4EZNA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4eznA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4eznA01
3T4AG 3L3OM 4WV7A 4EZZA 3DPOA 4JWDA 4JWEA 3T48A 4EZNA 4EZTA 4EZRA 3DOBA 4JN4A 3T49A 3N8EA 1DG4A 5E84A 4EZPA 4EZOA 4R5GA 2V7YA 4EZUA 4JNFA 1U00A 4EZQA 4E81A 3DQGA 2KHOA 2WINM 7HSCA 1CKRA 4HYBA 1Q5LA 3D2EA 3C7NB 4EZVA 3C7NA 2BPRA 2QXLA 4PO2A 4WV5A 1DKXA 4FL9A 2OP6A 4F00A 4H6HA 4R5LA 1YUWA 3D2FA 4B9QA 4EZXA 2QFFA 3T47A 4F01A 4HY9A 4EZWA 4R5KA 4R5IA 5TKYA 4EZSA 3DPPA 4JNEA 1DKZA 3OHXM 4R5JA 1DKYA 4H6IA 3DPQA 1BPRA 3QNJA 4EZYA 3H0XA 4JWIA 3T46A 4JWCA
chains in the Genus database with same CATH superfamily
3I01A 2D1LA 2MI7A 1SU8A 3EJUA 3BUPA 1I4LA 2F7QA 3DX0A 1U00A 3VEBA 4FZOA 2WINM 1OA1A 3DDGA 2BPRA 2OP6A 1I49A 4NPHA 3CV5A 4F01A 3PLTA 4FM3A 4H6IA 2X3WA 4FZPA 1GNLA 3DX3A 4JWCA 1Y2OA 3N8EA 4EZPA 3RPMA 2Z0NA 4JNFA 3DQGA 4IM2A 2WYHA 3D51A 4HR1B 3RV0A 3F7WA 1E1DA 3QA8A 3DX1A 3SOGA 4AZCB 2YKTA 4JWIA 1TQSA 3EJRA 4AZHA 3LVTA 3T48A 2GA9D 1TQTA 1QX1A 1HWWA 1R34A 3CAZA 4HR1A 1OAOA 2JNKA 4EZSA 2YLAA 4AZCA 2V0OA 3DPQA 3B51X 1OA0A 2F7PA 3BVWA 3BUBA 5FIGA 2ND0A 1MJGA 1DKXA 3KDRA 4FL9A 4EZXA 4IWOA 4M0MA 4DYLA 4BNEA 3T46A 4WV7A 4D8JA 2GF4A 5E84A 4EZOA 1TQVA 2OW6A 1WDZA 2WYIA 1X03A 1LQ7A 4JLCA 4IWPA 2YL5A 3L3PA 1I4TA 3QE6A 1O7DC 3DDFA 3ER8C 3DYTA 1DG4A 1SU7A 4DCNC 3CKDA 3EJSA 4AZGA 3SBTB 4IM3A 2QXLA 3BVVA 2YI8A 3ABHA 3ER9B 3ZEFA 1R33A 3HAHA 2YIAA 3DPPA 3FD9A 4R5LA 4FZSA 2EWFA 2ELBA 3OWGA 4UDYX 2EFKA 3BVUA 4NQIA 2OBMA 3A98A 3I39X 3QWEA 3ZEDA 3RV1A 2Z0VA 2F1AA 3T47A 3B52X 5KBPA 5TKYA 4I43A 2F7OA 4UDXX 3KAWA 4AVMA 2ZXQA 2RAIA 1PS3A 3D4ZA 4IWQA 2F7RA 3T49A 2YL9A 2YLLA 2YIVX 4EZQA 2KHOA 1UPXA 2Q13A 4WV5A 3QNIA 4G6QA 1ZYLA 4KIKB 4R5IA 3VEAA 3H0XA 3SBSA 4B9QA 1JQKA 1ZWWA 2X3VA 2FYVA 2LXYA 1TQWA 4ILGA 3D50A 4IM0A 3BUQA 4HY9A 4KIKA 1BPRA 1HXKA 2YI9A 4EZZA 4AZ7A 4EZTA 2F1BA 2YL8A 4JN4A 3ACOA 3LMFA 1GNTA 5C5BB 2LM0A 4ILIA 