  5DYG A;  5B6C A;  2EEO B;  2R93 A;  3X2P A;  2E2H A;  2VPX A;  4AVR A;  3X2N A;  4CRY G;  5FTJ A;  4ARC A;  2VPY A;  1O54 A;  5D6X A;  4FIB A;  2PJJ A;  2Q1C X;  5FTN A;  2VPZ A;  1KQF A;  1E32 A;  4UC4 A;  1G8K A;  1E60 A;  2YU9 A; 
#chains in the Genus database with same CATH homology
 1PQE A;  3IR6 A;  3QQ7 A;  2GF7 A;  2B25 A;  2QQS A;  1TWA A;  1R9T A;  2WAQ A;  2Q1D X;  2JIO A;  3CQZ A;  4KDI A;  3ZJV A;  1H0H A;  3FPT A;  1FDI A;  2R7Z A;  3DMR A;  1PYQ A;  1Y4Z A;  1PYU B;  1UHD A;  2PJH B;  2GFA A;  1TWH A;  4RV0 A;  1UHE A;  4AAY A;  3GTP A;  4CQN A;  1S3S A;  1VC3 B;  1ZYR D;  5FTK A;  4ARI A;  2QQR A;  1E61 A;  4CS0 A;  2JIR A;  1I3Q A;  4QIW A;  1KQG A;  1E18 A;  3FPU A;  3OUG A;  3GTQ A;  2A6H D;  2KY9 A;  2G6G A;  1PQF A;  2IV2 X;  4KO8 A;  5D6Y A;  3GTJ A;  3HU2 A;  2YUJ A;  3QWZ A;  2KI8 A;  4AS1 A;  5FTL A;  2JIP A;  2PI8 A;  5CD1 A;  2DMR A;  2XDP A;  1TMO A;  3IR5 A;  1EU1 A;  3O5A A;  2O5J D;  1I9G A;  3FPR A;  3ML1 A;  3LHD A;  4AQ7 A;  5ERG B;  2NAP A;  2CW0 D;  1K83 A;  2JA5 A;  4GA5 A;  1CR5 A;  5D6W A;  1WLF A;  2BE5 D;  1H5N A;  5CCB A;  2E7Z A;  5C1B A;  5C18 A;  3HKZ A;  1SIW A;  2A69 D;  4AZD A;  3IR7 A;  3LGA A;  3PLX B;  2MM2 A;  4KDL A;  1IW7 D;  2G5D A;  1YNJ D;  2JA7 A;  1PQH A;  2JA6 A;  2JIM A;  1DMS A;  1TWF A;  1Y1W A;  2PNW A;  1E5V A;  2Y0S A;  1CZ4 A;  1QCS A;  1Y1V A;  3QC8 A;  1I50 A;  2VPW A;  4CRZ A;  1AA6 A;  2MM0 A;  2YVL A;  2VUM A;  3GTK A;  4AON B;  2JV2 A;  3ZJU A;  3H0G A;  3TIW A;  2PWY A;  5T5M D;  1TWC A;  1AW8 B;  2A6E D;  2LW6 A;  4C2M A;  5GLF A;  1SMY D;  2NVX A;  2GAE A;  4D7Z B;  1YNN D;  5T5I D;  2E2I A;  1G8J A;  4KLN A;  1DMR A;  4NOH A;  4AYB A;  1SFO A;  2Q1A X;  2PIC A;  3FKI A;  3HU1 A;  3BQB A;  4KOD A;  2Q19 X;  3GTO A;  1WCM A;  2JIQ A;  3GTL A;  2R92 A;  1QDN A;  2AE0 X;  1FDO A;  1YLE A;  1TWG A;  2WB1 A;  3CZB A;  1ZC1 A;  4AOK B;  2V45 A;  1PT1 A;  2A68 D;  3MB5 A;  2C45 A;  5FTM A;  5EQJ B;  1PPY A;  5EPP A;  3TM7 B;  2V3V A;  1OGY A;  1PT0 A;  3GTM A;  1Q16 A;  1R27 A;  2B63 A;  2Q18 X;  3CF2 A;  5DYI A;  5CCX A;  3ZJT A;  2NYA A;  3HU3 A;  4DMR A;  1R7R A;  4GA6 A;  3ZGZ A;  3QQ8 A;  1CZ5 A;  2PMZ A;  1Y5I A;  3GTG A;  2NVY A;  5DYG A;  5B6C A;  2EEO B;  2R93 A;  2E2H A;  2VPX A;  4CRY G;  5FTJ A;  4ARC A;  2VPY A;  1O54 A;  5D6X A;  4FIB A;  2PJJ A;  2Q1C X;  5FTN A;  2VPZ A;  1KQF A;  1E32 A;  4UC4 A;  1G8K A;  1E60 A;  2YU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...