4JNEA

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Hsp70 CHAPERONE DnaK
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jneA05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jneA04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jneA03
3JXUA 3VGKA 4H0VB 2ASMA 4RWTA 5TKYA 3RSEA 1ZBSA 4Y0WA 1YXQA 4FWSA 4BRAA 4PKHA 3WXKA 1GLLO 5AQUA 1Q5LA 1BA1A 5LY3A 3IUCA 4H0YB 1DKXA 2BPRA 3A8YA 3FE1A 4CZIA 4EZNA 3VEOA 4AM7A 3W0LA 3GOIA 1YAGA 2ZGZA 1G99A 4K25A 2QWLA 3P4IA 3D2EA 5FPDA 1U00A 5BRFA 1K8KB 2HF3A 4CZFA 4A61A 3IDHA 3CI5A 3EZWA 3KVGA 3QMLA 3ENOA 5AQKA 1NMDA 5AQLA 3DXMB 3UKRA 4H5NA 5BRHA 3DPOA 3MCPA 3FR0A 2WUSA 3MK6A 2GWJA 3D2FA 3H1QA 4FWKA 3VGLA 2J4RA 3BP8A 1Z6RA 4HTLA 4O8KA 3VF4A 4BR2A 3TU5A 2P9IA 4ISFA 5JLHA 3ULEB 4EHTA 3O6WA 2E20A 1BPRA 5KPRA 3GDQA 4C23A 4BRIA 3ATUA 1RDWX 1V4SA 4FWQA 3T46A 2Q0RA 5AQOA 4DQ8A 3AAQA 4M7XA 3ID8A 1SAZA 4EZQA 4BC2A 4CBWA 3W3DA 4WV7A 1Y64A 1WUAA 3T4AG 3CJAA 3QFPA 4HWIA 1CKRA 1SZ2A 3QBXA 5ADXA 2E88A 1DKGD 1D4XA 4JAXA 4GY2B 4BC3A 1NGAA 1RGIA 5CE3A 1BOTO 3L6QA 5BREA 1ESVA 4CZKA 4JD2A 5AQGA 1NWKA 2GELA 4B1ZA 4I6MB 1X3NA 4B1YB 3QICA 4EIAA 3DXKA 3CJBA 4IWVA 3H1VX 4FWLA 2QXLA 3C7NB 5EXWA 2A5XA 2GUPA 3CQXA 3LM2A 3KZBA 2QW9A 2QWMA 1QZ6A 4DCHA 4QS8A 2FF6A 1NM1A 3VEVA 3T48A 3VETA 2GTDA 3QBWA 5AFUH 5BRDA 4FPBA 2P9LA 1CZAN 4CBUA 4L3QA 2P9SA 2NZTA 1E4GT 4R5LA 1HPMA 1S22A 3BEXA 2BTFA 1KAZA 3D2FB 4M7YA 2Q31A 4XH1A 2V7YA 3MN5A 4PL7A 4PKGA 3UKRB 5BPLA 1YVNA 4BVOA 2P9KB 4IO8A 2E2OA 4GNIA 3DPQA 3O5BA 2ZF5O 5AR0A 3R9PA 4CZGA 2CH5A 3DOBA 3VF2A 1MA9B 4FWMA 2W40A 1C0GA 1OKJA 4BG8A 2QWRA 2UYTA 5F2RA 3VERA 3WUHA 4JN4A 4FWPA 2P9NB 3HSCA 1JCGA 3M1FA 3FZLA 4FOIA 2P9IB 4FPAA 4BRPA 4CZLA 1GLAG 4EZSA 4WQ5A 2ZGYA 3HZ6A 2PBDA 4K43A 2WINM 1TUUA 4DHYA 1WOQA 3CQYA 3DXMA 1JCEA 1ZXOA 2ASOA 5AQWA 4BR5A 4WQ4C 3FFKB 1YUWA 3I8BA 4RCHA 2YJEA 4JWCA 5JICA 2P9UB 3ENHA 5AZIA 1XUPO 2IVPA 3BUZB 3JS6A 3LDOA 5AQFA 3I33A 5AQSA 4BROA 4PO2A 2IVNA 5AQJA 4BQLA 4FSVA 1KAYA 4CBXA 1QQOA 5BPNA 1C0FA 1SQKA 3VENA 3SMPA 1NGIA 5AZIB 2QM1A 3CERA 2E1YA 1QZ5A 4EFHA 2I7NA 4IJNA 3RSEB 2ASPA 2Q36A 3M3ZA 2P9KA 4JD2B 5BN8A 2D0PA 3DAWA 1HUXA 1TYQA 3VEXA 3LDQA 3H45C 5EY4A 3ZX2A 4PKIA 4FO0A 3WEEA 3WXJA 3O4WA 4MLEA 1QHAA 4EZYA 4BRQA 3O1BA 3MDQA 2H3GX 3L0QA 5AQRA 2QWPA 2FLOA 2CGJA 3EO3A 3ZX3A 2Q0UA 4H03B 2KHOA 1HLUA 2HF4A 1X3MA 3UE5A 2ITMA 3CJ7A 4BRCA 4EZOA 2YCHA 4H0PA 1T44A 4IJAA 4WQ4A 4F00A 3A5LC 4BRMA 4JWIA 2EWSA 3O8MA 1HKBA 4DB3A 3T49A 4XH4A 1U6ZA 3IFRA 3OHXM 1NGEA 4JHDB 4M63C 1J6ZA 1RFQA 2OANA 4MO4A 3CJ1A 3CHWA 2IIRA 5EX5A 2F9WA 1ATRA 2YHYA 3QFUA 4IXCA 3WT0A 1LOTB 5AQPA 3VOVA 1H1VA 2HMPA 3EKUA 3MN9A 4CD3A 1E4FT 2AA4A 1XC3A 3QNJA 1T6CA 1DEJA 2E2QA 4B1XB 1BG3A 3C0BA 3DXKB 4KBOA 1EQYA 1GLFO 3UKUA 1HJOA 1TYQB 5AQQA 4NB4A 5KQ8A 3VF6A 5BR9A 2V52B 2AP1A 2NRHA 2W41A 4BC4A 3ATVA 3U9ZA 4BR7A 4H5WA 1GLEG 3UB5A 4CZHA 3A5MC 3CETA 3VEYA 4EZTA 5LJWA 2P9LB 3GL1A 2I7PA 3EN9A 1TUYA 3QDKA 4EZVA 1Q18A 5ELZA 5I9EB 4K42A 3FZKA 3F9MA 3L4IA 4LC9B 2P9NA 4JNEA 3A5OC 2QFFA 3ZEUA 5AQXA 5AQZA 1ATSA 1K8KA 2E8AA 5KPZA 1MWMA 1JCFA 3GG4A 4MO5A 2V7ZA 4H6HA 3LDNA 4XEIA 3SLCA 3OHRA 2ZWHA 3H3NO 3O80A 2P9PA 4Z94A 4FL9A 5AQVA 1NGJA 2NLXA 2VCPA 2A6AA 2YJFA 4K41A 4R5KA 1HKCA 2P9UA 3GE1A 1BO5O 3L3OM 5EVZA 1QQMA 2Q97A 3DWLA 5LJVA 2FSNA 3ZX0A 2P9PB 5AZJB 1NGDA 2VWBA 1GLBG 1P8ZA 1QQNA 4BREA 3AARA 3U8XA 4H5RA 5AQHA 2IVOA 1DKYA 3GBTA 1KXPA 2E2NA 3FZHA 3WQUA 3CIPA 1GLDG 3A5NC 5AQTA 1U2VA 1ZC6A 1IG8A 3D2EB 3LL3A 1HKGA 3HTVA 3ZETA 5EOYA 3ULEA 3FLCO 4QS7A 3WEEB 4JHDA 1MWKA 3G25A 5ADXH 3HM8A 1NBWA 2D0OA 5KPTA 4FOEA 3ZETB 2QWOA 1LCUA 3LDPA 3N8EA 2CGLA 3U4LA 1BDGA 2Q1NA 3B8AX 4O5FA 3R6MA 4A2BA 1Z05A 2D1KA 1HX1A 3M6GA 4B1UB 5JLFA 1R59O 4A2AA 5AFUA 2FSJA 3DJCA 3BF3A 4BRNA 3IMXA 2PAVA 4BRHA 2A41A 3MMVA 1T6DA 1NGCA 2E1ZA 3EKSA 4QS9A 4JNFA 1DGKN 4BG9A 2GWKA 4J8FA 5BPMA 2A42A 4BRGA 4BGBA 2GEMA 4BR9A 5AZJA 3HBTA 2Q2RA 3CJCA 4YDUA 2BUPA 5FPEA 3SMSA 4WYBA 3KHYA 3H46O 3H6EA 4BC5A 4BGAA 5B8HA 2D4WA 3LDLA 3WQTA 3DQGA 4CI6A 4BRDA 5FPMA 2YHXA 1NGBA 4H0XB 2A40A 1KAXA 4MLHA 2YI1A 5E26A 4B1WB 4BRFA 5F1XA 5KQDA 3DPPA 3VGMA 3UKUB 7HSCA 1BUPA 1U2VB 2QWQA 3O08A 5AQNA 4A62A 5F0XA 4WV5A 3EL2A 4FWOA 4EAHD 5BN9A 3C7NA 2YHWA 2FSKA 3FZFA 1X9JA 1XQSC 3AAPA 1ATNA 1GLJO 3S41A 4R5IA 4YDUC 4F9OA 3FGUA 3VESA 4BRLA 4ISEA 3WXLA 5AQYA 3FZMA 1BWFO 1NGFA 1IJJA 3CJ9A 3TPQA 4E1JA 4H0OA 4FWRA 3SJHA 3BF1A 4EZRA 2QWNA 1BA0A 4PL8A 3VEWA 4H5VA 4B1VA 1NLVA 4EZPA 4F01A 3HI0A 4XH5A 3QB0A 4JWEA 4CZEA 4H6IA 4BR4A 4B9QA 4FWNA 3U9DA 2HOEA 5JMVA 2FF3B 4IZ9A 3H0XA 1NGGA 4HY9A 4R5GA 5AQIA 4EZZA 1GLCG 3A0IX 4H0TB 3VEZA 4CD1A 3T47A 3SK3A 4EZWA 1BU6O 3VPZA 4RTFD 4I6MA 3R8EA 3MN6A 4EZUA 2OP6A 2V51B 2F9TA 2DPNA 1S3XA 3D7EO 3AY9A 4EHUA 4CJ7A 4ISGA 4E81A 5FPNA 2P9SB 4CZJA 1MDUB 1NGHA 4BR0A 1DG4A 5AQMA 4JWDA 4AM6A 2A3ZA 4EZXA 4R5JA 2CH6A 2CGKA 4CZMA 3WXIA 1V4TA 4BVPA 5E84A 4HYBA 2E2PA 1DKZA 2VYPA 4NO7A 4H5TA 4BQZA 4WQ5C 3LM9A 3J8AA 3MN7A 4BRKA 2FXUA 3H3OB 3ZEUB 3O1WA
chains in the Genus database with same CATH superfamily
3LP2A 4CFCA 3LWLA 3JXUA 5TKYA 1R34A 2X78A 1ZBSA 3I01A 3P31A 2JWLA 3CCSN 2YHBA 1BA1A 1BIUA 2B6AA 4CF0A 4DTRA 1DKXA 3M8PA 2ZXQA 3JSMA 1RT1A 3W0LA 2P5GA 1YAGA 4UDXX 1RBVA 4H4OA 4FLZA 1BQMA 2ZJRL 4CGFA 4CZFA 4FK0A 3OYMA 3AO1A 1VSLA 1IKYA 1C6VA 1HQEA 3KVGA 3KK3A 4DSEA 4AKVA 1O7DC 3SQ4A 4C1NI 4H5NA 2G8FA 3DPOA 4KRFA 2Z1GA 3L3PA 3ZT1A 5CHIA 4JKBA 5KGWA 4AH9A 4BR2A 1VSMA 3MXMA 4F3TA 2VQFK 1FKPA 3ULEB 4JKCA 3O6WA 3VQCA 4EHTA 3A98A 5KPRA 1XNRK 4FJMA 1BL3A 3BVTA 1RDWX 5DK5A 4BE0A 2UUCK 3RTVA 4RW9A 2R7YA 4M3UA 3ID8A 4IWOA 3C6UA 4KIKA 1QSSA 3AA3A 4DR6K 2ALWA 4JI3K 4W5RA 1RT2A 5ADXA 3SUPA 1DTTA 3P83D 1EKEA 3P38A 1RGIA 1BOTO 3CCLN 2OTLN 2YIBA 3PIPL 4JD2A 1L3TA 3OJUA 1LAVA 4I6MB 3THWA 2PYJA 3QICA 2UU9K 2KLAA 3OA9A 3ENBA 4YY3K 1D8YA 1D5AA 5KRSA 1VSKA 3ULDA 3NF8A 4Z4GA 2A5XA 2GUPA 2ETJA 1WSFA 3CQXA 4B3MK 2QWMA 3CMAN 3QA8A 1NM1A 3BUDA 4JI4K 4FCYA 4KB1A 4Y1DA 4FPBA 1YJNN 3T69A 4CBUA 4DU3A 4NCAA 3AVHA 5GADP 3SUQA 4IM3A 3M3WA 4O8UA 2NZTA 4R5LA 4D8JA 3BEXA 2BTFA 1KAZA 3MN5A 4PL7A 4J2EA 3HPOA 3UKRB 3DOKA 1YVNA 3NFAA 4F2SA 1XHXA 4WF9L 4NXNK 1VQ9N 2F7PA 4GNIA 3DDGA 1ITGA 3HPGA 2NNWA 1VK0A 3R9PA 4DYLA 1IO2A 3QEWA 3HOTA 4AZ7A 2UUBK 5A2QO 4LF8K 1I4TA 1UWBA 4DFMA 4W5TA 1KVBA 3M1FA 4FPAA 4BRPA 3TAEA 1BHLA 1JLEA 4AZ6A 3EJUA 4CJTA 4WQ5A 2XY6A 2ZGYA 4M3RA 3O9TA 4AHUA 3UIQA 4KI4A 2PBDA 4H4MA 1TUUA 2IAJA 1WOQA 1RBRA 2RE2A 4FW2A 3G9GA 4AF1A 2WOMA 4E89A 4BR5A 4WQ4C 4A5BA 4BY9C 3FFKB 3PIOL 3JAMO 5HROA 5D3GA 4JWCA 3AVJA 3ENHA 3E1YA 1I3AA 3ITHA 4MFBA 4JS4A 1T05A 2HSTA 3OYIA 3VQBA 2O8CA 4Q0BA 1JLCA 2ZE2A 4FZPA 3OYFA 5AQJA 4CBXA 1KAYA 3KDRA 4ELTA 4AZBA 1NGIA 4HUEA 1RDUA 2O8EA 3NAEA 2Z8YA 4C8KA 3EY1A 4OLBA 3M8QA 2I7NA 1RDCA 1IH7A 3TANA 2JGUA 3LZIA 3B53X 4JKGA 2LXYA 4KI6A 1Z25A 5EY4A 4DUYK 4IEEA 1VQLN 1YHQN 4DSJA 4FO0A 3G10A 3WXJA 3MEDA 4YFUA 3OBYA 3KTQA 3SV4A 3O1BA 2H3GX 3K59A 2Z0NA 2QWPA 2YL5A 3EO3A 2Q0UA 3Q7CA 2KHOA 4FYDA 3SQ0A 4C8NA 3KD1E 1X3MA 2YV0X 1SKSA 4LF6K 2ITMA 5HLFA 4IKFA 3WNHA 1TV6A 3SUOA 4CFDA 4BRCA 4EZOA 2XRIA 3BGRA 4CGJA 1T44A 4IJAA 2YIAA 3SCXA 1K6YA 2HB5A 1XHZA 1TAUA 3A5LC 2IOCA 4DB3A 1KVCA 3OYDA 1NGEA 3ZLJA 3DLGA 4JHDB 2IS3A 2OANA 4MO4A 3I39X 3CHWA 4AILC 