1R5EA 1E9VA 4WPEA 2OW7A 4HYBA 2D4CA 3BVTA 3Q84A 2EFLA 4I1QA 1I4DA 1YWMA 2OO2A 4ATMA 4AZ5A 2RAKA 3LLLA 3BUDA 4ILHB 2PY6A 5C5BA 3O3OB 4WPCA 2O0I1 2PMRA 3D2FA 2QFFA 3G9GA 3DX4A 2F18A 4EZWA 1URUA 3T4AG 3EJQA 4JWDA 2Z8YA 3UITA 3D52A 1GN9A 3CZNA 2JNSA 3CZSA 2YL6A 4PO2A 3OK8A 5FLEX 3SYVA 3O3NB 2N3KA 3CVRA 4R5KA 4E3CA 3D4YA 4AZ6A 2Q12A 1TQUA 4E81A 1Q5LA 3D2EA 3ERCC 2EX3B 1E2UA 4MQDA 2OZNB 4R5JA 4AZBA 3BVXA 4NSWA 3DPOA 4EZRA 4JWEA 2V7YA 3HAJA 4H8SA 4AZIA 2X5CA 3HAIA 2RAJA 4JNEA 2QKWA 3QNJA 4EZYA 2C08A 3GI7A 3DX2A 4EZNA 3EJTA 2OBLA 1QWNA 2GAFD 4AKVA 7HSCA 1CKRA 1HTYA 3B53X 3C7NB 4EZVA 2ND1A 4JL9A 4H6HA 2ALWA 2Z0OA 2YIBA 1W9MA 2RT6A 3I2WA 4IW0A 3DOBA 2NCZA 3EJPA 3KAVA 3L3OM 1O7DB 4R5GA 4EZUA 1X04A 2FICA 1SUFA 3O3MB 3C7NA 1QWUA 3BUIA 2X3XA 3BLBA 4F00A 1YUWA 1SU6A 3M3WA 1DKZA 3OHXM 1DKYA 3I04A 3VKHA 3Q0KA
chains in the Genus database with same CATH topology
4WV7A 3I01A 4D8JA 1SU8A 5E84A 4EZOA 1U00A 3VEBA 4E81A 4ILGA 2WINM 1OA1A 1Q5LA 3D2EA 4IM0A 2BPRA 2OP6A 3ERCC 2EX3B 1E2UA 4MQDA 4NPHA 4JLCA 4IWPA 4F01A 4HY9A 4KIKA 4FM3A 4R5JA 4H6IA 1BPRA 1GNLA 4JWCA 2YI9A 4EZZA 3DPOA 4EZTA 4JWEA 4EZRA 3ER8C 4JN4A 3N8EA 1DG4A 1SU7A 3LMFA 1GNTA 4EZPA 2V7YA 2LM0A 4ILIA 1E9VA 4JNFA 4IM2A 3DQGA 4HYBA 3SBTB 4HR1B 3RV0A 4IM3A 2QXLA 2X5CA 3F7WA 2YI8A 1E1DA 3QA8A 3ER9B 3ZEFA 2YIAA 3DPPA 4JNEA 3QNJA 4EZYA 3FD9A 4JWIA 4R5LA 3GI7A 3T48A 4EZNA 2EWFA 3OWGA 4UDYX 4ILHB 2GA9D 2PY6A 2OBLA 2GAFD 3O3OB 2OBMA 7HSCA 1CKRA 3A98A 3B53X 3C7NB 4EZVA 3I39X 4HR1A 2ND1A 1OAOA 4JL9A 4H6HA 3ZEDA 3D2FA 3RV1A 2QFFA 3T47A 2YIBA 3B52X 4EZWA 4EZSA 1W9MA 5TKYA 2RT6A 4I43A 3DPQA 4IW0A 4UDXX 3KAWA 3DOBA 2NCZA 3T4AG 3KAVA 3L3OM 3B51X 4JWDA 2Z8YA 4IWQA 1OA0A 3UITA 1GN9A 3T49A 2YIVX 2JNSA 4R5GA 4EZUA 4EZQA 5FIGA 2ND0A 2KHOA 1UPXA 1MJGA 1SUFA 3O3MB 3C7NA 4PO2A 4WV5A 1DKXA 3KDRA 4G6QA 4F00A 4FL9A 5FLEX 1YUWA 1ZYLA 4EZXA 4IWOA 3O3NB 4M0MA 1SU6A 2N3KA 4KIKB 4R5KA 4R5IA 4E3CA 1DKZA 3OHXM 