1BPRA

Nmr structure of the substrate binding domain of dnak, minimized average structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
173
structure length
173
Chain Sequence
SIEGRVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNAK
publication title NMR solution structure of the 21 kDa chaperone protein DnaK substrate binding domain: a preview of chaperone-protein interaction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Molecular chaperone
total genus 17
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 1998-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1bprA00
4EZSA 7HSCA 1DKZA 4R5KA 4JWIA 3D2FA 1Q5LA 3DPQA 1BPRA 4EZUA 3C7NA 2KHOA 5TKYA 4R5IA 1CKRA 2OP6A 4R5JA 4WV7A 1DKYA 3N8EA 1U00A 4B9QA 4EZTA 4JNEA 4EZXA 4EZQA 3DQGA 4JWEA 4JWDA 1YUWA 4JWCA 4WV5A 4EZWA 3H0XA 5E84A 3DOBA 1DG4A 4JNFA 2V7YA 4HYBA 2QXLA 1DKXA 4F00A 4R5GA 4EZOA 4EZVA 4JN4A 2BPRA 4E81A 4EZZA 3D2EA 3QNJA 4R5LA 4EZYA 4EZPA 4PO2A 4FL9A 4HY9A 4EZRA 3DPOA 3C7NB 4EZNA 4F01A 3DPPA
chains in the Genus database with same CATH superfamily
4EZSA 7HSCA 1DKZA 4R5KA 4JWIA 3D2FA 1Q5LA 3DPQA 1BPRA 3SBTB 3ZEFA 3C7NA 4EZUA 4ILIA 2KHOA 4ILHB 4R5IA 5TKYA 1CKRA 2OP6A 4R5JA 4WV7A 1DKYA 3N8EA 1U00A 4ILGA 4B9QA 4EZTA 4JNEA 4EZXA 4EZQA 3DQGA 4JWEA 3SBSA 4I43A 4JWDA 1YUWA 4JWCA 4WV5A 4EZWA 3H0XA 5E84A 3DOBA 1DG4A 4JNFA 2V7YA 4MQDA 4HYBA 2QXLA 1DKXA 4F00A 4R5GA 4EZOA 4EZVA 4JN4A 2BPRA 4E81A 4EZZA 3D2EA 3QNJA 4R5LA 4EZYA 4EZPA 4PO2A 4FL9A 4HY9A 4EZRA 3DPOA 3C7NB 4EZNA 4F01A 3DPPA
chains in the Genus database with same CATH topology
4EZSA 7HSCA 1DKZA 4R5KA 4JWIA 3D2FA 1Q5LA 3DPQA 1BPRA 3SBTB 3ZEFA 3C7NA 4EZUA 4ILIA 2KHOA 4ILHB 4R5IA 5TKYA 1CKRA 2OP6A 4R5JA 4WV7A 1DKYA 3N8EA 1U00A 4ILGA 4B9QA 4EZTA 4JNEA 4EZXA 4EZQA 3DQGA 4JWEA 3SBSA 4I43A 4JWDA 1YUWA 4JWCA 4WV5A 4EZWA 3H0XA 5E84A 3DOBA 1DG4A 4JNFA 2V7YA 4MQDA 4HYBA 2QXLA 1DKXA 4F00A 4R5GA 4EZOA 4EZVA 4JN4A 2BPRA 4E81A 4EZZA 3D2EA 3QNJA 4R5LA 4EZYA 4EZPA 4PO2A 4FL9A 4HY9A 4EZRA 3DPOA 3C7NB 4EZNA 4F01A 3DPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZS A;  7HSC A;  1DKZ A;  4R5K A;  4JWI A;  3D2F A;  1Q5L A;  3DPQ A;  1BPR A;  4EZU A;  3C7N A;  2KHO A;  5TKY A;  4R5I A;  1CKR A;  2OP6 A;  4R5J A;  4WV7 A;  1DKY A;  3N8E A;  1U00 A;  4B9Q A;  4EZT A;  4JNE A;  4EZX A;  4EZQ A;  3DQG A;  4JWE A;  4JWD A;  1YUW A;  4JWC A;  4WV5 A;  4EZW A;  3H0X A;  5E84 A;  3DOB A;  1DG4 A;  4JNF A;  2V7Y A;  4HYB A;  2QXL A;  1DKX A;  4F00 A;  4R5G A;  4EZO A;  4EZV A;  4JN4 A;  2BPR A;  4E81 A;  4EZZ A;  3D2E A;  3QNJ A;  4R5L A;  4EZY A;  4EZP A;  4PO2 A;  4FL9 A;  4HY9 A;  4EZR A;  3DPO A;  3C7N B;  4EZN A;  4F01 A;  3DPP A; 
#chains in the Genus database with same CATH topology
 4EZS A;  7HSC A;  1DKZ A;  4R5K A;  4JWI A;  3D2F A;  1Q5L A;  3DPQ A;  1BPR A;  3SBT B;  3ZEF A;  3C7N A;  4EZU A;  4ILI A;  2KHO A;  4ILH B;  4R5I A;  5TKY A;  1CKR A;  2OP6 A;  4R5J A;  4WV7 A;  1DKY A;  3N8E A;  1U00 A;  4ILG A;  4B9Q A;  4EZT A;  4JNE A;  4EZX A;  4EZQ A;  3DQG A;  4JWE A;  3SBS A;  4I43 A;  4JWD A;  1YUW A;  4JWC A;  4WV5 A;  4EZW A;  3H0X A;  5E84 A;  3DOB A;  1DG4 A;  4JNF A;  2V7Y A;  4MQD A;  4HYB A;  2QXL A;  1DKX A;  4F00 A;  4R5G A;  4EZO A;  4EZV A;  4JN4 A;  2BPR A;  4E81 A;  4EZZ A;  3D2E A;  3QNJ A;  4R5L A;  4EZY A;  4EZP A;  4PO2 A;  4FL9 A;  4HY9 A;  4EZR A;  3DPO A;  3C7N B;  4EZN A;  4F01 A;  3DPP A; 
#chains in the Genus database with same CATH homology
 4EZS A;  7HSC A;  1DKZ A;  4R5K A;  4JWI A;  3D2F A;  1Q5L A;  3DPQ A;  1BPR A;  3SBT B;  3ZEF A;  3C7N A;  4EZU A;  4ILI A;  2KHO A;  4ILH B;  4R5I A;  5TKY A;  1CKR A;  2OP6 A;  4R5J A;  4WV7 A;  1DKY A;  3N8E A;  1U00 A;  4ILG A;  4B9Q A;  4EZT A;  4JNE A;  4EZX A;  4EZQ A;  3DQG A;  4JWE A;  3SBS A;  4I43 A;  4JWD A;  1YUW A;  4JWC A;  4WV5 A;  4EZW A;  3H0X A;  5E84 A;  3DOB A;  1DG4 A;  4JNF A;  2V7Y A;  4MQD A;  4HYB A;  2QXL A;  1DKX A;  4F00 A;  4R5G A;  4EZO A;  4EZV A;  4JN4 A;  2BPR A;  4E81 A;  4EZZ A;  3D2E A;  3QNJ A;  4R5L A;  4EZY A;  4EZP A;  4PO2 A;  4FL9 A;  4HY9 A;  4EZR A;  3DPO A;  3C7N B;  4EZN A;  4F01 A;  3DPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...