3OTOK 2YHYA 3KIOA 3QFUA 4YORA 5HBMA 3KLEA 3OYNA 4LY7A 3L2UA 3VOVA 3PX6A 3MN9A 1E4FT 3SAFA 4B1XB 1DEJA 1NJWA 1IBLK 4DKWA 1BG3A 3CC4N 4DFPA 1YITN 1EQYA 4LD0A 1JLGA 1TYQB 4B9VA 5KQ8A 2OPQA 3VF6A 3ATVA 1KD1O 1S1TA 4NCBA 4N5SA 4EZTA 4JKFA 5LJWA 1NMNA 5T7BA 2Z0OA 3EN9A 2Q12A 2HBMA 3G0ZA 2O8EB 3LWMA 2HVIA 5I9EB 3TR8A 4K42A 4CJ4A 2KFZA 2P9NA 4HUGA 2WFBA 4JS5A 3A5OC 1EWQA 4DTUA 2E6LA 3VEAA 3SPZA 3GG4A 2XY8A 3O3MB 3D6RA 3V1OA 1Q9YA 5K14A 4KHPK 3LDNA 4OPHA 3LANA 4K8ZA 3H3NO 5AQVA 2NLXA 2OZSA 4C8LA 4K41A 4R5KA 1HKCA 2P9UA 1BGXT 4WFNL 1BIZA 5EVZA 3J81O 1QHTA 3VQEA 2YL8A 3RRHA 4DTSA 2FSNA 3ZX0A 2X5CA 4CECA 3AARA 4GKKK 1HPZA 3L2WA 2IVOA 1VSDA 4IG3A 1DKYA 3GBTA 4FZOA 4C8OA 1Q9XA 3LPUA 1X1PA 1RT5A 4OPKA 2VQEK 4JRPA 3DI6A 5AQTA 4OLAA 3D45A 3O4QA 2YI9A 3NVKA 4O4GA 1QS4A 1SKWA 5EOYA 3THVA 3FLCO 5JVGL 1HWWA 4JHDA 1MWKA 4CVNE 3QEXA 4JKDA 5KPTA 2YKNA 4WFBL 3S5TA 4JI2K 3QETA 2NRVA 4O0JA 3K5OA 3N8EA 2CGLA 3U4LA 4O5FA 4A2BA 4B1UB 2D1KA 5I3UA 5AFUA 3VEBA 4BRHA 2PAVA 4CHQA 3D4YA 1L5UA 2HW3A 3MMVA 3OYHA 1VQ8N 1DGKN 4J8FA 2A42A 4NLBA 4BGBA 1J5OA 4BR9A 4K0KK 1LW0A 3OS1A 2BUPA 1OH7A 2Z1HA 2RHKA 4PA1A 4DLEA 4WYBA 3OYJA 5B8HA 2D4WA 1IBMK 4CHYA 2O0I1 3ZEDA 3WNEA 4CEEA 4H0XB 2A40A 4MLHA 3ISNC 2Q3SA 3K9JA 3UKUB 4HTUA 2OW7A 1BUPA 1U2VB 2QWQA 3O08A 2OCEA 4NSWA 4A62A 3ABHA 4WV5A 3EL2A 5F0XA 4BDPA 3ER9B 5BN9A 3MWPA 2YHWA 1SL0A 2FSKA 4DR2K 3BVXA 2PZSA 4QAGA 2D5RA 4E1MA 3C6TA 1Q82O 3FGUA 3VESA 4PHTX 4BDZA 3BUPA 4WE1A 3CJ9A 4E1JA 1QX1A 1T3VA 1VQ4N 4J2DA 2ND0A 1TKDA 3P39A 4B3SK 1W9MA 1BA0A 4LH5A 4DSFA 4AHRA 5CR4A 2PY6A 3OYBA 4H6IA 4B9QA 2OBLA 1ZBUA 4QCLA 3P1GA 5M1PA 3MX5A 1ASWA 3VA3A 4B8AB 1NGGA 4FZSA 3NHGA 4H0TB 4E7KA 3SK3A 4IM0A 3OS2A 4EZWA 3ZT0A 4XJXA 4KTWA 4FM3A 3E01A 5IT9O 3VQ8A 3CYGA 3MN6A 4EZUA 3ID6A 4G9ZA 3K9KA 1T03A 1ILYA 1NKBA 4E7HA 3HAHA 4ELUA 4O44A 1TVRA 4JK7A 4EHUA 1UA1A 4CEDA 4ISGA 5FPNA 3E66A 3HPHA 3AVGA 2WTUA 3K0SA 2YKMA 4DG1A 4R5JA 2CH6A 1WNSA 2C1IA 3IAYA 4BVPA 1GOBA 2LSNA 1LV5A 1XI1A 4V19S 3EE8A 5DMRA 1WAJA 2ZQBA 1K73O 5BR8K 2F1BA 1EWRA 4BNEA 2F96A 1ZBLA 3KAVA 3QE6A 3O1WA 5C5BA 4H0VB 5HL7L 2HHVA 1OH5A 3ZT4A 3KLFA 3IRXA 2F4VK 1A5XA 3MCAB 2KZZA 2FBXA 4QOZB 3AGKA 5LY3A 3HT3A 4CZIA 3FE1A 5H1SQ 2A1RA 4AM7A 2XY5A 1IKXA 3AVLA 5FROA 2YKTA 1F21A 4K25A 2QKWA 4FK2A 4UQGA 3ZSZA 4EP4A 1U00A 2F18A 5BRFA 2HHWA 3AA5X 3THWB 3IDHA 1OA1A 3CC7N 3DX0A 1WSJA 2QA4N 2FBYA 4DQSA 3QMLA 5E41A 3ENOA 3HJFA 1OAOA 1A5WA 3IG1A 5J1EA 3MCPA 1HMVA 3FR0A 1RILA 2WUSA 3MK6A 3PSIA 4CHPA 3HP6A 3H1QA 3L2VA 5IWAK 4NQIA 5HRNA 3KJVA 2O4IA 3DLHA 2P9IA 4FM2A 1S1WA 4ICLA 5EU7A 5GIPA 2E20A 1GNTA 4F4KA 2AJQA 4C23A 3O9SA 4RW4A 1V4SA 2Q0RA 5AQOA 3OY9A 4BE7B 1VSFA 1X04A 4NYNA 4CBWA 2F1AA 3W3DA 1Y64A 3OBWA 4DV5K 1WUAA 3QFPA 1CKRA 2F7RA 1LAWA 3QBXA 3KK2A 3KK1A 4DF4A 4MQ3A 4DTMA 4M3XA 2BH1A 4GY2B 4JEPA 5C10A 3DLLL 2HBKA 4CESA 2YNGA 4CZKA 2GELA 4CFBA 3AVMA 4B1ZA 1X3NA 1QTMA 4JKHA 2D1LA 5HRSA 3CJBA 4Q5VA 3SBTB 3H1VX 3G71N 3C7NB 4DQRA 5EXWA 3V9WA 1QZ6A 4QS8A 1VQ7N 1LWCA 4Y1CA 3VETA 3QBWA 1DTQA 1ASUA 4OKKA 3CCEN 1VQ5N 2LM0A 3EYZA 4DUZK 2O8DB 1QE1A 1E4GT 1TAQA 4XH1A 3TTDA 5HRPA 2V7YA 1R0AA 3D50A 3HYFA 4PKGA 2JLEA 1L3SA 4KKOA 2P9KB 4BVOA 2QK9A 3SBSA 1C1AA 4OGCA 3VF2A 4LFCK 4JI7K 4FXDA 1C0GA 3CVRA 1OKJA 1RTJA 4PWDA 1WSEA 3K58A 2G8KA 4JN4A 4AZIA 1UA0A 3ZEFA 1YTUA 1S1UA 2P9IB 4EZSA 4RG8A 1KCFA 5DM7L 3QNIA 3BVWA 3AVNA 3DYAA 2YL6A 4RW7A 1JJ2M 3DXMA 5AJ3K 1LQ7A 3V1RA 1N8RO 4RCHA 4KHSA 5JICA 5AZIA 5GINA 3JS6A 3LDOA 3B6OA 3S9HA 3BUIA 3CCRN 1QQOA 5BPNA 3IS9A 3PO4A 3MXIA 4X62K 4KH4A 1JLBA 2QM1A 2O8FB 3CERA 3C6HA 3CZSA 3DMJA 2E1YA 2B5JA 3D4ZA 3P5JA 4Z0UA 2HNDA 2YX6A 1I39A 1HRHA 4FJGA 2ASPA 1QVFM 2NRWA 2X6SA 5BN8A 3PX4A 4YOVA 3CKDA 4DR5K 3O4WA 2D4CA 4MLEA 2HNYA 2RPIA 1N5YA 4RW6A 4JL9A 1U04A 3L0QA 4KH5A 1RTIA 3NF7A 4KH6A 1HLUA 3NCIA 3HXMA 4FJHA 3CJ7A 1L3VA 2YCHA 1RDAA 4KTZA 2X6NA 3S3OA 4F00A 4DS4A 3TAMA 4JWIA 3KKSA 1HKBA 1U49A 1IG9A 4HCCA 1BI4A 4CGHA 3NGIA 3IFRA 3RMAA 1I49A 1BCOA 1RDDA 5CYQA 2HBLA 3SYZA 4W5NA 3VQAA 2IIRA 3DRSA 4CIGA 3K5MA 4IXCA 4KV8A 1OVQA 3WT0A 2O8DA 3EJTA 4LF4K 1H1VA 2HMPA 1KSPA 5CY4A 4HR1B 1KQSM 4KB0A 3M8RA 1MJGA 3C0BA 3OVNA 1HJOA 4NB4A 4ILJA 1RNHA 4FJNA 2HHSA 4A57A 5M1OA 4BC4A 2NRZA 5SZTA 3HM9A 4BR7A 2UXDK 3I04A 3UB5A 3VQ6A 2PYLA 4E0DA 1UPXA 2P9LB 3GL1A 4O0IA 3QDKA 1VQNN 4EZVA 5ELZA 4ATMA 2QTDA 3O3GA 5I42A 1Q86O 1B9FA 1VSIA 1J5EK 2KKZA 5AQXA 2HBJA 3S3MA 5AQZA 2BDPA 2RF2A 4CEOA 3F7WA 4DMNA 1K8KA 2E8AA 1HR0K 1JCFA 3SQ1A 1NKCA 3QEVA 4CIFA 4U67L 4MO5A 4NCGA 2G8HA 1SKRA 1U45A 1UAXA 3BDPA 4M3WA 4FW1A 1NGJA 3AGRA 4W5OA 3GE1A 4GKJK 3L3OM 3OYEA 1SL1A 4DCNC 1HJRA 1QWUA 2PFUA 2GBZA 2F7OA 4FLYA 1QQNA 3AVIA 4BREA 3U8XA 3RMCA 1NJXA 1KXPA 4N56A 2QI2A 3FZHA 4FJ7A 4BEBA 5KBPA 2G8VA 4CJUA 1CZBA 3CIPA 4OPJA 1S72N 3T1AA 1ZC6A 2ITGA 4N41A 3IKMA 2VGMA 3KAWA 3D2EB 3LL3A 1VQPN 3HTVA 4JKGB 3ULEA 3EZ5A 1VHXA 4WCEL 1Q7YO 2OYQA 3WEEB 1CZ9A 1NNEA 2GAFD 2YLLA 1NKEA 1DT9A 1NG9A 1HNVA 1BCMA 3BVVA 4CJQA 4ILIA 3ZETB 1LCUA 3LDPA 1RBUA 2QXFA 1BDGA 1TL3A 3K5NA 3B8AX 4DTPA 3R6MA 4CJ3A 1Z05A 4LFAK 2X3WA 4A2AA 4IO9L 3NMUA 3AA4A 4BRNA 3IMXA 1QSYA 1JXEA 4OKEA 4CHNA 3AO5A 1U4BA 2E1ZA 4QS9A 1VSHA 5BPMA 2GWKA 5LMNK 4KFBA 4CEAA 4B3OA 1N33K 3HBTA 3NBPA 1WB9A 5FRMA 3UITA 2YNHA 5FPEA 4FJ9A 3SMSA 3H46O 2GA9D 3EE9A 3GI7A 1N36K 1E2UA 3TSQA 3WQTA 3DQGA 4OO1J 1NGBA 4B1WB 5F1XA 3VQQA 4ID5A 3QEIA 1TKXA 4BACA 2IC3A 5C0YA 4CEFA 3AAPA 3O4NA 1GLJO 4R5IA 3D51A 4DSIA 3DYTA 3CCJN 3TPQA 4EP5A 2W00A 4H8KA 3QIPA 4FWRA 2UUAK 4DU1A 4CIEA 3EEQA 3NH1A 3C6AA 4PL8A 4M45A 1YIJN 4F01A 4XH5A 3CAZA 4JWEA 3CZNA 1WLJA 3BY5A 4FLXA 4FWNA 3DX3A 3OYLA 2KW4A 3ZSWA 1Y2OA 5JMVA 2ZJQL 2O8FA 4ZTFA 4IZ9A 5AQIA 2ELBA 4EZZA 1NJYA 3DOLA 4KREA 3SBTA 5JS1A 1C0UA 2HVHA 2DFEA 3VPZA 3LP1A 2HMIA 1GOAA 1N32K 2OP6A 2F9TA 2YI8A 3O3FA 1FK9A 2FYVA 1S3XA 1BISA 3D7EO 1I94K 4E81A 2P9SB 1JXBA 3B51X 1MDUB 1DG4A 3U3YA 5AQMA 4JWDA 3BZCA 3C94A 1VSJA 5SWMA 4E7IA 3TAFA 3J7ZO 3AVAA 3KD5E 4CJKA 2EHGA 1N34K 4KHWA 5E84A 2E2PA 2BGGA 4WQ5C 3THYB 4NPHA 3LM9A 2ZD1A 4FJJA 3ZEUB 1JQKA 3EJQA 4CFAA 3VGKA 2FC0A 4Y0WA 4IG0A 1YXQA 2OW6A 4AHTA 4BRAA 4PKHA 4FJ5A 1GLLO 1XNQK 2HHHK 3ALYA 3IUCA 4H0YB 2BPRA 4Z4IA 3A8YA 4CF2A 2Z0VA 4EZNA 3VEOA 3HRGA 4G6QA 3GOIA 2ZGZA 1G99A 2QWLA 4GV9A 3P4IA 3D2EA 5FPDA 3QESA 4GVEA 3ZCMA 2JWKA 1C1CA 1VQKN 5C15A 3CI5A 1K8AO 3CC2N 3VMFB 4I9QA 3EZWA 1NMDA 1W97L 5JENA 5BRHA 3OS0A 2HHUA 1RT3A 2OO2A 2GWJA 4FWKA 4O55A 2J4RA 3BP8A 1Z6RA 4HTLA 4FZYA 2ND1A 1RDBA 3VF4A 3TU5A 3TAPA 4JKAA 3RMDA 4LF7K 3C65A 3GDQA 3OWGA 4FM0A 1J53A 2IDOA 3RRGA 2RKIA 4LF9K 3PSFA 4FWQA 2ZM6K 3T46A 1TKTA 1VAZA 4OVLA 4M7XA 1TGOA 4EZQA 4BC2A 1OH8A 4IOAL 3NF9A 4WV7A 1L3UA 4I2PA 1U47A 4FVUA 4HWIA 1GOCA 5C12A 3V81A 2E88A 3H08A 4IDKA 1D4XA 1R5EA 4DR1K 3V9XA 4JAXA 1TK5A 2RAKA 4BC3A 1NGAA 3J80O 1ZYLA 1EETA 3M5RA 5J2MA 3L6QA 1ESVA 2UXCK 5AQGA 4CJLA 4R79A 3L4QA 1TQUA 4EIAA 3VQ5A 4E3SA 4DU4A 4JLHA 2QXLA 1RTHA 3TWHA 2RT6A 2W42A 1A5VA 3BZKA 3LM2A 4CCHA 2QW9A 4DCHA 1YVUA 2FF6A 1HNZK 1C0TA 3T48A 3F5TA 2E5LK 2GTDA 3TSPA 2P9LA 4L3QA 4X65K 2WC9A 3MEEA 3O9UA 2WYHA 1HPMA 3D2FB 1NJIO 3F73A 4I43A 3DX2A 3QNNA 4CHOA 4AZCA 4DR4K 1OA0A 4AVMA 3DPQA 3O3HA 1SUQA 3O5BA 2ZF5O 5AR0A 4CZGA 3MWTA 4ZHRA 3DOBA 3CCVN 4JI5K 1RT4A 1MA9B 1FKOA 2FICA 4FWMA 