4EZNA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 60
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4eznA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4eznA01
2QFFA 1U00A 3OHXM 4HYBA 2V7YA 2BPRA 4FL9A 4H6HA 3DOBA 4JWDA 4HY9A 4EZSA 3T4AG 7HSCA 5TKYA 2QXLA 1Q5LA 3DPPA 4E81A 4EZVA 4EZPA 4EZOA 4EZRA 4WV7A 4JWCA 4EZTA 2OP6A 1DG4A 1YUWA 3C7NB 4H6IA 4EZZA 4EZNA 4JWIA 3DPOA 4PO2A 3T49A 3D2EA 1CKRA 3L3OM 3C7NA 4R5JA 3T48A 4EZUA 4EZXA 4B9QA 4JWEA 3DPQA 5E84A 4R5LA 4WV5A 2KHOA 2WINM 4JNEA 4R5GA 4EZYA 1DKYA 3N8EA 4F01A 4F00A 4JN4A 3T46A 4R5IA 4EZWA 3D2FA 4R5KA 3H0XA 3T47A 3QNJA 4EZQA 1BPRA 1DKXA 3DQGA 1DKZA 4JNFA
chains in the Genus database with same CATH superfamily
2N3KA 2EFKA 4HYBA 3DX3A 1Q5LA 3RV1A 3KAVA 3QE6A 1TQSA 2D1LA 4B9QA 4D8JA 4EZYA 3ACOA 5C5BA 3D51A 4IM0A 4JN4A 2Z8YA 4IWQA 1BPRA 2YL6A 1DKZA 2YI8A 2YLAA 4FL9A 1SU8A 3BVTA 3BUBA 4AZIA 4EZUA 4EZXA 1R5EA 4WV5A 2OW6A 4JNEA 3N8EA 1R34A 4EZZA 2YIBA 1LQ7A 4I1QA 4AZ5A 4ILIA 4AZCB 1O7DB 4FZOA 1WDZA 3SYVA 2JNKA 4PO2A 3L3OM 4ILHB 1JQKA 3EJPA 3DDFA 3DOBA 3T4AG 2OW7A 3DPPA 2RAJA 2X3WA 4E3CA 2GAFD 5E84A 3T47A 4WPEA 4EZQA 1HWWA 4AVMA 3CKDA 4JNFA 4G6QA 3BUQA 1QWNA 2OBLA 4EZPA 3VKHA 3BUDA 4UDYX 3QNIA 3C7NB 2Q13A 2RAIA 3DPOA 2F1BA 3D2EA 2YL8A 1OAOA 4AZHA 1E2UA 1I4DA 1PS3A 3LVTA 1ZYLA 2WYIA 3KAWA 2MI7A 3G9GA 2QFFA 1U00A 2V7YA 4NPHA 4AKVA 2F7QA 4E81A 1HTYA 3ER9B 2LM0A 2ELBA 1DG4A 3EJSA 2NCZA 3T49A 2O0I1 3DX0A 2KHOA 4R5GA 3DX4A 3B52X 3ERCC 3I01A 1TQTA 3I2WA 3DDGA 3D2FA 2C08A 3VEAA 2F18A 3SBSA 3RPMA 3Q0KA 2F7RA 5FLEX 4R5JA 2PMRA 4JWEA 3DPQA 3EJTA 2EWFA 1X03A 4BNEA 3H0XA 3A98A 1DKXA 3ABHA 4H6HA 1OA1A 4AZCA 3BVXA 3B53X 4IWOA 3HAIA 3I04A 1I4LA 1E1DA 2EX3B 3DQGA 1R33A 1I49A 1W9MA 4JWDA 2OO2A 2ZXQA 3DX1A 2RAKA 4KIKB 4KIKA 2Z0OA 4JWCA 2OP6A 2OZNB 4H6IA 3HAJA 4M0MA 4MQDA 3Q84A 2GA9D 4AZGA 4JL9A 4F01A 1SUFA 1URUA 2FYVA 3ZEFA 3FD9A 4R5KA 3D50A 4WV7A 2YIAA 3O3OB 4EZRA 4EZOA 4H8SA 2ALWA 