1DKYA 3VEAA 3I04A 3VKHA 3H0XA 3SBSA 3T46A 4B9QA 1JQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4A G;  3L3O M;  4WV7 A;  4EZZ A;  3DPO A;  4JWD A;  4JWE A;  3T48 A;  4EZN A;  4EZT A;  4EZR A;  3DOB A;  4JN4 A;  3T49 A;  3N8E A;  1DG4 A;  5E84 A;  4EZP A;  4EZO A;  4R5G A;  2V7Y A;  4EZU A;  4JNF A;  1U00 A;  4EZQ A;  4E81 A;  3DQG A;  2KHO A;  2WIN M;  7HSC A;  1CKR A;  4HYB A;  1Q5L A;  3D2E A;  3C7N B;  4EZV A;  3C7N A;  2BPR A;  2QXL A;  4PO2 A;  4WV5 A;  1DKX A;  4FL9 A;  2OP6 A;  4F00 A;  4H6H A;  4R5L A;  1YUW A;  3D2F A;  4B9Q A;  4EZX A;  2QFF A;  3T47 A;  4F01 A;  4HY9 A;  4EZW A;  4R5K A;  4R5I A;  5TKY A;  4EZS A;  3DPP A;  4JNE A;  1DKZ A;  3OHX M;  4R5J A;  1DKY A;  4H6I A;  3DPQ A;  1BPR A;  3QNJ A;  4EZY A;  3H0X A;  4JWI A;  3T46 A;  4JWC A; 
#chains in the Genus database with same CATH topology
 3I01 A;  2D1L A;  2MI7 A;  1SU8 A;  3EJU A;  3BUP A;  1I4L A;  2F7Q A;  3DX0 A;  1U00 A;  3VEB A;  4FZO A;  2WIN M;  1OA1 A;  3DDG A;  2BPR A;  2OP6 A;  1I49 A;  4NPH A;  3CV5 A;  4F01 A;  3PLT A;  4FM3 A;  4H6I A;  2X3W A;  4FZP A;  1GNL A;  3DX3 A;  4JWC A;  1Y2O A;  3N8E A;  4EZP A;  3RPM A;  2Z0N A;  4JNF A;  3DQG A;  4IM2 A;  2WYH A;  3D51 A;  4HR1 B;  3RV0 A;  3F7W A;  1E1D A;  3QA8 A;  3DX1 A;  3SOG A;  4AZC B;  2YKT A;  4JWI A;  1TQS A;  3EJR A;  4AZH A;  3LVT A;  3T48 A;  2GA9 D;  1TQT A;  1QX1 A;  1HWW A;  1R34 A;  3CAZ A;  4HR1 A;  1OAO A;  2JNK A;  4EZS A;  2YLA A;  4AZC A;  2V0O A;  3DPQ A;  3B51 X;  1OA0 A;  2F7P A;  3BVW A;  3BUB A;  5FIG A;  2ND0 A;  1MJG A;  1DKX A;  3KDR A;  4FL9 A;  4EZX A;  4IWO A;  4M0M A;  4DYL A;  4BNE A;  3T46 A;  4WV7 A;  4D8J A;  2GF4 A;  5E84 A;  4EZO A;  1TQV A;  2OW6 A;  1WDZ A;  2WYI A;  1X03 A;  1LQ7 A;  4JLC A;  4IWP A;  2YL5 A;  3L3P A;  1I4T A;  3QE6 A;  1O7D C;  3DDF A;  3ER8 C;  3DYT A;  1DG4 A;  1SU7 A;  4DCN C;  3CKD A;  3EJS A;  4AZG A;  