4Z4CA 3MEGA 4B08A 1I4DA 5KGXA 4HHTA 2UYTA 5F2RA 1O1WA 4JI1K 3WUHA 3KLHA 3NH2A 3THXA 2O8BA 1RT7A 3LVTA 3QLHA 4CGDA 1JL2A 4FOIA 4CZLA 1GLAG 4FZZA 4K43A 4DHYA 4DQPA 4IOXA 3CQYA 1HYZA 2ASOA 5AQWA 4DFJA 3M8SA 4F3OA 1QWNA 5JS2A 3I8BA 1YUWA 3CXCM 4HCBA 1XWLA 5TKWA 4DV3K 3OYKA 1XUPO 2IVPA 3O3OB 2EX3A 4FJ8A 4YOXA 3I33A 3KWIA 4PY5A 3QINA 4PO2A 2IVNA 4BQLA 5DM6L 4FSVA 3L2QA 1X9SA 3D52A 4BDYA 2G8UA 1REVA 1C0FA 3CG7A 3U6FA 3VENA 3SMPA 1KRPA 4GV3A 4DTJA 1WSHA 4EFHA 1XC9A 5HP1A 3DLEA 2Q36A 3DLRA 3M3ZA 2P9KA 2GX9A 3CM5A 3ZSYA 3OYGA 4JD2B 3DAWA 4AQYK 1HUXA 4EZ6A 3H45C 3PY8A 4PKIA 3WEEA 2FBVA 1LWFA 3C95A 4UDYX 3MDQA 4CF9A 5AQRA 3WNFA 2FLOA 2CGJA 3ZX3A 3LDSA 4H03B 4AZGA 1HTYA 3G4SN 3UE5A 2OZMA 2O4GA 4CK2A 1FJGK 5GAGP 4WQ4A 3AA2A 4DTOA 3KLIA 3E9PA 3TTFA 3O8MA 3VQ9A 3T49A 4JKEA 3L8BA 3OHXM 1X9MA 1R33A 5M1QA 1QVGM 1J6ZA 1RFQA 3CJ1A 1X03A 5EX5A 2F9WA 1ATRA 3R1XA 1QQCA 2RAIA 3NE6A 2G8WA 3CQ8A 2Z1JA 1VSEA 4CE9A 3RV1A 2JNKA 4B9TA 3ACOA 3PV8A 2A1SA 2YHAA 1XC3A 2E2QA 3NDKA 2VWJA 1RTDA 3DXKB 4U7BA 1GLFO 4FLTA 1PS3A 3DX1A 1RBTA 4A59A 4JLCA 2V52B 2NRHA 1LWEA 4GVMA 3Q84A 3U9ZA 3AVBA 5KI6A 1YTAA 3A5MC 3CETA 3VEYA 4DWIA 3R3LA 4IEIA 1KVAA 2I7PA 1TUYA 2YNIA 3I0SA 2VG5A 3KK7A 4B9SA 4AHCA 3EJSA 1Q18A 3SYVA 3L4IA 4LC9B 4JNEA 1EXQA 1IKVA 1JLAA 3FD9A 1ATSA 5KPZA 4E7JA 4DF8A 4CEZA 4E1NA 3U3GA 2X74A 1M90O 4XEIA 1YF5L 3OHRA 3O80A 2P9PA 2YL9A 4FL9A 4KHYA 4JK8A 2VCPA 2A6AA 1G15A 2YIVX 4LH4A 3Q0KA 2YJFA 5FDLA 1NOZA 1BO5O 2Q97A 1Q8IA 1S9EA 3N4PA 2Q13A 3J7AP 2D0AA 4I9LA 2P9PB 5AZJB 4BE1A 1LW2A 3CFRA 1GLBG 1P8ZA 1HNIA 3RVCA 3T7ZA 4B8CA 4H5RA 3B52X 1I4LA 5KRTA 3RR7A 2HHQA 2P51A 3NVMA 2VWKA 1GLDG 3A5NC 3ZYYX 4ILGA 4LSNA 1IG8A 2KFNA 3AVFA 1HKGA 5J2NA 3O9QA 3KWGA 3AO4A 1S1XA 5CZ1A 2C08A 3EJPA 1NBWA 2D0OA 3T1HK 4L8RB 2QWOA 3SUNA 4YOWA 1NJZA 3OJSA 3MXJA 4MQDA 4DV4K 5JLFA 3M6GA 4JI0K 1HX1A 3NGYA 5C25A 1R59O 1B92A 4KHNA 4CJRA 4B3TK 3I56N 2N3KA 1T6DA 1NGCA 4KAZA 3VQPA 3SV3A 4JNFA 4J2BA 4IM2A 4H8SA 4BRGA 3S3NA 2W6KA 3I0RA 3ZSVA 2BE2A 5M1NA 1GN9A 2NCZA 3SBGA 4BC5A 4BGAA 1Y97A 3H6EA 3SQ2A 3PUFA 1W7AA 5FPMA 1NK6A 2YHXA 5FLEX 1BI4B 3CYMA 5KQDA 3DPPA 4FM1A 4Z4HA 4M3YA 3QERA 4EAHD 3L2RA 2UXBK 3C7NA 3KLGA 3FZFA 3QO9A 2WYIA 1X9JA 3RMBA 4UY8O 3KKRA 3SNNA 3S41A 3VTIA 4FZXC 4YDUC 4F9OA 4BRLA 2OPPA 3WXLA 5AQYA 1TQWA 3FZMA 1BWFO 4FJXA 3MECA 3RPMA 2XHBA 2NUBA 2EWFA 3BF1A 1ZBHA 1T8EA 3I2WA 1C0MA 4EZRA 2QWNA 5C42A 3VEWA 3I8DA 1HNXK 3NH0A 3HI0A 3PLAA 2OBMA 1O13A 1D9DA 1RCHA 3CPEA 2HHXA 3ZSOA 2DFFA 2Y1JA 2HOEA 4AHSA 2FF3B 3RV0A 3H0XA 4HY9A 2EFKA 3A0IX 3VEZA 1B9DA 1WBBA 1T7PA 3HVRA 3DM2A 1HQUA 3HP9A 1NOYA 2V51B 3VKHA 2EFLA 2BANA 1SL2A 1O7DB 4LFBK 4CJVA 4CEQA 4M3TA 4OPAA 4DV6K 1NGHA 4BR0A 2QKBA 1ZBIA 1E1DA 2A3ZA 4EZXA 4CZMA 3WXIA 4CJEA 1YJWN 2WONA 4HYBA 1C1BA 4AZ5A 3OW2M 2VYPA 1E9VA 4NO7A 4H5TA 4BQZA 3TABA 4XIUA 4R5PA 4KPYA 3SZ2A 3J8AA 3MN7A 2FXUA 1RT6A 2XO7A 3H3OB 4CJSA 4RWTA 5HOOA 2ASMA 4X66K 3RSEA 2KQ2A 4DTNA 4IWQA 3VN5A 3ASMA 4FWSA 3DLKA 3WXKA 5AQUA 1Q5LA 4JK9A 4YOTA 4CGGA 1IBKK 4E72A 3T19A 4DR3K 1ZYQA 4KHUA 1IV0A 3TAQA 4YOYA 4BWJA 2C1GA 1S6PA 2YLAA 1K8KB 2HF3A 4MDBA 4IOCL 4A61A 4F8RA 3E9OA 1ZWWA 4B9UA 1KTQA 5AQLA 5AQKA 3UKRA 3DXMB 3VTHA 4FVMA 5FLXO 3WXMB 3D2FA 3VGLA 4AZHA 4O8KA 3CD6N 1VQ6N 3AV9A 4ISFA 5JLHA 1J54A 4KHQA 2DTUA 3TTCA 1EO1A 1BPRA 1EX4A 3HL8A 4BRIA 3ATUA 4CHZA 4DQ8A 3F9KA 4HR1A 3AAQA 1SAZA 3THXB 2O8BB 4ID1A 4FLWA 3CJAA 3T4AG 3EJRA 1WSIA 1SZ2A 1NK0A 1DKGD 1KFSA 3ZSRA 3PLTA 5CE3A 4DV1K 2ATQA 2W6LA 5BREA 3K5LA 1NWKA 3TSUA 4B1YB 3DXKA 3QIOA 4IWVA 2DY4A 4FWLA 4M41A 3TI0A 4DSLA 2EX3B 3KZBA 1ASVA 3SOGA 3V9SA 3VEVA 3ZSXA 3LAMA 3BUBA 5AFUH 5BRDA 4IFEA 4PQUA 1TL1A 1CZAN 2V0OA 2P9SA 2OZNB 3I55N 2Z1IA 1M1KO 2OPRA 4M7YA 1S22A 1K9MO 2Q31A 4F2RA 4OKJA 4ZTJA 4I1QA 5BPLA 4IO8A 3QNOA 2E2OA 2ZJPL 3ERCC 3O3NB 2NRRA 4M3ZA 3AVCA 1NK9A 2CH5A 5C5BB 3L3UA 1D9FA 5GIOA 1VRUA 2W40A 4BG8A 2QWRA 3VERA 3V6DA 1SU6A 2D0BA 1CXUA 4FWPA 1UOCA 2P9NB 4C8MA 3HSCA 1JCGA 4C1NK 3SPYA 3T3FA 3FZLA 4DLGA 1TKZA 4CK3A 3HZ6A 4BE2A 4YOUA 2WINM 4Z4EA 1WDZA 2GUIA 1TK0A 1Z26A 1JCEA 1ZXOA 1FXXA 2DFHA 4CJPA 2X3VA 2YJEA 3Q7BA 1Q81O 1SS6A 4CF1A 3MX2A 2P9UB 3BUZB 4IW0A 2FBTA 4OGEA 5AQFA 1NK4A 5AQSA 3AO2A 3LP3A 4BROA 3CFPA 4GMJB 4ILGB 3HO1A 3LMFA 1SQKA 4N47A 4DR7K 5AZIB 4CK1A 1WAFA 4E7LA 4AZCB 1QZ5A 3OYAA 3TARA 1HYSA 4CEBA 1HNWK 5LMUK 3LLLA 4IJNA 3RSEB 4MDAA 1SUFA 1NU0A 4LF5K 1URUA 2D0PA 4HVJA 2KTQA 1TYQA 3VEXA 3LDQA 2JNSA 3FFIA 3ZX2A 2NRTA 3J7YP 1JLFA 1QHAA 4EZYA 4NYFA 5LL6Z 3WNGA 4FJIA 4BRQA 3AVKA 5FIGA 5C24A 2D0CA 3A2FA 3LAKA 4YHHK 3HOSA 4IDHA 4FJLA 3CM6A 1TK8A 2HF4A 3CCQN 2F7TA 1GNLA 2I5JA 3F2KA 4KTQA 4H0PA 4A5AA 3N4QA 4PUOA 4BRMA 3CPWM 3LP0A 5J2PA 2EWSA 4DFKA 4CW7B 1JLQA 4XH4A 1U6ZA 4M63C 4JI8K 2IGIA 4W5QA 2PY5A 2G8IA 3NGZA 1LOTB 4OJRA 4WFAL 4JRQA 5AQPA 3EKUA 1NK8A 3RWUA 1S1VA 4CD3A 4M0MA 2AA4A 5CYMA 3QNJA 1T6CA 4I2QA 5M1KA 2VG6A 4K8XA 3LPTA 4KBOA 4M42A 3DRPA 1BQNA 3UKUA 3CFOA 4TSXA 5AQQA 5M1FA 3BVUA 5BR9A 2AP1A 2W41A 3NF6A 4H5WA 1GLEG 4CZHA 4B9NA 3ZT3A 3V9ZA 4E19A 3B6PA 1FW6A 3FZKA 3F9MA 2HNZA 3V9UA 4FLUA 5FRNA 2QFFA 5CZ2A 3ZEUA 3LALA 3CCMN 1JKHA 4E3CA 1KFDA 1HXKA 3DX4A 1MWMA 1J9AA 2V7ZA 4H6HA 3V4IA 3SLCA 2ZWHA 1U48A 4Z94A 2F8TA 4X64K 4HUFA 1YWMA 1TQSA 4GV6A 4JI6K 1JL1A 2KZMA 2P1JA 2WBNA 3HVTA 1QQMA 3DWLA 5LJVA 1S6QA 1SU7A 4IWPA 1TQVA 1NGDA 2VWBA 3L3VA 1WBDA 4KO0A 3OK8A 5AQHA 4LSLA 4AHVA 2E2NA 1X9WA 4BWMA 3WQUA 1WSGA 4JYAK 4FLVA 1CLQA 4FJKA 1U2VA 1W0HA 5MLCQ 3ZT2A 3ER8C 4J2AA 1DLOA 3ZETA 4JV5K 5C2FA 4BECA 1WN7A 4Z4FA 4QS7A 2X3XA 1S5JA 1NK5A 4CJFA 3G25A 4GW6A 5ADXH 3HM8A 3DDFA 1KC8O 4DTXA 4FOEA 1VRTA 1VQMN 4KIKB 3JYTA 2Q1NA 4IFYA 2GV9A 3E9LA 3THYA 3HSTB 3SI6A 2QEXN 4YNQA 2FSJA 3DJCA 3D0PA 3BF3A 3ZSQA 3OYCA 2A41A 2YNFA 4O5BA 2HHIA 3EKSA 4BG9A 1EP4A 2F7QA 2GEMA 3HAIA 5AZJA 4ELVA 2Q2RA 3CJCA 4YDUA 1S9GA 1NK7A 4G1QA 2VG7A 3KHYA 1YI2N 3SAGA 2E4LA 3LDLA 4B9LA 3O9RA 1SU8A 4CI6A 4BRDA 5E26A 2XY7A 1KAXA 1KLMA 2YI1A 4BRFA 3VGMA 4ILHB 4CERA 1YJ9N 7HSCA 4DV7K 1P90A 2OPSA 5AQNA 4FWOA 5GAHP 3HK2A 2QKKA 2RN2A 4NLCA 3BLBA 1XQSC 3MAQA 1ATNA 5GAEP 5HRRA 1MU2A 1IKWA 3LZJA 1XMOK 3QEPA 1QSLA 1RBSA 4OX9K 4ISEA 3QWEA 1SV5A 2OA8A 4NXMK 3G6EN 4WPCA 1IJJA 1NGFA 3DLBA 4H0OA 3T1YK 3SJHA 3PO5A 4DSKA 3CCUN 3VA0A 1ZBFA 2B4JA 4CGIA 4IFVA 3V1QA 4H5VA 4B1VA 1E3MA 1NLVA 4EZPA 3SAHA 3DRRA 3QB0A 4CZEA 2PMRA 4BR4A 2Y1IA 4B3RK 5C2DA 3SJJA 4RW8A 4CF8A 3U9DA 3K2PA 4FK4A 4EZ9A 3RR8A 2OTJN 4DV0K 4R5GA 1GLCG 2E6MA 2VGNA 3VQ4A 4DS5A 3PX0A 4CD1A 3CMEN 3T47A 3HAJA 3K57A 1BU6O 4RTFD 1OVYA 4I6MA 1N6QA 3R8EA 4N76A 3CV5A 2O8CB 2MI7A 1YT3A 2DPNA 1CXQA 3AY9A 5JVHL 1XMQK 4CJ7A 1W9HA 4IBNA 2HHTA 1KLNA 4CZJA 5J2QA 1TQTA 3AO3A 3TAGA 4DV2K 4WPEA 4AM6A 4DQQA 4DQIA 2P5OA 4CJ5A 4B9MA 1HYVA 2CGKA 5KTQA 1OH6A 2RAJA 1V4TA 3BUQA 3VQDA 2GF4A 1DKZA 2F8SA 2NRXA 1W2BM 4I7FA 3VQ7A 4BRKA 4ILHA 4CJWA 3CF5L 1VQON
chains in the Genus database with same CATH topology