2FICA 1X04A 3C7NA 1QWUA 2RT6A 3QWEA 2QKWA 3L3PA 2EFLA 1O7DC 3CAZA 3EJRA 2Z0NA 2WYHA 3ER8C 2Q12A 5TKYA 3ZEDA 4UDXX 3RV0A 3O3MB 3SBTB 1Y2OA 3B51X 1ZWWA 3QA8A 1GNLA 3M3WA 4FZSA 2PY6A 3D4ZA 3HAHA 3LMFA 3OHXM 4HR1B 1E9VA 1I4TA 1YWMA 4HR1A 4EZSA 3CZSA 4EZVA 4IM2A 3GI7A 4I43A 2YKTA 5C5BB 2V0OA 4F00A 1TQVA 3BVWA 4FZPA 1SU7A 4NSWA 1UPXA 2F7OA 2YI9A 3BVUA 3BUIA 4IWPA 1GN9A 3DYTA 4IM3A 4EZNA 4JWIA 1TQUA 2YL5A 3T48A 3EJUA 4DCNC 1DKYA 2YLLA 3T46A 3BVVA 4EZWA 3OK8A 3QNJA 1YUWA 5FIGA 4HY9A 7HSCA 4ATMA 2QXLA 1HXKA 4EZTA 4NQIA 1SU6A 3I39X 4IW0A 2X5CA 2X3VA 3PLTA 4ILGA 4R5IA 2OBMA 1OA0A 3OWGA 3BLBA 2JNSA 4AZ6A 4WPCA 3BUPA 3CZNA 2ND1A 3D52A 3UITA 2D4CA 4AZBA 1TQWA 4R5LA 2WINM 5KBPA 3O3NB 3VEBA 1QX1A 2GF4A 2LXYA 1GNTA 4JLCA 2BPRA 1MJGA 3KDRA 2F1AA 4DYLA 3SOGA 2X3XA 3CV5A 2Z0VA 1CKRA 2F7PA 2ND0A 3D4YA 4FM3A 2YIVX 3EJQA 3CVRA 2YL9A 3LLLA 4AZ7A 3F7WA 3DX2A
chains in the Genus database with same CATH topology
4G6QA 2N3KA 4HYBA 1UPXA 1W9MA 2YI9A 3DQGA 4JWDA 4KIKB 4IWPA 1Q5LA 2OBLA 3RV1A 4KIKA 4EZPA 1GN9A 3VKHA 4JWCA 4UDYX 3KAVA 2OP6A 4IM3A 3C7NB 4H6IA 4EZNA 4JWIA 3DPOA 3D2EA 3T48A 4M0MA 4B9QA 4MQDA 4D8JA 4EZYA 2GA9D 1DKYA 4JL9A 4F01A 1SUFA 1OAOA 4IM0A 4JN4A 3T46A 3ZEFA 1E2UA 2Z8YA 3FD9A 4R5KA 4EZWA 3QNJA 4IWQA 1ZYLA 3KAWA 1BPRA 1DKZA 1YUWA 2QFFA 1U00A 2YI8A 2YIAA 4NPHA 2V7YA 5FIGA 4FL9A 4WV7A 1SU8A 4HY9A 7HSCA 2QXLA 4E81A 3O3OB 4EZRA 3ER9B 4EZOA 2LM0A 4EZTA 1DG4A 1SU6A 2NCZA 3T49A 3I39X 4IW0A 3C7NA 4EZUA 2X5CA 4EZXA 4WV5A 2KHOA 4JNEA 4R5GA 3B52X 3N8EA 3ERCC 3I01A 4ILGA 2RT6A 4R5IA 3D2FA 2OBMA 1OA0A 3OWGA 4EZZA 3VEAA 2JNSA 2YIBA 3SBSA 1E1DA 3ER8C 4ILIA 5TKYA 3ZEDA 4UDXX 3RV0A 2ND1A 3UITA 5FLEX 4PO2A 3O3MB 3L3OM 4R5JA 4ILHB 3SBTB 4JWEA 3DPQA 3B51X 4R5LA 2WINM 3QA8A 2EWFA 1JQKA 1GNLA 3O3NB 3VEBA 3H0XA 3A98A 2PY6A 1DKXA 3LMFA 3OHXM 1GNTA 4HR1B 1E9VA 4JLCA 4H6HA 4HR1A 2BPRA 1MJGA 3DOBA 3KDRA 4EZSA 3T4AG 1OA1A 3DPPA 4EZVA 4IM2A 1CKRA 3GI7A 3B53X 4I43A 