3SBT B;  4IM3 A;  2QXL A;  3BVV A;  2YI8 A;  3ABH A;  3ER9 B;  3ZEF A;  1R33 A;  3HAH A;  2YIA A;  3DPP A;  3FD9 A;  4R5L A;  4FZS A;  2EWF A;  2ELB A;  3OWG A;  4UDY X;  2EFK A;  3BVU A;  4NQI A;  2OBM A;  3A98 A;  3I39 X;  3QWE A;  3ZED A;  3RV1 A;  2Z0V A;  2F1A A;  3T47 A;  3B52 X;  5KBP A;  5TKY A;  4I43 A;  2F7O A;  4UDX X;  3KAW A;  4AVM A;  2ZXQ A;  2RAI A;  1PS3 A;  3D4Z A;  4IWQ A;  2F7R A;  3T49 A;  2YL9 A;  2YLL A;  2YIV X;  4EZQ A;  2KHO A;  1UPX A;  2Q13 A;  4WV5 A;  3QNI A;  4G6Q A;  1ZYL A;  4KIK B;  4R5I A;  3VEA A;  3H0X A;  3SBS A;  4B9Q A;  1JQK A;  1ZWW A;  2X3V A;  2FYV A;  2LXY A;  1TQW A;  4ILG A;  3D50 A;  4IM0 A;  3BUQ A;  4HY9 A;  4KIK A;  1BPR A;  1HXK A;  2YI9 A;  4EZZ A;  4AZ7 A;  4EZT A;  2F1B A;  2YL8 A;  4JN4 A;  3ACO A;  3LMF A;  1GNT A;  5C5B B;  2LM0 A;  4ILI A;  1R5E A;  1E9V A;  4WPE A;  2OW7 A;  4HYB A;  2D4C A;  3BVT A;  3Q84 A;  2EFL A;  4I1Q A;  1I4D A;  1YWM A;  2OO2 A;  4ATM A;  4AZ5 A;  2RAK A;  3LLL A;  3BUD A;  4ILH B;  2PY6 A;  5C5B A;  3O3O B;  4WPC A;  2O0I 1;  2PMR A;  3D2F A;  2QFF A;  3G9G A;  3DX4 A;  2F18 A;  4EZW A;  1URU A;  3T4A G;  3EJQ A;  4JWD A;  2Z8Y A;  3UIT A;  3D52 A;  1GN9 A;  3CZN A;  2JNS A;  3CZS A;  2YL6 A;  4PO2 A;  3OK8 A;  5FLE X;  3SYV A;  3O3N B;  2N3K A;  3CVR A;  4R5K A;  4E3C A;  3D4Y A;  4AZ6 A;  2Q12 A;  1TQU A;  4E81 A;  1Q5L A;  3D2E A;  3ERC C;  2EX3 B;  1E2U A;  4MQD A;  2OZN B;  4R5J A;  4AZB A;  3BVX A;  4NSW A;  3DPO A;  4EZR A;  4JWE A;  2V7Y A;  3HAJ A;  4H8S A;  4AZI A;  2X5C A;  3HAI A;  2RAJ A;  4JNE A;  2QKW A;  3QNJ A;  4EZY A;  2C08 A;  3GI7 A;  3DX2 A;  4EZN A;  3EJT A;  2OBL A;  1QWN A;  2GAF D;  4AKV A;  7HSC A;  1CKR A;  1HTY A;  3B53 X;  3C7N B;  4EZV A;  2ND1 A;  4JL9 A;  4H6H A;  2ALW A;  2Z0O A;  2YIB A;  1W9M A;  2RT6 A;  3I2W A;  4IW0 A;  3DOB A;  2NCZ A;  3EJP A;  3KAV A;  3L3O M;  1O7D B;  4R5G A;  4EZU A;  1X04 A;  2FIC A;  1SUF A;  3O3M B;  3C7N A;  1QWU A;  3BUI A;  2X3X A;  3BLB A;  4F00 A;  1YUW A;  1SU6 A;  3M3W A;  1DKZ A;  3OHX M;  1DKY A;  3I04 A;  3VKH A;  3Q0K A; 