3JXUA 3VGKA 4H0VB 2ASMA 4RWTA 5TKYA 5HL7L 5HOOA 3RSEA 1ZBSA 4Y0WA 4IWQA 3I01A 1YXQA 3MCAB 3P31A 4FWSA 4BRAA 4PKHA 2JWLA 3WXKA 3CCSN 1GLLO 3AGKA 5AQUA 1Q5LA 1BA1A 5LY3A 3IUCA 4H0YB 4JK9A 4YOTA 1DKXA 2BPRA 3A8YA 3FE1A 4CZIA 4EZNA 3VEOA 5H1SQ 4AM7A 3HRGA 4G6QA 3W0LA 4O8UA 3GOIA 4YOYA 1YAGA 4UDXX 2ZGZA 2C1GA 1G99A 4K25A 2QWLA 4GV9A 3P4IA 3D2EA 5FPDA 1U00A 5BRFA 2ZJRL 4GVEA 1K8KB 2HF3A 4MDBA 4CZFA 4A61A 4IOCL 2JWKA 3E9OA 3IDHA 1OA1A 3CC7N 1VQKN 5C15A 2QA4N 3CI5A 1K8AO 3CC2N 3VMFB 3EZWA 3KVGA 3QMLA 3ENOA 5AQKA 1NMDA 1W97L 3DXMB 1OAOA 5AQLA 3UKRA 3VTHA 4H5NA 4C1NI 3DPOA 3MCPA 5BRHA 3FR0A 2WUSA 3MK6A 3WXMB 2GWJA 5CHIA 3D2FA 3H1QA 4FWKA 3VGLA 2J4RA 3BP8A 1Z6RA 4HTLA 4O8KA 2ND1A 4JKBA 3VF4A 3CD6N 1VQ6N 4BR2A 3TU5A 2P9IA 4ISFA 5JLHA 3TTCA 4JKAA 3ULEB 4JKCA 3O6WA 4EHTA 5GIPA 3A98A 2E20A 1BPRA 3C65A 5KPRA 1GNTA 1EO1A 1NJIO 3GDQA 3OWGA 4C23A 3O9SA 4BRIA 3ATUA 1RDWX 1V4SA 4FWQA 3T46A 2Q0RA 1VAZA 5AQOA 4DQ8A 4BE7B 4HR1A 3AAQA 4M7XA 3ID8A 1SAZA 4IWOA 4EZQA 4KIKA 4BC2A 4CBWA 4IOAL 3W3DA 4WV7A 1Y64A 3OBWA 1WUAA 3T4AG 3CJAA 3QFPA 4FVUA 4HWIA 1CKRA 1SZ2A 3QBXA 5C12A 5ADXA 2E88A 1DKGD 1D4XA 2BH1A 4JAXA 4GY2B 3P38A 4BC3A 1NGAA 1RGIA 4JEPA 5C10A 3DLLL 1ZYLA 3M5RA 1BOTO 2HBKA 3L6QA 5CE3A 3CCLN 2OTLN 2YIBA 5BREA 1ESVA 4CZKA 3PIPL 4JD2A 5AQGA 1NWKA 2GELA 3TSUA 3L4QA 4R79A 4B1ZA 4I6MB 1X3NA 4B1YB 3QICA 4EIAA 4JKHA 3DXKA 2KLAA 3OA9A 3ENBA 3SAFA 3CJBA 4IWVA 3SBTB 3H1VX 4FWLA 2QXLA 3G71N 3C7NB 2RT6A 5EXWA 2A5XA 2EX3B 2GUPA 3CQXA 3KZBA 3LM2A 2QW9A 2QWMA 1QZ6A 3CMAN 4DCHA 4QS8A 2FF6A 1VQ7N 3QA8A 1NM1A 3VEVA 3T48A 3F5TA 3VETA 2GTDA 3QBWA 5AFUH 3TSPA 4FPBA 4IFEA 2P9LA 3T69A 1CZAN 5BRDA 1YJNN 3CCEN 4CBUA 4L3QA 2WC9A 2P9SA 5GADP 2LM0A 3I55N 4IM3A 3O9UA 1M1KO 1VQ5N 2NZTA 1E4GT 4R5LA 4D8JA 1HPMA 1S22A 2BTFA 1KAZA 3BEXA 3D2FB 2Q31A 4M7YA 2V7YA 4I43A 4XH1A 1K9MO 3MN5A 4PL7A 4PKGA 3UKRB 5BPLA 1YVNA 4BVOA 2P9KB 4IO8A 1OA0A 4WF9L 2E2OA 2ZJPL 1VQ9N 4GNIA 3DPQA 3ERCC 3O3NB 2NNWA 2NRRA 3SBSA 2ZF5O 3O5BA 5AR0A 3R9PA 3MWTA 4CZGA 2CH5A 3DOBA 3CCVN 3VF2A 1MA9B 3HOTA 4FWMA 5GIOA 2W40A 1C0GA 1OKJA 4BG8A 2QWRA 2UYTA 5F2RA 3VERA 3WUHA 1SU6A 4JN4A 4FWPA 2P9NB 3HSCA 3ZEFA 1JCGA 3M1FA 4C1NK 3FZLA 4FOIA 2P9IB 4FPAA 4BRPA 4CZLA 1GLAG 4EZSA 4WQ5A 2ZGYA 3HZ6A 3O9TA 5DM7L 4YOUA 2PBDA 4K43A 2WINM 1TUUA 4DHYA 4IOXA 1WOQA 2RE2A 3CQYA 3DXMA 1JJ2M 4AF1A 1JCEA 1ZXOA 2ASOA 5AQWA 4BR5A 4WQ4C 4A5BA 4BY9C 1N8RO 3FFKB 1YUWA 3I8BA 4RCHA 3PIOL 2YJEA 3Q7BA 3CXCM 1Q81O 1SS6A 4JWCA 3MX2A 5TKWA 2P9UB 3ENHA 3TTDA 3E1YA 5AZIA 5JICA 1XUPO 2IVPA 3BUZB 4IW0A 3O3OB 2HSTA 3JS6A 3LDOA 5GINA 5AQFA 4YOXA 3CCRN 3I33A 3KWIA 5AQSA 4BROA 4PO2A 2IVNA 5AQJA 4BQLA 4FSVA 1KAYA 4CBXA 1QQOA 5BPNA 4ILGB 5DM6L 3LMFA 3KDRA 1C0FA 1SQKA 3VENA 3SMPA 4GV3A 1NGIA 5AZIB 1RDUA 4KH4A 2QM1A 3CERA 3C6HA 2Z8YA 2E1YA 1QZ5A 4EFHA 2I7NA 2YX6A 4IJNA 3RSEB 2ASPA 4MDAA 2Q36A 1QVFM 3M3ZA 1SUFA 2NRWA 2GX9A 2P9KA 4JD2B 5BN8A 3B53X 2D0PA 4JKGA 3DAWA 1HUXA 1TYQA 3VEXA 3LDQA 3H45C 5EY4A 2JNSA 4YOVA 4IEEA 1VQLN 3ZX2A 1YHQN 4PKIA 4FO0A 2NRTA 3WEEA 3WXJA 3O4WA 4MLEA 3OBYA 1QHAA 4EZYA 4BRQA 4UDYX 3O1BA 3MDQA 4JL9A 2H3GX 3L0QA 4KH5A 5FIGA 5AQRA 2QWPA 2FLOA 2CGJA 3EO3A 4IDHA 3ZX3A 3HOSA 2Q0UA 4H03B 3Q7CA 2KHOA 4KH6A 1HLUA 2HF4A 3CCQN 1X3MA 2F7TA 3UE5A 3G4SN 1GNLA 2ITMA 3CJ7A 3F2KA 4BRCA 4EZOA 2YCHA 4H0PA 4A5AA 1T44A 3N4QA 2YIAA 4IJAA 5GAGP 4WQ4A 4F00A 3A5LC 4BRMA 3CPWM 4JWIA 2EWSA 3E9PA 3TTFA 3O8MA 1HKBA 1KQSM 4DB3A 3T49A 4XH4A 4JKEA 1U6ZA 3IFRA 3OHXM 1NGEA 4JHDB 4M63C 5M1QA 1QVGM 1J6ZA 1RFQA 2OANA 4MO4A 2HBLA 3I39X 3CJ1A 3CHWA 2IIRA 5EX5A 2F9WA 1ATRA 2YHYA 3QFUA 3R1XA 4YORA 4IXCA 3WT0A 1LOTB 4WFAL 5AQPA 3VOVA 1H1VA 3RV1A 2HMPA 3EKUA 3MN9A 4M0MA 4HR1B 1E4FT 2AA4A 4CD3A 1XC3A 3QNJA 1T6CA 1DEJA 2E2QA 4B1XB 4DKWA 1MJGA 5M1KA 1BG3A 3C0BA 3DXKB 4KBOA 3CC4N 4U7BA 1YITN 1EQYA 1GLFO 3UKUA 1HJOA 1TYQB 5AQQA 4NB4A 4ILJA 5M1FA 4A59A 5KQ8A 4JLCA 3VF6A 5BR9A 2V52B 2AP1A 2NRHA 2W41A 5M1OA 3ATVA 2NRZA 4A57A 3U9ZA 4BC4A 4BR7A 1KD1O 4H5WA 3I04A 1GLEG 3UB5A 4CZHA 3A5MC 3CETA 3VEYA 4EZTA 4JKFA 3R3LA 5LJWA 1UPXA 2P9LB 3GL1A 4IEIA 2I7PA 3EN9A 1TUYA 2HBMA 3KK7A 3QDKA 1VQNN 4EZVA 1Q18A 5ELZA 5I9EB 4K42A 2QTDA 3FZKA 3F9MA 3L4IA 4LC9B 2P9NA 4JNEA 1Q86O 2WFBA 3A5OC 2QFFA 3ZEUA 3FD9A 3CCMN 2KKZA 5AQXA 2HBJA 4E3CA 5AQZA 3F7WA 1ATSA 1K8KA 3VEAA 2E8AA 5KPZA 1MWMA 1JCFA 3GG4A 3O3MB 3D6RA 4U67L 4MO5A 2V7ZA 4H6HA 3LDNA 1M90O 4OPHA 4XEIA 3SLCA 1YF5L 3OHRA 2ZWHA 3H3NO 3O80A 2P9PA 4Z94A 4FL9A 5AQVA 1NGJA 2NLXA 4JK8A 2VCPA 4GV6A 2A6AA 2YJFA 2YIVX 4K41A 4R5KA 3AGRA 1HKCA 2P9UA 3GE1A 1BO5O 4WFNL 2WBNA 3L3OM 5EVZA 1QQMA 2Q97A 3DWLA 5LJVA 2FSNA 2PFUA 3N4PA 3ZX0A 1SU7A 2P9PB 4IWPA 1NGDA 5AZJB 2VWBA 2X5CA 1GLBG 1P8ZA 1QQNA 3T7ZA 3RVCA 3AARA 3U8XA 4BREA 4H5RA 5AQHA 3B52X 2IVOA 1DKYA 3GBTA 1KXPA 2E2NA 2QI2A 3FZHA 4BEBA 3WQUA 3NVMA 3CIPA 1GLDG 3A5NC 5AQTA 4ILGA 3ZYYX 1U2VA 1S72N 1ZC6A 3IKMA 1IG8A 2VGMA 3KAWA 5MLCQ 3D2EB 3LL3A 1HKGA 3ER8C 1VQPN 2YI9A 3HTVA 3O9QA 4JKGB 3ZETA 3NVKA 3KWGA 5C2FA 5EOYA 3ULEA 4BECA 3FLCO 4WCEL 4QS7A 5JVGL 1Q7YO 3WEEB 4JHDA 1MWKA 3G25A 2GAFD 5ADXH 3HM8A 1DT9A 1NBWA 2D0OA 4JKDA 5KPTA 4WFBL 1KC8O 4FOEA 4ILIA 2NRVA 1LCUA 2QWOA 3LDPA 3ZETB 3N8EA 4KIKB 2CGLA 1BDGA 2Q1NA 3U4LA 4YOWA 1VQMN 3B8AX 4MQDA 3E9LA 4O5FA 3R6MA 4A2BA 1Z05A 2D1KA 1HX1A 3M6GA 4B1UB 5JLFA 1R59O 4A2AA 2QEXN 5AFUA 2FSJA 3DJCA 4IO9L 3NMUA 3VEBA 3BF3A 3IMXA 2PAVA 4BRNA 4BRHA 2A41A 3I56N 2N3KA 1T6DA 3MMVA 1VQ8N 1NGCA 2E1ZA 3EKSA 4QS9A 4JNFA 1DGKN 4BG9A 4IM2A 2GWKA 4J8FA 5BPMA 2A42A 4BRGA 4NLBA 4BGBA 2GEMA 4BR9A 5AZJA 3HBTA 2Q2RA 3CJCA 4YDUA 2BUPA 3UITA 5M1NA 2RHKA 5FPEA 3SMSA 4WYBA 1GN9A 2NCZA 3SBGA 3KHYA 3H46O 2GA9D 3H6EA 3EE9A 4BC5A 4BGAA 2D4WA 5B8HA 3GI7A 3SAGA 1YI2N 3LDLA 1E2UA 3O9RA 3TSQA 1SU8A 3DQGA 3WQTA 4BRDA 3ZEDA 5FPMA 2YHXA 1NGBA 5FLEX 4CI6A 4OO1J 4H0XB 2A40A 1KAXA 4MLHA 2YI1A 5E26A 4B1WB 4BRFA 5F1XA 5KQDA 3DPPA 3VGMA 4ILHB 3K9JA 3UKUB 1YJ9N 7HSCA 1P90A 1BUPA 1U2VB 2QWQA 3O08A 5AQNA 4A62A 5F0XA 4WV5A 3EL2A 4FWOA 5GAHP 4EAHD 3ER9B 5BN9A 3MWPA 3C7NA 2YHWA 2FSKA 3FZFA 4NLCA 1X9JA 1XQSC 4UY8O 5C0YA 3AAPA 1ATNA 1GLJO 5GAEP 3S41A 4R5IA 3VTIA 4YDUC 4F9OA 1Q82O 3FGUA 3VESA 4BRLA 4PHTX 4ISEA 3WXLA 5AQYA 3FZMA 1BWFO 3G6EN 3CCJN 1NGFA 1IJJA 3CJ9A 1T3VA 3TPQA 4E1JA 1VQ4N 2W00A 4H0OA 4FWRA 2EWFA 3SJHA 2ND0A 3BF1A 3CCUN 3P39A 4EZRA 2QWNA 3C6AA 1W9MA 1BA0A 4PL8A 3VEWA 4H5VA 4B1VA 1NLVA 1YIJN 4EZPA 5CR4A 4F01A 3HI0A 4XH5A 2OBMA 3QB0A 3SAHA 4JWEA 1O13A 2PY6A 4CZEA 3PLAA 4H6IA 4BR4A 3CPEA 4B9QA 4FWNA 5C2DA 2OBLA 3U9DA 2HOEA 5JMVA 5M1PA 2ZJQL 3MX5A 2FF3B 4IZ9A 3RV0A 3H0XA 1NGGA 2OTJN 4HY9A 4R5GA 5AQIA 4EZZA 1GLCG 2VGNA 3A0IX 4H0TB 3VEZA 3SBTA 4CD1A 3T47A 3SK3A 3CMEN 4IM0A 4EZWA 1BU6O 4XJXA 3VPZA 4FM3A 4RTFD 1OVYA 4I6MA 3R8EA 3MN6A 4EZUA 3ID6A 2OP6A 3VKHA 2V51B 3K9KA 4G9ZA 1ILYA 2F9TA 2YI8A 2DPNA 1S3XA 3D7EO 3AY9A 4JK7A 4EHUA 4CJ7A 5JVHL 4ISGA 4E81A 5FPNA 3E66A 2P9SB 4OPAA 4CZJA 3B51X 1MDUB 1NGHA 4BR0A 1DG4A 5AQMA 4JWDA 4AM6A 1E1DA 2A3ZA 4EZXA 4R5JA 2CH6A 2CGKA 4CZMA 3J7ZO 3WXIA 1YJWN 2C1IA 1V4TA 4BVPA 5E84A 4HYBA 2E2PA 1DKZA 3OW2M 3EE8A 2VYPA 1E9VA 4NO7A 4H5TA 4BQZA 4WQ5C 4NPHA 3LM9A 2NRXA 3J8AA 1K73O 1W2BM 3MN7A 4BRKA 2FXUA 4ILHA 3KAVA 3H3OB 3ZEUB 3CF5L 3O1WA 1JQKA 1VQON