2ND0A 4E3CA 2GAFD 4FM3A 2YIVX 5E84A 4IWOA 3I04A 4F00A 3T47A 4EZQA 3F7WA 2EX3B 1SU7A 4JNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFF A;  1U00 A;  3OHX M;  4HYB A;  2V7Y A;  2BPR A;  4FL9 A;  4H6H A;  3DOB A;  4JWD A;  4HY9 A;  4EZS A;  3T4A G;  7HSC A;  5TKY A;  2QXL A;  1Q5L A;  3DPP A;  4E81 A;  4EZV A;  4EZP A;  4EZO A;  4EZR A;  4WV7 A;  4JWC A;  4EZT A;  2OP6 A;  1DG4 A;  1YUW A;  3C7N B;  4H6I A;  4EZZ A;  4EZN A;  4JWI A;  3DPO A;  4PO2 A;  3T49 A;  3D2E A;  1CKR A;  3L3O M;  3C7N A;  4R5J A;  3T48 A;  4EZU A;  4EZX A;  4B9Q A;  4JWE A;  3DPQ A;  5E84 A;  4R5L A;  4WV5 A;  2KHO A;  2WIN M;  4JNE A;  4R5G A;  4EZY A;  1DKY A;  3N8E A;  4F01 A;  4F00 A;  4JN4 A;  3T46 A;  4R5I A;  4EZW A;  3D2F A;  4R5K A;  3H0X A;  3T47 A;  3QNJ A;  4EZQ A;  1BPR A;  1DKX A;  3DQG A;  1DKZ A;  4JNF A; 
#chains in the Genus database with same CATH topology
 2N3K A;  2EFK A;  4HYB A;  3DX3 A;  1Q5L A;  3RV1 A;  3KAV A;  3QE6 A;  1TQS A;  2D1L A;  4B9Q A;  4D8J A;  4EZY A;  3ACO A;  5C5B A;  3D51 A;  4IM0 A;  4JN4 A;  2Z8Y A;  4IWQ A;  1BPR A;  2YL6 A;  1DKZ A;  2YI8 A;  2YLA A;  4FL9 A;  1SU8 A;  3BVT A;  3BUB A;  4AZI A;  4EZU A;  4EZX A;  1R5E A;  4WV5 A;  2OW6 A;  4JNE A;  3N8E A;  1R34 A;  4EZZ A;  2YIB A;  1LQ7 A;  4I1Q A;  4AZ5 A;  4ILI A;  4AZC B;  1O7D B;  4FZO A;  1WDZ A;  3SYV A;  2JNK A;  4PO2 A;  3L3O M;  4ILH B;  1JQK A;  3EJP A;  3DDF A;  3DOB A;  3T4A G;  2OW7 A;  3DPP A;  2RAJ A;  2X3W A;  4E3C A;  2GAF D;  5E84 A;  3T47 A;  4WPE A;  4EZQ A;  1HWW A;  4AVM A;  3CKD A;  4JNF A;  4G6Q A;  3BUQ A;  1QWN A;  2OBL A;  4EZP A;  3VKH A;  3BUD A;  4UDY X;  3QNI A;  3C7N B;  2Q13 A;  2RAI A;  3DPO A;  2F1B A;  3D2E A;  2YL8 A;  1OAO A;  4AZH A;  1E2U A;  1I4D A;  1PS3 A;  3LVT A;  1ZYL A;  2WYI A;  3KAW A;  2MI7 A;  3G9G A;  2QFF A;  1U00 A;  2V7Y A;  4NPH A;  4AKV A;  2F7Q A;  4E81 A;  1HTY A;  3ER9 B;  2LM0 A;  2ELB