#chains in the Genus database with same CATH homology
 4WV7 A;  3I01 A;  4D8J A;  1SU8 A;  5E84 A;  4EZO A;  1U00 A;  3VEB A;  4E81 A;  4ILG A;  2WIN M;  1OA1 A;  1Q5L A;  3D2E A;  4IM0 A;  2BPR A;  2OP6 A;  3ERC C;  2EX3 B;  1E2U A;  4MQD A;  4NPH A;  4JLC A;  4IWP A;  4F01 A;  4HY9 A;  4KIK A;  4FM3 A;  4R5J A;  4H6I A;  1BPR A;  1GNL A;  4JWC A;  2YI9 A;  4EZZ A;  3DPO A;  4EZT A;  4JWE A;  4EZR A;  3ER8 C;  4JN4 A;  3N8E A;  1DG4 A;  1SU7 A;  3LMF A;  1GNT A;  4EZP A;  2V7Y A;  2LM0 A;  4ILI A;  1E9V A;  4JNF A;  4IM2 A;  3DQG A;  4HYB A;  3SBT B;  4HR1 B;  3RV0 A;  4IM3 A;  2QXL A;  2X5C A;  3F7W A;  2YI8 A;  1E1D A;  3QA8 A;  3ER9 B;  3ZEF A;  2YIA A;  3DPP A;  4JNE A;  3QNJ A;  4EZY A;  3FD9 A;  4JWI A;  4R5L A;  3GI7 A;  3T48 A;  4EZN A;  2EWF A;  3OWG A;  4UDY X;  4ILH B;  2GA9 D;  2PY6 A;  2OBL A;  2GAF D;  3O3O B;  2OBM A;  7HSC A;  1CKR A;  3A98 A;  3B53 X;  3C7N B;  4EZV A;  3I39 X;  4HR1 A;  2ND1 A;  1OAO A;  4JL9 A;  4H6H A;  3ZED A;  3D2F A;  3RV1 A;  2QFF A;  3T47 A;  2YIB A;  3B52 X;  4EZW A;  4EZS A;  1W9M A;  5TKY A;  2RT6 A;  4I43 A;  3DPQ A;  4IW0 A;  4UDX X;  3KAW A;  3DOB A;  2NCZ A;  3T4A G;  3KAV A;  3L3O M;  3B51 X;  4JWD A;  2Z8Y A;  4IWQ A;  1OA0 A;  3UIT A;  1GN9 A;  3T49 A;  2YIV X;  2JNS A;  4R5G A;  4EZU A;  4EZQ A;  5FIG A;  2ND0 A;  2KHO A;  1UPX A;  1MJG A;  1SUF A;  3O3M B;  3C7N A;  4PO2 A;  4WV5 A;  1DKX A;  3KDR A;  4G6Q A;  4F00 A;  4FL9 A;  5FLE X;  1YUW A;  1ZYL A;  4EZX A;  4IWO A;  3O3N B;  4M0M A;  1SU6 A;  2N3K A;  4KIK B;  4R5K A;  4R5I A;  4E3C A;  1DKZ A;  3OHX M;  1DKY A;  3VEA A;  3I04 A;  3VKH A;  3H0X A;  3SBS A;  3T46 A;  4B9Q A;  1JQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...