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXU A;  3VGK A;  4H0V B;  2ASM A;  4RWT A;  5TKY A;  3RSE A;  1ZBS A;  4Y0W A;  1YXQ A;  4FWS A;  4BRA A;  4PKH A;  3WXK A;  1GLL O;  5AQU A;  1Q5L A;  1BA1 A;  5LY3 A;  3IUC A;  4H0Y B;  1DKX A;  2BPR A;  3A8Y A;  3FE1 A;  4CZI A;  4EZN A;  3VEO A;  4AM7 A;  3W0L A;  3GOI A;  1YAG A;  2ZGZ A;  1G99 A;  4K25 A;  2QWL A;  3P4I A;  3D2E A;  5FPD A;  1U00 A;  5BRF A;  1K8K B;  2HF3 A;  4CZF A;  4A61 A;  3IDH A;  3CI5 A;  3EZW A;  3KVG A;  3QML A;  3ENO A;  5AQK A;  1NMD A;  5AQL A;  3DXM B;  3UKR A;  4H5N A;  5BRH A;  3DPO A;  3MCP A;  3FR0 A;  2WUS A;  3MK6 A;  2GWJ A;  3D2F A;  3H1Q A;  4FWK A;  3VGL A;  2J4R A;  3BP8 A;  1Z6R A;  4HTL A;  4O8K A;  3VF4 A;  4BR2 A;  3TU5 A;  2P9I A;  4ISF A;  5JLH A;  3ULE B;  4EHT A;  3O6W A;  2E20 A;  1BPR A;  5KPR A;  3GDQ A;  4C23 A;  4BRI A;  3ATU A;  1RDW X;  1V4S A;  4FWQ A;  3T46 A;  2Q0R A;  5AQO A;  4DQ8 A;  3AAQ A;  4M7X A;  3ID8 A;  1SAZ A;  4EZQ A;  4BC2 A;  4CBW A;  3W3D A;  4WV7 A;  1Y64 A;  1WUA A;  3T4A G;  3CJA A;  3QFP A;  4HWI A;  1CKR A;  1SZ2 A;  3QBX A;  5ADX A;  2E88 A;  1DKG D;  1D4X A;  4JAX A;  4GY2 B;  4BC3 A;  1NGA A;  1RGI A;  5CE3 A;  1BOT O;  3L6Q A;  5BRE A;  1ESV A;  4CZK A;  4JD2 A;  5AQG A;  1NWK A;  2GEL A;  4B1Z A;  4I6M B;  1X3N A;  4B1Y B;  3QIC A;  4EIA A;  3DXK A;  3CJB A;  4IWV A;  3H1V X;  4FWL A;  2QXL A;  3C7N B;  5EXW A;  2A5X A;  2GUP A;  3CQX A;  3LM2 A;  3KZB A;  2QW9 A;  2QWM A;  1QZ6 A;  4DCH A;  4QS8 A;  2FF6 A;  1NM1 A;  3VEV A;  3T48 A;  3VET A;  2GTD A;  3QBW A;  5AFU H;  5BRD A;  4FPB A;  2P9L A;  1CZA N;  4CBU A;  4L3Q A;  2P9S A;  2NZT A;  1E4G T;  4R5L A;  1HPM A;  1S22 A;  3BEX A;  2BTF A;  1KAZ A;  3D2F B;  4M7Y A;  2Q31 A;  4XH1 A;  2V7Y A;  3MN5 A;  4PL7 A;  4PKG A;  3UKR B;  5BPL A;  1YVN A;  4BVO A;  2P9K B;  4IO8 A;  2E2O A;  4GNI A;  3DPQ A;  3O5B A;  2ZF5 O;  5AR0 A;  3R9P A;  4CZG A;  2CH5 A;  3DOB A;  3VF2 A;  1MA9 B;  4FWM A;  2W40 A;  1C0G A;  1OKJ A;  4BG8 A;  2QWR A;  2UYT A;  5F2R A;  3VER A;  3WUH A;  4JN4 A;  4FWP A;  2P9N B;  3HSC A;  1JCG A;  3M1F A;  3FZL A;  4FOI A;  2P9I B;  4FPA A;  4BRP A;  4CZL A;  1GLA G;  4EZS A;  4WQ5 A;  2ZGY A;  3HZ6 A;  2PBD A;  4K43 A;  2WIN M;  1TUU A;  4DHY A;  1WOQ A;  3CQY A;  3DXM A;  1JCE A;  1ZXO A;  2ASO A;  5AQW A;  4BR5 A;  4WQ4 C;  3FFK B;  1YUW A;  3I8B A;  4RCH A;  2YJE A;  4JWC A;  5JIC A;  2P9U B;  3ENH A;  5AZI A;  1XUP O;  2IVP A;  3BUZ B;  3JS6 A;  3LDO A;  5AQF A;  3I33 A;  5AQS A;  4BRO A;  4PO2 A;  2IVN A;  5AQJ A;  4BQL A;  4FSV A;  1KAY A;  4CBX A;  1QQO A;  5BPN A;  1C0F A;  1SQK A;  3VEN A;  3SMP A;  1NGI A;  5AZI B;  2QM1 A;  3CER A;  2E1Y A;  1QZ5 A;  4EFH A;  2I7N A;  4IJN A;  3RSE B;  2ASP A;  2Q36 A;  3M3Z A;  2P9K A;  4JD2 B;  5BN8 A;  2D0P A;  3DAW A;  1HUX A;  1TYQ A;  3VEX A;  3LDQ A;  3H45 C;  5EY4 A;  3ZX2 A;  4PKI A;  4FO0 A;  3WEE A;  3WXJ A;  3O4W A;  4MLE A;  1QHA A;  4EZY A;  4BRQ A;  3O1B A;  3MDQ A;  2H3G X;  3L0Q A;  5AQR A;  2QWP A;  2FLO A;  2CGJ A;  3EO3 A;  3ZX3 A;  2Q0U A;  4H03 B;  2KHO A;  1HLU A;  2HF4 A;  1X3M A;  3UE5 A;  2ITM A;  3CJ7 A;  4BRC A;  4EZO A;  2YCH A;  4H0P A;  1T44 A;  4IJA A;  4WQ4 A;  4F00 A;  3A5L C;  4BRM A;  4JWI A;  2EWS A;  3O8M A;  1HKB A;  4DB3 A;  3T49 A;  4XH4 A;  1U6Z A;  3IFR A;  3OHX M;  1NGE A;  4JHD B;  4M63 C;  1J6Z A;  1RFQ A;  2OAN A;  4MO4 A;  3CJ1 A;  3CHW A;  2IIR A;  5EX5 A;  2F9W A;  1ATR A;  2YHY A;  3QFU A;  4IXC A;  3WT0 A;  1LOT B;  5AQP A;  3VOV A;  1H1V A;  2HMP A;  3EKU A;  3MN9 A;  4CD3 A;  1E4F T;  2AA4 A;  1XC3 A;  3QNJ A;  1T6C A;  1DEJ A;  2E2Q A;  4B1X B;  1BG3 A;  3C0B A;  3DXK B;  4KBO A;  1EQY A;  1GLF O;  3UKU A;  1HJO A;  1TYQ B;  5AQQ A;  4NB4 A;  5KQ8 A;  3VF6 A;  5BR9 A;  2V52 B;  2AP1 A;  2NRH A;  2W41 A;  4BC4 A;  3ATV A;  3U9Z A;  4BR7 A;  4H5W A;  1GLE G;  3UB5 A;  4CZH A;  3A5M C;  3CET A;  3VEY A;  4EZT A;  5LJW A;  2P9L B;  3GL1 A;  2I7P A;  3EN9 A;  1TUY A;  3QDK A;  4EZV A;  1Q18 A;  5ELZ A;  5I9E B;  4K42 A;  3FZK A;  3F9M A;  3L4I A;  4LC9 B;  2P9N A;  4JNE A;  3A5O C;  2QFF A;  3ZEU A;  5AQX A;  5AQZ A;  1ATS A;  1K8K A;  2E8A A;  5KPZ A;  1MWM A;  1JCF A;  3GG4 A;  4MO5 A;  2V7Z A;  4H6H A;  3LDN A;  4XEI A;  3SLC A;  3OHR A;  2ZWH A;  3H3N O;  3O80 A;  2P9P A;  4Z94 A;  4FL9 A;  5AQV A;  1NGJ A;  2NLX A;  2VCP A;  2A6A A;  2YJF A;  4K41 A;  4R5K A;  1HKC A;  2P9U A;  3GE1 A;  1BO5 O;  3L3O M;  5EVZ A;  1QQM A;  2Q97 A;  3DWL A;  5LJV A;  2FSN A;  3ZX0 A;  2P9P B;  5AZJ B;  1NGD A;  2VWB A;  1GLB G;  1P8Z A;  1QQN A;  4BRE A;  3AAR A;  3U8X A;  4H5R A;  5AQH A;  2IVO A;  1DKY A;  3GBT A;  1KXP A;  2E2N A;  3FZH A;  3WQU A;  3CIP A;  1GLD G;  3A5N C;  5AQT A;  1U2V A;  1ZC6 A;  1IG8 A;  3D2E B;  3LL3 A;  1HKG A;  3HTV A;  3ZET A;  5EOY A;  3ULE A;  3FLC O;  4QS7 A;  3WEE B;  4JHD A;  1MWK A;  3G25 A;  5ADX H;  3HM8 A;  1NBW A;  2D0O A;  5KPT A;  4FOE A;  3ZET B;  2QWO A;  1LCU A;  3LDP A;  3N8E A;  2CGL A;  3U4L A;  1BDG A;  2Q1N A;  3B8A X;  4O5F A;  3R6M A;  4A2B A;  1Z05 A;  2D1K A;  1HX1 A;  3M6G A;  4B1U B;  5JLF A;  1R59 O;  4A2A A;  5AFU A;  2FSJ A;  3DJC A;  3BF3 A;  4BRN A;  3IMX A;  2PAV A;  4BRH A;  2A41 A;  3MMV A;  1T6D A;  1NGC A;  2E1Z A;  3EKS A;  4QS9 A;  4JNF A;  1DGK N;  4BG9 A;  2GWK A;  4J8F A;  5BPM A;  2A42 A;  4BRG A;  4BGB A;  2GEM A;  4BR9 A;  5AZJ A;  3HBT A;  2Q2R A;  3CJC A;  4YDU A;  2BUP A;  5FPE A;  3SMS A;  4WYB A;  3KHY A;  3H46 O;  3H6E A;  4BC5 A;  4BGA A;  5B8H A;  2D4W A;  3LDL A;  3WQT A;  3DQG A;  4CI6 A;  4BRD A;  5FPM A;  2YHX A;  1NGB A;  4H0X B;  2A40 A;  1KAX A;  4MLH A;  2YI1 A;  5E26 A;  4B1W B;  4BRF A;  5F1X A;  5KQD A;  3DPP A;  3VGM A;  3UKU B;  7HSC A;  1BUP A;  1U2V B;  2QWQ A;  3O08 A;  5AQN A;  4A62 A;  5F0X A;  4WV5 A;  3EL2 A;  4FWO A;  4EAH D;  5BN9 A;  3C7N A;  2YHW A;  2FSK A;  3FZF A;  1X9J A;  1XQS C;  3AAP A;  1ATN A;  1GLJ O;  3S41 A;  4R5I A;  4YDU C;  4F9O A;  3FGU A;  3VES A;  4BRL A;  4ISE A;  3WXL A;  5AQY A;  3FZM A;  1BWF O;  1NGF A;  1IJJ A;  3CJ9 A;  3TPQ A;  4E1J A;  4H0O A;  4FWR A;  3SJH A;  3BF1 A;  4EZR A;  2QWN A;  1BA0 A;  4PL8 A;  3VEW A;  4H5V A;  4B1V A;  1NLV A;  4EZP A;  4F01 A;  3HI0 A;  4XH5 A;  3QB0 A;  4JWE A;  4CZE A;  4H6I A;  4BR4 A;  4B9Q A;  4FWN A;  3U9D A;  2HOE A;  5JMV A;  2FF3 B;  4IZ9 A;  3H0X A;  1NGG A;  4HY9 A;  4R5G A;  5AQI A;  4EZZ A;  1GLC G;  3A0I X;  4H0T B;  3VEZ A;  4CD1 A;  3T47 A;  3SK3 A;  4EZW A;  1BU6 O;  3VPZ A;  4RTF D;  4I6M A;  3R8E A;  3MN6 A;  4EZU A;  2OP6 A;  2V51 B;  2F9T A;  2DPN A;  1S3X A;  3D7E O;  3AY9 A;  4EHU A;  4CJ7 A;  4ISG A;  4E81 A;  5FPN A;  2P9S B;  4CZJ A;  1MDU B;  1NGH A;  4BR0 A;  1DG4 A;  5AQM A;  4JWD A;  4AM6 A;  2A3Z A;  4EZX A;  4R5J A;  2CH6 A;  2CGK A;  4CZM A;  3WXI A;  1V4T A;  4BVP A;  5E84 A;  4HYB A;  2E2P A;  1DKZ A;  2VYP A;  4NO7 A;  4H5T A;  4BQZ A;  4WQ5 C;  3LM9 A;  3J8A A;  3MN7 A;  4BRK A;  2FXU A;  3H3O B;  3ZEU B;  3O1W A; 
#chains in the Genus database with same CATH topology