A;  1DG4 A;  3EJS A;  2NCZ A;  3T49 A;  2O0I 1;  3DX0 A;  2KHO A;  4R5G A;  3DX4 A;  3B52 X;  3ERC C;  3I01 A;  1TQT A;  3I2W A;  3DDG A;  3D2F A;  2C08 A;  3VEA A;  2F18 A;  3SBS A;  3RPM A;  3Q0K A;  2F7R A;  5FLE X;  4R5J A;  2PMR A;  4JWE A;  3DPQ A;  3EJT A;  2EWF A;  1X03 A;  4BNE A;  3H0X A;  3A98 A;  1DKX A;  3ABH A;  4H6H A;  1OA1 A;  4AZC A;  3BVX A;  3B53 X;  4IWO A;  3HAI A;  3I04 A;  1I4L A;  1E1D A;  2EX3 B;  3DQG A;  1R33 A;  1I49 A;  1W9M A;  4JWD A;  2OO2 A;  2ZXQ A;  3DX1 A;  2RAK A;  4KIK B;  4KIK A;  2Z0O A;  4JWC A;  2OP6 A;  2OZN B;  4H6I A;  3HAJ A;  4M0M A;  4MQD A;  3Q84 A;  2GA9 D;  4AZG A;  4JL9 A;  4F01 A;  1SUF A;  1URU A;  2FYV A;  3ZEF A;  3FD9 A;  4R5K A;  3D50 A;  4WV7 A;  2YIA A;  3O3O B;  4EZR A;  4EZO A;  4H8S A;  2ALW A;  2FIC A;  1X04 A;  3C7N A;  1QWU A;  2RT6 A;  3QWE A;  2QKW A;  3L3P A;  2EFL A;  1O7D C;  3CAZ A;  3EJR A;  2Z0N A;  2WYH A;  3ER8 C;  2Q12 A;  5TKY A;  3ZED A;  4UDX X;  3RV0 A;  3O3M B;  3SBT B;  1Y2O A;  3B51 X;  1ZWW A;  3QA8 A;  1GNL A;  3M3W A;  4FZS A;  2PY6 A;  3D4Z A;  3HAH A;  3LMF A;  3OHX M;  4HR1 B;  1E9V A;  1I4T A;  1YWM A;  4HR1 A;  4EZS A;  3CZS A;  4EZV A;  4IM2 A;  3GI7 A;  4I43 A;  2YKT A;  5C5B B;  2V0O A;  4F00 A;  1TQV A;  3BVW A;  4FZP A;  1SU7 A;  4NSW A;  1UPX A;  2F7O A;  2YI9 A;  3BVU A;  3BUI A;  4IWP A;  1GN9 A;  3DYT A;  4IM3 A;  4EZN A;  4JWI A;  1TQU A;  2YL5 A;  3T48 A;  3EJU A;  4DCN C;  1DKY A;  2YLL A;  3T46 A;  3BVV A;  4EZW A;  3OK8 A;  3QNJ A;  1YUW A;  5FIG A;  4HY9 A;  7HSC A;  4ATM A;  2QXL A;  1HXK A;  4EZT A;  4NQI A;  1SU6 A;  3I39 X;  4IW0 A;  2X5C A;  2X3V A;  3PLT A;  4ILG A;  4R5I A;  2OBM A;  1OA0 A;  3OWG A;  3BLB A;  2JNS A;  4AZ6 A;  4WPC A;  3BUP A;  3CZN A;  2ND1 A;  3D52 A;  3UIT A;  2D4C A;  4AZB A;  1TQW A;  4R5L A;  2WIN M;  5KBP A;  3O3N B;  3VEB A;  1QX1 A;  2GF4 A;  2LXY A;  1GNT A;  4JLC A;  2BPR A;  1MJG A;  3KDR A;  2F1A A;  4DYL A;  3SOG A;  2X3X A;  3CV5 A;  2Z0V A;  1CKR A;  2F7P A;  2ND0 A;  3D4Y A;  4FM3 A;  2YIV X;  3EJQ A;  3CVR A;  2YL9 A;  3LLL A;  4AZ7 A;  3F7W A;  3DX2 A; 