 3LP2 A;  4CFC A;  3LWL A;  3JXU A;  5TKY A;  1R34 A;  2X78 A;  1ZBS A;  3I01 A;  3P31 A;  2JWL A;  3CCS N;  2YHB A;  1BA1 A;  1BIU A;  2B6A A;  4CF0 A;  4DTR A;  1DKX A;  3M8P A;  2ZXQ A;  3JSM A;  1RT1 A;  3W0L A;  2P5G A;  1YAG A;  4UDX X;  1RBV A;  4H4O A;  4FLZ A;  1BQM A;  2ZJR L;  4CGF A;  4CZF A;  4FK0 A;  3OYM A;  3AO1 A;  1VSL A;  1IKY A;  1C6V A;  1HQE A;  3KVG A;  3KK3 A;  4DSE A;  4AKV A;  1O7D C;  3SQ4 A;  4C1N I;  4H5N A;  2G8F A;  3DPO A;  4KRF A;  2Z1G A;  3L3P A;  3ZT1 A;  5CHI A;  4JKB A;  5KGW A;  4AH9 A;  4BR2 A;  1VSM A;  3MXM A;  4F3T A;  2VQF K;  1FKP A;  3ULE B;  4JKC A;  3O6W A;  3VQC A;  4EHT A;  3A98 A;  5KPR A;  1XNR K;  4FJM A;  1BL3 A;  3BVT A;  1RDW X;  5DK5 A;  4BE0 A;  2UUC K;  3RTV A;  4RW9 A;  2R7Y A;  4M3U A;  3ID8 A;  4IWO A;  3C6U A;  4KIK A;  1QSS A;  3AA3 A;  4DR6 K;  2ALW A;  4JI3 K;  4W5R A;  1RT2 A;  5ADX A;  3SUP A;  1DTT A;  3P83 D;  1EKE A;  3P38 A;  1RGI A;  1BOT O;  3CCL N;  2OTL N;  2YIB A;  3PIP L;  4JD2 A;  1L3T A;  3OJU A;  1LAV A;  4I6M B;  3THW A;  2PYJ A;  3QIC A;  2UU9 K;  2KLA A;  3OA9 A;  3ENB A;  4YY3 K;  1D8Y A;  1D5A A;  5KRS A;  1VSK A;  3ULD A;  3NF8 A;  4Z4G A;  2A5X A;  2GUP A;  2ETJ A;  1WSF A;  3CQX A;  4B3M K;  2QWM A;  3CMA N;  3QA8 A;  1NM1 A;  3BUD A;  4JI4 K;  4FCY A;  4KB1 A;  4Y1D A;  4FPB A;  1YJN N;  3T69 A;  4CBU A;  4DU3 A;  4NCA A;  3AVH A;  5GAD P;  3SUQ A;  4IM3 A;  3M3W A;  4O8U A;  2NZT A;  4R5L A;  4D8J A;  3BEX A;  2BTF A;  1KAZ A;  3MN5 A;  4PL7 A;  4J2E A;  3HPO A;  3UKR B;  3DOK A;  1YVN A;  3NFA A;  4F2S A;  1XHX A;  4WF9 L;  4NXN K;  1VQ9 N;  2F7P A;  4GNI A;  3DDG A;  1ITG A;  3HPG A;  2NNW A;  1VK0 A;  3R9P A;  4DYL A;  1IO2 A;  3QEW A;  3HOT A;  4AZ7 A;  2UUB K;  5A2Q O;  4LF8 K;  1I4T A;  1UWB A;  4DFM A;  4W5T A;  1KVB A;  3M1F A;  4FPA A;  4BRP A;  3TAE A;  1BHL A;  1JLE A;  4AZ6 A;  3EJU A;  4CJT A;  4WQ5 A;  2XY6 A;  2ZGY A;  4M3R A;  3O9T A;  4AHU A;  3UIQ A;  4KI4 A;  2PBD A;  4H4M A;  1TUU A;  2IAJ A;  1WOQ A;  1RBR A;  2RE2 A;  4FW2 A;  3G9G A;  4AF1 A;  2WOM A;  4E89 A;  4BR5 A;  4WQ4 C;  4A5B A;  4BY9 C;  3FFK B;  3PIO L;  3JAM O;  5HRO A;  5D3G A;  4JWC A;  3AVJ A;  3ENH A;  3E1Y A;  1I3A A;  3ITH A;  4MFB A;  4JS4 A;  1T05 A;  2HST A;  3OYI A;  3VQB A;  2O8C A;  4Q0B A;  1JLC A;  2ZE2 A;  4FZP A;  3OYF A;  5AQJ A;  4CBX A;  1KAY A;  3KDR A;  4ELT A;  4AZB A;  1NGI A;  4HUE A;  1RDU A;  2O8E A;  3NAE A;  2Z8Y A;  4C8K A;  3EY1 A;  4OLB A;  3M8Q A;  2I7N A;  1RDC A;  1IH7 A;  3TAN A;  2JGU A;  3LZI A;  3B53 X;  4JKG A;  2LXY A;  4KI6 A;  1Z25 A;  5EY4 A;  4DUY K;  4IEE A;  1VQL N;  1YHQ N;  4DSJ A;  4FO0 A;  3G10 A;  3WXJ A;  3MED A;  4YFU A;  3OBY A;  3KTQ A;  3SV4 A;  3O1B A;  2H3G X;  3K59 A;  2Z0N A;  2QWP A;  2YL5 A;  3EO3 A;  2Q0U A;  3Q7C A;  2KHO A;  4FYD A;  3SQ0 A;  4C8N A;  3KD1 E;  1X3M A;  2YV0 X;  1SKS A;  4LF6 K;  2ITM A;  5HLF A;  4IKF A;  3WNH A;  1TV6 A;  3SUO A;  4CFD A;  4BRC A;  4EZO A;  2XRI A;  3BGR A;  4CGJ A;  1T44 A;  4IJA A;  2YIA A;  3SCX A;  1K6Y A;  2HB5 A;  1XHZ A;  1TAU A;  3A5L C;  2IOC A;  4DB3 A;  1KVC A;  3OYD A;  1NGE A;  3ZLJ A;  3DLG A;  4JHD B;  2IS3 A;  2OAN A;  4MO4 A;  3I39 X;  3CHW A;  4AIL C;  3OTO K;  2YHY A;  3KIO A;  3QFU A;  4YOR A;  5HBM A;  3KLE A;  3OYN A;  4LY7 A;  3L2U A;  3VOV A;  3PX6 A;  3MN9 A;  1E4F T;  3SAF A;  4B1X B;  1DEJ A;  1NJW A;  1IBL K;  4DKW A;  1BG3 A;  3CC4 N;  4DFP A;  1YIT N;  1EQY A;  4LD0 A;  1JLG A;  1TYQ B;  4B9V A;  5KQ8 A;  2OPQ A;  3VF6 A;  3ATV A;  1KD1 O;  1S1T A;  4NCB A;  4N5S A;  4EZT A;  4JKF A;  5LJW A;  1NMN A;  5T7B A;  2Z0O A;  3EN9 A;  2Q12 A;  2HBM A;  3G0Z A;  2O8E B;  3LWM A;  2HVI A;  5I9E B;  3TR8 A;  4K42 A;  4CJ4 A;  2KFZ A;  2P9N A;  4HUG A;  2WFB A;  4JS5 A;  3A5O C;  1EWQ A;  4DTU A;  2E6L A;  3VEA A;  3SPZ A;  3GG4 A;  2XY8 A;  3O3M B;  3D6R A;  3V1O A;  1Q9Y A;  5K14 A;  4KHP K;  3LDN A;  4OPH A;  3LAN A;  4K8Z A;  3H3N O;  5AQV A;  2NLX A;  2OZS A;  4C8L A;  4K41 A;  4R5K A;  1HKC A;  2P9U A;  1BGX T;  4WFN L;  1BIZ A;  5EVZ A;  3J81 O;  1QHT A;  3VQE A;  2YL8 A;  3RRH A;  4DTS A;  2FSN A;  3ZX0 A;  2X5C A;  4CEC A;  3AAR A;  4GKK K;  1HPZ A;  3L2W A;  2IVO A;  1VSD A;  4IG3 A;  1DKY A;  3GBT A;  4FZO A;  4C8O A;  1Q9X A;  3LPU A;  1X1P A;  1RT5 A;  4OPK A;  2VQE K;  4JRP A;  3DI6 A;  5AQT A;  4OLA A;  3D45 A;  3O4Q A;  2YI9 A;  3NVK A;  4O4G A;  1QS4 A;  1SKW A;  5EOY A;  3THV A;  3FLC O;  5JVG L;  1HWW A;  4JHD A;  1MWK A;  4CVN E;  3QEX A;  4JKD A;  5KPT A;  2YKN A;  4WFB L;  3S5T A;  4JI2 K;  3QET A;  2NRV A;  4O0J A;  3K5O A;  3N8E A;  2CGL A;  3U4L A;  4O5F A;  4A2B A;  4B1U B;  2D1K A;  5I3U A;  5AFU A;  3VEB A;  4BRH A;  2PAV A;  4CHQ A;  3D4Y A;  1L5U A;  2HW3 A;  3MMV A;  3OYH A;  1VQ8 N;  1DGK N;  4J8F A;  2A42 A;  4NLB A;  4BGB A;  1J5O A;  4BR9 A;  4K0K K;  1LW0 A;  3OS1 A;  2BUP A;  1OH7 A;  2Z1H A;  2RHK A;  4PA1 A;  4DLE A;  4WYB A;  3OYJ A;  5B8H A;  2D4W A;  1IBM K;  4CHY A;  2O0I 1;  3ZED A;  3WNE A;  4CEE A;  4H0X B;  2A40 A;  4MLH A;  3ISN C;  2Q3S A;  3K9J A;  3UKU B;  4HTU A;  2OW7 A;  1BUP A;  1U2V B;  2QWQ A;  3O08 A;  2OCE A;  4NSW A;  4A62 A;  3ABH A;  4WV5 A;  3EL2 A;  5F0X A;  4BDP A;  3ER9 B;  5BN9 A;  3MWP A;  2YHW A;  1SL0 A;  2FSK A;  4DR2 K;  3BVX A;  2PZS A;  4QAG A;  2D5R A;  4E1M A;  3C6T A;  1Q82 O;  3FGU A;  3VES A;  4PHT X;  4BDZ A;  3BUP A;  4WE1 A;  3CJ9 A;  4E1J A;  1QX1 A;  1T3V A;  1VQ4 N;  4J2D A;  2ND0 A;  1TKD A;  3P39 A;  4B3S K;  1W9M A;  1BA0 A;  4LH5 A;  4DSF A;  4AHR A;  5CR4 A;  2PY6 A;  3OYB A;  4H6I A;  4B9Q A;  2OBL A;  1ZBU A;  4QCL A;  3P1G A;  5M1P A;  3MX5 A;  1ASW A;  3VA3 A;  4B8A B;  1NGG A;  4FZS A;  3NHG A;  4H0T B;  4E7K A;  3SK3 A;  4IM0 A;  3OS2 A;  4EZW A;  3ZT0 A;  4XJX A;  4KTW A;  4FM3 A;  3E01 A;  5IT9 O;  3VQ8 A;  3CYG A;  3MN6 A;  4EZU A;  3ID6 A;  4G9Z A;  3K9K A;  1T03 A;  1ILY A;  1NKB A;  4E7H A;  3HAH A;  4ELU A;  4O44 A;  1TVR A;  4JK7 A;  4EHU A;  1UA1 A;  4CED A;  4ISG A;  5FPN A;  3E66 A;  3HPH A;  3AVG A;  2WTU A;  3K0S A;  2YKM A;  4DG1 A;  4R5J A;  2CH6 A;  1WNS A;  2C1I A;  3IAY A;  4BVP A;  1GOB A;  2LSN A;  1LV5 A;  1XI1 A;  4V19 S;  3EE8 A;  5DMR A;  1WAJ A;  2ZQB A;  1K73 O;  5BR8 K;  2F1B A;  1EWR A;  4BNE A;  2F96 A;  1ZBL A;  3KAV A;  3QE6 A;  3O1W A;  5C5B A;  4H0V B;  5HL7 L;  2HHV A;  1OH5 A;  3ZT4 A;  3KLF A;  3IRX A;  2F4V K;  1A5X A;  3MCA B;  2KZZ A;  2FBX A;  4QOZ B;  3AGK A;  5LY3 A;  3HT3 A;  4CZI A;  3FE1 A;  5H1S Q;  2A1R A;  4AM7 A;  2XY5 A;  1IKX A;  3AVL A;  5FRO A;  2YKT A;  1F21 A;  4K25 A;  2QKW A;  4FK2 A;  4UQG A;  3ZSZ A;  4EP4 A;  1U00 A;  2F18 A;  5BRF A;  2HHW A;  3AA5 X;  3THW B;  3IDH A;  1OA1 A;  3CC7 N;  3DX0 A;  1WSJ A;  2QA4 N;  2FBY A;  4DQS A;  3QML A;  5E41 A;  3ENO A;  3HJF A;  1OAO A;  1A5W A;  3IG1 A;  5J1E A;  3MCP A;  1HMV A;  3FR0 A;  1RIL A;  2WUS A;  3MK6 A;  3PSI A;  4CHP A;  3HP6 A;  3H1Q A;  3L2V A;  5IWA K;  4NQI A;  5HRN A;  3KJV A;  2O4I A;  3DLH A;  2P9I A;  4FM2 A;  1S1W A;  4ICL A;  5EU7 A;  5GIP A;  2E20 A;  1GNT A;  4F4K A;  2AJQ A;  4C23 A;  3O9S A;  4RW4 A;  1V4S A;  2Q0R A;  5AQO A;  3OY9 A;  4BE7 B;  1VSF A;  1X04 A;  4NYN A;  4CBW A;  2F1A A;  3W3D A;  1Y64 A;  3OBW A;  4DV5 K;  1WUA A;  3QFP A;  1CKR A;  2F7R A;  1LAW A;  3QBX A;  3KK2 A;  3KK1 A;  4DF4 A;  4MQ3 A;  4DTM A;  4M3X A;  2BH1 A;  4GY2 B;  4JEP A;  5C10 A;  3DLL L;  2HBK A;  4CES A;  2YNG A;  4CZK A;  2GEL A;  4CFB A;  3AVM A;  4B1Z A;  1X3N A;  1QTM A;  4JKH A;  2D1L A;  5HRS A;  3CJB A;  4Q5V A;  3SBT B;  3H1V X;  3G71 N;  3C7N B;  4DQR A;  5EXW A;  3V9W A;  1QZ6 A;  4QS8 A;  1VQ7 N;  1LWC A;  4Y1C A;  3VET A;  3QBW A;  1DTQ A;  1ASU A;  4OKK A;  3CCE N;  1VQ5 N;  2LM0 A;  3EYZ A;  4DUZ K;  2O8D B;  1QE1 A;  1E4G T;  1TAQ A;  4XH1 A;  3TTD A;  5HRP A;  2V7Y A;  1R0A A;  3D50 A;  3HYF A;  4PKG A;  2JLE A;  1L3S A;  4KKO A;  2P9K B;  4BVO A;  2QK9 A;  3SBS A;  1C1A A;  4OGC A;  3VF2 A;  4LFC K;  4JI7 K;  4FXD A;  1C0G A;  3CVR A;  1OKJ A;  1RTJ A;  4PWD A;  1WSE A;  3K58 A;  2G8K A;  4JN4 A;  4AZI A;  1UA0 A;  3ZEF A;  1YTU A;  1S1U A;  2P9I B;  4EZS A;  4RG8 A;  1KCF A;  5DM7 L;  3QNI A;  3BVW A;  3AVN A;  3DYA A;  2YL6 A;  4RW7 A;  1JJ2 M;  3DXM A;  5AJ3 K;  1LQ7 A;  3V1R A;  1N8R O;  4RCH A;  4KHS A;  5JIC A;  5AZI A;  5GIN A;  3JS6 A;  3LDO A;  3B6O A;  3S9H A;  3BUI A;  3CCR N;  1QQO A;  5BPN A;  3IS9 A;  3PO4 A;  3MXI A;  4X62 K;  4KH4 A;  1JLB A;  2QM1 A;  2O8F B;  3CER A;  3C6H A;  3CZS A;  3DMJ A;  2E1Y A;  2B5J A;  3D4Z A;  3P5J A;  4Z0U A;  2HND A;  2YX6 A;  1I39 A;  1HRH A;  4FJG A;  2ASP A;  1QVF M;  2NRW A;  2X6S A;  5BN8 A;  3PX4 A;  4YOV A;  3CKD A;  4DR5 K;  3O4W A;  2D4C A;  4MLE A;  2HNY A;  2RPI A;  1N5Y A;  4RW6 A;  4JL9 A;  1U04 A;  3L0Q A;  4KH5 A;  1RTI A;  3NF7 A;  4KH6 A;  1HLU A;  3NCI A;  3HXM A;  4FJH A;  3CJ7 A;  1L3V A;  2YCH A;  1RDA A;  4KTZ A;  2X6N A;  3S3O A;  4F00 A;  4DS4 A;  3TAM A;  4JWI A;  3KKS A;  1HKB A;  1U49 A;  1IG9 A;  4HCC A;  1BI4 A;  4CGH A;  3NGI A;  3IFR A;  3RMA A;  1I49 A;  1BCO A;  1RDD A;  5CYQ A;  2HBL A;  3SYZ A;  4W5N A;  3VQA A;  2IIR A;  3DRS A;  4CIG A;  3K5M A;  4IXC A;  4KV8 A;  1OVQ A;  3WT0 A;  2O8D A;  3EJT A;  4LF4 K;  1H1V A;  2HMP A;  1KSP A;  5CY4 A;  4HR1 B;  1KQS M;  4KB0 A;  3M8R A;  1MJG A;  3C0B A;  3OVN A;  1HJO A;  4NB4 A;  4ILJ A;  1RNH A;  4FJN A;  2HHS A;  4A57 A;  5M1O A;  4BC4 A;  2NRZ A;  5SZT A;  3HM9 A;  4BR7 A;  2UXD K;  3I04 A;  3UB5 A;  3VQ6 A;  2PYL A;  4E0D A;  1UPX A;  2P9L B;  3GL1 A;  4O0I A;  3QDK A;  1VQN N;  4EZV A;  5ELZ A;  4ATM A;  2QTD A;  3O3G A;  5I42 A;  1Q86 O;  1B9F A;  1VSI A;  1J5E K;  2KKZ A;  5AQX A;  2HBJ A;  3S3M A;  5AQZ A;  2BDP A;  2RF2 A;  4CEO A;  3F7W A;  4DMN A;  1K8K A;  2E8A A;  1HR0 K;  1JCF A;  3SQ1 A;  1NKC A;  3QEV A;  4CIF A;  4U67 L;  4MO5 A;  4NCG A;  2G8H A;  1SKR A;  1U45 A;  1UAX A;  3BDP A;  4M3W A;  4FW1 A;  1NGJ A;  3AGR A;  4W5O A;  3GE1 A;  4GKJ K;  3L3O M;  3OYE A;  1SL1 A;  4DCN C;  1HJR A;  1QWU A;  2PFU A;  2GBZ A;  2F7O A;  4FLY A;  1QQN A;  3AVI A;  4BRE A;  3U8X A;  3RMC A;  1NJX A;  1KXP A;  4N56 A;  2QI2 A;  3FZH A;  4FJ7 A;  4BEB A;  5KBP A;  2G8V A;  4CJU A;  1CZB A;  3CIP A;  4OPJ A;  1S72 N;  3T1A A;  1ZC6 A;  2ITG A;  4N41 A;  3IKM A;  2VGM A;  3KAW A;  3D2E B;  3LL3 A;  1VQP N;  3HTV A;  4JKG B;  3ULE A;  3EZ5 A;  1VHX A;  4WCE L;  1Q7Y O;  2OYQ A;  3WEE B;  1CZ9 A;  1NNE A;  2GAF D;  2YLL A;  1NKE A;  1DT9 A;  1NG9 A;  1HNV A;  1BCM A;  3BVV A;  4CJQ A;  4ILI A;  3ZET B;  1LCU A;  3LDP A;  1RBU A;  2QXF A;  1BDG A;  1TL3 A;  3K5N A;  3B8A X;  4DTP A;  3R6M A;  4CJ3 A;  1Z05 A;  4LFA K;  2X3W A;  4A2A A;  4IO9 L;  3NMU A;  3AA4 A;  4BRN A;  3IMX A;  1QSY A;  1JXE A;  4OKE A;  4CHN A;  3AO5 A;  1U4B A;  2E1Z A;  4QS9 A;  1VSH A;  5BPM A;  2GWK A;  5LMN K;  4KFB A;  4CEA A;  4B3O A;  1N33 K;  3HBT A;  3NBP A;  1WB9 A;  5FRM A;  3UIT A;  2YNH A;  5FPE A;  4FJ9 A;  3SMS A;  3H46 O;  2GA9 D;  3EE9 A;  3GI7 A;  1N36 K;  1E2U A;  3TSQ A;  3WQT A;  3DQG A;  4OO1 J;  1NGB A;  4B1W B;  5F1X A;  3VQQ A;  4ID5 A;  3QEI A;  1TKX A;  4BAC A;  2IC3 A;  5C0Y A;  4CEF A;  3AAP A;  3O4N A;  1GLJ O;  4R5I A;  3D51 A;  4DSI A;  3DYT A;  3CCJ N;  3TPQ A;  4EP5 A;  2W00 A;  4H8K A;  3QIP A;  4FWR A;  2UUA K;  4DU1 A;  4CIE A;  3EEQ A;  3NH1 A;  3C6A A;  4PL8 A;  4M45 A;  1YIJ N;  4F01 A;  4XH5 A;  3CAZ A;  4JWE A;  3CZN A;  1WLJ A;  3BY5 A;  4FLX A;  4FWN A;  3DX3 A;  3OYL A;  2KW4 A;  3ZSW A;  1Y2O A;  5JMV A;  2ZJQ L;  2O8F A;  4ZTF A;  4IZ9 A;  5AQI A;  2ELB A;  4EZZ A;  1NJY A;  3DOL A;  4KRE A;  3SBT A;  5JS1 A;  1C0U A;  2HVH A;  2DFE A;  3VPZ A;  3LP1 A;  2HMI A;  1GOA A;  1N32 K;  2OP6 A;  2F9T A;  2YI8 A;  3O3F A;  1FK9 A;  2FYV A;  1S3X A;  1BIS A;  3D7E O;  1I94 K;  4E81 A;  2P9S B;  1JXB A;  3B51 X;  1MDU B;  1DG4 A;  3U3Y A;  5AQM A;  4JWD A;  3BZC A;  3C94 A;  1VSJ A;  5SWM A;  4E7I A;  3TAF A;  3J7Z O;  3AVA A;  3KD5 E;  4CJK A;  2EHG A;  1N34 K;  4KHW A;  5E84 A;  2E2P A;  2BGG A;  4WQ5 C;  3THY B;  4NPH A;  3LM9 A;  2ZD1 A;  4FJJ A;  3ZEU B;  1JQK A;  3EJQ A;  4CFA A;  3VGK A;  2FC0 A;  4Y0W A;  4IG0 A;  1YXQ A;  2OW6 A;  4AHT A;  4BRA A;  4PKH A;  4FJ5 A;  1GLL O;  1XNQ K;  2HHH K;  3ALY A;  3IUC A;  4H0Y B;  2BPR A;  4Z4I A;  3A8Y A;  4CF2 A;  2Z0V A;  4EZN A;  3VEO A;  3HRG A;  4G6Q A;  3GOI A;  2ZGZ A;  1G99 A;  2QWL A;  4GV9 A;  3P4I A;  3D2E A;  5FPD A;  3QES A;  4GVE A;  3ZCM A;  2JWK A;  1C1C A;  1VQK N;  5C15 A;  3CI5 A;  1K8A O;  3CC2 N;  3VMF B;  4I9Q A;  3EZW A;  1NMD A;  1W97 L;  5JEN A;  5BRH A;  3OS0 A;  2HHU A;  1RT3 A;  2OO2 A;  2GWJ A;  4FWK A;  4O55 A;  2J4R A;  3BP8 A;  1Z6R A;  4HTL A;  4FZY A;  2ND1 A;  1RDB A;  3VF4 A;  3TU5 A;  3TAP A;  4JKA A;  3RMD A;  4LF7 K;  3C65 A;  3GDQ A;  3OWG A;  4FM0 A;  1J53 A;  2IDO A;  3RRG A;  2RKI A;  4LF9 K;  3PSF A;  4FWQ A;  2ZM6 K;  3T46 A;  1TKT A;  1VAZ A;  4OVL A;  4M7X A;  1TGO A;  4EZQ A;  4BC2 A;  1OH8 A;  4IOA L;  3NF9 A;  4WV7 A;  1L3U A;  4I2P A;  1U47 A;  4FVU A;  4HWI A;  1GOC A;  5C12 A;  3V81 A;  2E88 A;  3H08 A;  4IDK A;  1D4X A;  1R5E A;  4DR1 K;  3V9X A;  4JAX A;  1TK5 A;  2RAK A;  4BC3 A;  1NGA A;  3J80 O;  1ZYL A;  1EET A;  3M5R A;  5J2M A;  3L6Q A;  1ESV A;  2UXC K;  5AQG A;  4CJL A;  4R79 A;  3L4Q A;  1TQU A;  4EIA A;  3VQ5 A;  4E3S A;  4DU4 A;  4JLH A;  2QXL A;  1RTH A;  3TWH A;  2RT6 A;  2W42 A;  1A5V A;  3BZK A;  3LM2 A;  4CCH A;  2QW9 A;  4DCH A;  1YVU A;  2FF6 A;  1HNZ K;  1C0T A;  3T48 A;  3F5T A;  2E5L K;  2GTD A;  3TSP A;  2P9L A;  4L3Q A;  4X65 K;  2WC9 A;  3MEE A;  3O9U A;  2WYH A;  1HPM A;  3D2F B;  1NJI O;  3F73 A;  4I43 A;  3DX2 A;  3QNN A;  4CHO A;  4AZC A;  4DR4 K;  1OA0 A;  4AVM A;  3DPQ A;  3O3H A;  1SUQ A;  3O5B A;  2ZF5 O;  5AR0 A;  4CZG A;  3MWT A;  4ZHR A;  3DOB A;  3CCV N;  4JI5 K;  1RT4 A;  1MA9 B;  1FKO A;  2FIC A;  4FWM A;  4Z4C A;  3MEG A;  4B08 A;  1I4D A;  5KGX A;  4HHT A;  2UYT A;  5F2R A;  1O1W A;  4JI1 K;  3WUH A;  3KLH A;  3NH2 A;  3THX A;  2O8B A;  1RT7 A;  3LVT A;  3QLH A;  4CGD A;  1JL2 A;  4FOI A;  4CZL A;  1GLA G;  4FZZ A;  4K43 A;  4DHY A;  4DQP A;  4IOX A;  3CQY A;  1HYZ A;  2ASO A;  5AQW A;  4DFJ A;  3M8S A;  4F3O A;  1QWN A;  5JS2 A;  3I8B A;  1YUW A;  3CXC M;  4HCB A;  1XWL A;  5TKW A;  4DV3 K;  3OYK A;  1XUP O;  2IVP A;  3O3O B;  2EX3 A;  4FJ8 A;  4YOX A;  3I33 A;  3KWI A;  4PY5 A;  3QIN A;  4PO2 A;  2IVN A;  4BQL A;  5DM6 L;  4FSV A;  3L2Q A;  1X9S A;  3D52 A;  4BDY A;  2G8U A;  1REV A;  1C0F A;  3CG7 A;  3U6F A;  3VEN A;  3SMP A;  1KRP A;  4GV3 A;  4DTJ A;  1WSH A;  4EFH A;  1XC9 A;  5HP1 A;  3DLE A;  2Q36 A;  