#chains in the Genus database with same CATH homology
 4G6Q A;  2N3K A;  4HYB A;  1UPX A;  1W9M A;  2YI9 A;  3DQG A;  4JWD A;  4KIK B;  4IWP A;  1Q5L A;  2OBL A;  3RV1 A;  4KIK A;  4EZP A;  1GN9 A;  3VKH A;  4JWC A;  4UDY X;  3KAV A;  2OP6 A;  4IM3 A;  3C7N B;  4H6I A;  4EZN A;  4JWI A;  3DPO A;  3D2E A;  3T48 A;  4M0M A;  4B9Q A;  4MQD A;  4D8J A;  4EZY A;  2GA9 D;  1DKY A;  4JL9 A;  4F01 A;  1SUF A;  1OAO A;  4IM0 A;  4JN4 A;  3T46 A;  3ZEF A;  1E2U A;  2Z8Y A;  3FD9 A;  4R5K A;  4EZW A;  3QNJ A;  4IWQ A;  1ZYL A;  3KAW A;  1BPR A;  1DKZ A;  1YUW A;  2QFF A;  1U00 A;  2YI8 A;  2YIA A;  4NPH A;  2V7Y A;  5FIG A;  4FL9 A;  4WV7 A;  1SU8 A;  4HY9 A;  7HSC A;  2QXL A;  4E81 A;  3O3O B;  4EZR A;  3ER9 B;  4EZO A;  2LM0 A;  4EZT A;  1DG4 A;  1SU6 A;  2NCZ A;  3T49 A;  3I39 X;  4IW0 A;  3C7N A;  4EZU A;  2X5C A;  4EZX A;  4WV5 A;  2KHO A;  4JNE A;  4R5G A;  3B52 X;  3N8E A;  3ERC C;  3I01 A;  4ILG A;  2RT6 A;  4R5I A;  3D2F A;  2OBM A;  1OA0 A;  3OWG A;  4EZZ A;  3VEA A;  2JNS A;  2YIB A;  3SBS A;  1E1D A;  3ER8 C;  4ILI A;  5TKY A;  3ZED A;  4UDX X;  3RV0 A;  2ND1 A;  3UIT A;  5FLE X;  4PO2 A;  3O3M B;  3L3O M;  4R5J A;  4ILH B;  3SBT B;  4JWE A;  3DPQ A;  3B51 X;  4R5L A;  2WIN M;  3QA8 A;  2EWF A;  1JQK A;  1GNL A;  3O3N B;  3VEB A;  3H0X A;  3A98 A;  2PY6 A;  1DKX A;  3LMF A;  3OHX M;  1GNT A;  4HR1 B;  1E9V A;  4JLC A;  4H6H A;  4HR1 A;  2BPR A;  1MJG A;  3DOB A;  3KDR A;  4EZS A;  3T4A G;  1OA1 A;  3DPP A;  4EZV A;  4IM2 A;  1CKR A;  3GI7 A;  3B53 X;  4I43 A;  2ND0 A;  4E3C A;  2GAF D;  4FM3 A;  2YIV X;  5E84 A;  4IWO A;  3I04 A;  4F00 A;  3T47 A;  4EZQ A;  3F7W A;  2EX3 B;  1SU7 A;  4JNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...