3DLR A;  3M3Z A;  2P9K A;  2GX9 A;  3CM5 A;  3ZSY A;  3OYG A;  4JD2 B;  3DAW A;  4AQY K;  1HUX A;  4EZ6 A;  3H45 C;  3PY8 A;  4PKI A;  3WEE A;  2FBV A;  1LWF A;  3C95 A;  4UDY X;  3MDQ A;  4CF9 A;  5AQR A;  3WNF A;  2FLO A;  2CGJ A;  3ZX3 A;  3LDS A;  4H03 B;  4AZG A;  1HTY A;  3G4S N;  3UE5 A;  2OZM A;  2O4G A;  4CK2 A;  1FJG K;  5GAG P;  4WQ4 A;  3AA2 A;  4DTO A;  3KLI A;  3E9P A;  3TTF A;  3O8M A;  3VQ9 A;  3T49 A;  4JKE A;  3L8B A;  3OHX M;  1X9M A;  1R33 A;  5M1Q A;  1QVG M;  1J6Z A;  1RFQ A;  3CJ1 A;  1X03 A;  5EX5 A;  2F9W A;  1ATR A;  3R1X A;  1QQC A;  2RAI A;  3NE6 A;  2G8W A;  3CQ8 A;  2Z1J A;  1VSE A;  4CE9 A;  3RV1 A;  2JNK A;  4B9T A;  3ACO A;  3PV8 A;  2A1S A;  2YHA A;  1XC3 A;  2E2Q A;  3NDK A;  2VWJ A;  1RTD A;  3DXK B;  4U7B A;  1GLF O;  4FLT A;  1PS3 A;  3DX1 A;  1RBT A;  4A59 A;  4JLC A;  2V52 B;  2NRH A;  1LWE A;  4GVM A;  3Q84 A;  3U9Z A;  3AVB A;  5KI6 A;  1YTA A;  3A5M C;  3CET A;  3VEY A;  4DWI A;  3R3L A;  4IEI A;  1KVA A;  2I7P A;  1TUY A;  2YNI A;  3I0S A;  2VG5 A;  3KK7 A;  4B9S A;  4AHC A;  3EJS A;  1Q18 A;  3SYV A;  3L4I A;  4LC9 B;  4JNE A;  1EXQ A;  1IKV A;  1JLA A;  3FD9 A;  1ATS A;  5KPZ A;  4E7J A;  4DF8 A;  4CEZ A;  4E1N A;  3U3G A;  2X74 A;  1M90 O;  4XEI A;  1YF5 L;  3OHR A;  3O80 A;  2P9P A;  2YL9 A;  4FL9 A;  4KHY A;  4JK8 A;  2VCP A;  2A6A A;  1G15 A;  2YIV X;  4LH4 A;  3Q0K A;  2YJF A;  5FDL A;  1NOZ A;  1BO5 O;  2Q97 A;  1Q8I A;  1S9E A;  3N4P A;  2Q13 A;  3J7A P;  2D0A A;  4I9L A;  2P9P B;  5AZJ B;  4BE1 A;  1LW2 A;  3CFR A;  1GLB G;  1P8Z A;  1HNI A;  3RVC A;  3T7Z A;  4B8C A;  4H5R A;  3B52 X;  1I4L A;  5KRT A;  3RR7 A;  2HHQ A;  2P51 A;  3NVM A;  2VWK A;  1GLD G;  3A5N C;  3ZYY X;  4ILG A;  4LSN A;  1IG8 A;  2KFN A;  3AVF A;  1HKG A;  5J2N A;  3O9Q A;  3KWG A;  3AO4 A;  1S1X A;  5CZ1 A;  2C08 A;  3EJP A;  1NBW A;  2D0O A;  3T1H K;  4L8R B;  2QWO A;  3SUN A;  4YOW A;  1NJZ A;  3OJS A;  3MXJ A;  4MQD A;  4DV4 K;  5JLF A;  3M6G A;  4JI0 K;  1HX1 A;  3NGY A;  5C25 A;  1R59 O;  1B92 A;  4KHN A;  4CJR A;  4B3T K;  3I56 N;  2N3K A;  1T6D A;  1NGC A;  4KAZ A;  3VQP A;  3SV3 A;  4JNF A;  4J2B A;  4IM2 A;  4H8S A;  4BRG A;  3S3N A;  2W6K A;  3I0R A;  3ZSV A;  2BE2 A;  5M1N A;  1GN9 A;  2NCZ A;  3SBG A;  4BC5 A;  4BGA A;  1Y97 A;  3H6E A;  3SQ2 A;  3PUF A;  1W7A A;  5FPM A;  1NK6 A;  2YHX A;  5FLE X;  1BI4 B;  3CYM A;  5KQD A;  3DPP A;  4FM1 A;  4Z4H A;  4M3Y A;  3QER A;  4EAH D;  3L2R A;  2UXB K;  3C7N A;  3KLG A;  3FZF A;  3QO9 A;  2WYI A;  1X9J A;  3RMB A;  4UY8 O;  3KKR A;  3SNN A;  3S41 A;  3VTI A;  4FZX C;  4YDU C;  4F9O A;  4BRL A;  2OPP A;  3WXL A;  5AQY A;  1TQW A;  3FZM A;  1BWF O;  4FJX A;  3MEC A;  3RPM A;  2XHB A;  2NUB A;  2EWF A;  3BF1 A;  1ZBH A;  1T8E A;  3I2W A;  1C0M A;  4EZR A;  2QWN A;  5C42 A;  3VEW A;  3I8D A;  1HNX K;  3NH0 A;  3HI0 A;  3PLA A;  2OBM A;  1O13 A;  1D9D A;  1RCH A;  3CPE A;  2HHX A;  3ZSO A;  2DFF A;  2Y1J A;  2HOE A;  4AHS A;  2FF3 B;  3RV0 A;  3H0X A;  4HY9 A;  2EFK A;  3A0I X;  3VEZ A;  1B9D A;  1WBB A;  1T7P A;  3HVR A;  3DM2 A;  1HQU A;  3HP9 A;  1NOY A;  2V51 B;  3VKH A;  2EFL A;  2BAN A;  1SL2 A;  1O7D B;  4LFB K;  4CJV A;  4CEQ A;  4M3T A;  4OPA A;  4DV6 K;  1NGH A;  4BR0 A;  2QKB A;  1ZBI A;  1E1D A;  2A3Z A;  4EZX A;  4CZM A;  3WXI A;  4CJE A;  1YJW N;  2WON A;  4HYB A;  1C1B A;  4AZ5 A;  3OW2 M;  2VYP A;  1E9V A;  4NO7 A;  4H5T A;  4BQZ A;  3TAB A;  4XIU A;  4R5P A;  4KPY A;  3SZ2 A;  3J8A A;  3MN7 A;  2FXU A;  1RT6 A;  2XO7 A;  3H3O B;  4CJS A;  4RWT A;  5HOO A;  2ASM A;  4X66 K;  3RSE A;  2KQ2 A;  4DTN A;  4IWQ A;  3VN5 A;  3ASM A;  4FWS A;  3DLK A;  3WXK A;  5AQU A;  1Q5L A;  4JK9 A;  4YOT A;  4CGG A;  1IBK K;  4E72 A;  3T19 A;  4DR3 K;  1ZYQ A;  4KHU A;  1IV0 A;  3TAQ A;  4YOY A;  4BWJ A;  2C1G A;  1S6P A;  2YLA A;  1K8K B;  2HF3 A;  4MDB A;  4IOC L;  4A61 A;  4F8R A;  3E9O A;  1ZWW A;  4B9U A;  1KTQ A;  5AQL A;  5AQK A;  3UKR A;  3DXM B;  3VTH A;  4FVM A;  5FLX O;  3WXM B;  3D2F A;  3VGL A;  4AZH A;  4O8K A;  3CD6 N;  1VQ6 N;  3AV9 A;  4ISF A;  5JLH A;  1J54 A;  4KHQ A;  2DTU A;  3TTC A;  1EO1 A;  1BPR A;  1EX4 A;  3HL8 A;  4BRI A;  3ATU A;  4CHZ A;  4DQ8 A;  3F9K A;  4HR1 A;  3AAQ A;  1SAZ A;  3THX B;  2O8B B;  4ID1 A;  4FLW A;  3CJA A;  3T4A G;  3EJR A;  1WSI A;  1SZ2 A;  1NK0 A;  1DKG D;  1KFS A;  3ZSR A;  3PLT A;  5CE3 A;  4DV1 K;  2ATQ A;  2W6L A;  5BRE A;  3K5L A;  1NWK A;  3TSU A;  4B1Y B;  3DXK A;  3QIO A;  4IWV A;  2DY4 A;  4FWL A;  4M41 A;  3TI0 A;  4DSL A;  2EX3 B;  3KZB A;  1ASV A;  3SOG A;  3V9S A;  3VEV A;  3ZSX A;  3LAM A;  3BUB A;  5AFU H;  5BRD A;  4IFE A;  4PQU A;  1TL1 A;  1CZA N;  2V0O A;  2P9S A;  2OZN B;  3I55 N;  2Z1I A;  1M1K O;  2OPR A;  4M7Y A;  1S22 A;  1K9M O;  2Q31 A;  4F2R A;  4OKJ A;  4ZTJ A;  4I1Q A;  5BPL A;  4IO8 A;  3QNO A;  2E2O A;  2ZJP L;  3ERC C;  3O3N B;  2NRR A;  4M3Z A;  3AVC A;  1NK9 A;  2CH5 A;  5C5B B;  3L3U A;  1D9F A;  5GIO A;  1VRU A;  2W40 A;  4BG8 A;  2QWR A;  3VER A;  3V6D A;  1SU6 A;  2D0B A;  1CXU A;  4FWP A;  1UOC A;  2P9N B;  4C8M A;  3HSC A;  1JCG A;  4C1N K;  3SPY A;  3T3F A;  3FZL A;  4DLG A;  1TKZ A;  4CK3 A;  3HZ6 A;  4BE2 A;  4YOU A;  2WIN M;  4Z4E A;  1WDZ A;  2GUI A;  1TK0 A;  1Z26 A;  1JCE A;  1ZXO A;  1FXX A;  2DFH A;  4CJP A;  2X3V A;  2YJE A;  3Q7B A;  1Q81 O;  1SS6 A;  4CF1 A;  3MX2 A;  2P9U B;  3BUZ B;  4IW0 A;  2FBT A;  4OGE A;  5AQF A;  1NK4 A;  5AQS A;  3AO2 A;  3LP3 A;  4BRO A;  3CFP A;  4GMJ B;  4ILG B;  3HO1 A;  3LMF A;  1SQK A;  4N47 A;  4DR7 K;  5AZI B;  4CK1 A;  1WAF A;  4E7L A;  4AZC B;  1QZ5 A;  3OYA A;  3TAR A;  1HYS A;  4CEB A;  1HNW K;  5LMU K;  3LLL A;  4IJN A;  3RSE B;  4MDA A;  1SUF A;  1NU0 A;  4LF5 K;  1URU A;  2D0P A;  4HVJ A;  2KTQ A;  1TYQ A;  3VEX A;  3LDQ A;  2JNS A;  3FFI A;  3ZX2 A;  2NRT A;  3J7Y P;  1JLF A;  1QHA A;  4EZY A;  4NYF A;  5LL6 Z;  3WNG A;  4FJI A;  4BRQ A;  3AVK A;  5FIG A;  5C24 A;  2D0C A;  3A2F A;  3LAK A;  4YHH K;  3HOS A;  4IDH A;  4FJL A;  3CM6 A;  1TK8 A;  2HF4 A;  3CCQ N;  2F7T A;  1GNL A;  2I5J A;  3F2K A;  4KTQ A;  4H0P A;  4A5A A;  3N4Q A;  4PUO A;  4BRM A;  3CPW M;  3LP0 A;  5J2P A;  2EWS A;  4DFK A;  4CW7 B;  1JLQ A;  4XH4 A;  1U6Z A;  4M63 C;  4JI8 K;  2IGI A;  4W5Q A;  2PY5 A;  2G8I A;  3NGZ A;  1LOT B;  4OJR A;  4WFA L;  4JRQ A;  5AQP A;  3EKU A;  1NK8 A;  3RWU A;  1S1V A;  4CD3 A;  4M0M A;  2AA4 A;  5CYM A;  3QNJ A;  1T6C A;  4I2Q A;  5M1K A;  2VG6 A;  4K8X A;  3LPT A;  4KBO A;  4M42 A;  3DRP A;  1BQN A;  3UKU A;  3CFO A;  4TSX A;  5AQQ A;  5M1F A;  3BVU A;  5BR9 A;  2AP1 A;  2W41 A;  3NF6 A;  4H5W A;  1GLE G;  4CZH A;  4B9N A;  3ZT3 A;  3V9Z A;  4E19 A;  3B6P A;  1FW6 A;  3FZK A;  3F9M A;  2HNZ A;  3V9U A;  4FLU A;  5FRN A;  2QFF A;  5CZ2 A;  3ZEU A;  3LAL A;  3CCM N;  1JKH A;  4E3C A;  1KFD A;  1HXK A;  3DX4 A;  1MWM A;  1J9A A;  2V7Z A;  4H6H A;  3V4I A;  3SLC A;  2ZWH A;  1U48 A;  4Z94 A;  2F8T A;  4X64 K;  4HUF A;  1YWM A;  1TQS A;  4GV6 A;  4JI6 K;  1JL1 A;  2KZM A;  2P1J A;  2WBN A;  3HVT A;  1QQM A;  3DWL A;  5LJV A;  1S6Q A;  1SU7 A;  4IWP A;  1TQV A;  1NGD A;  2VWB A;  3L3V A;  1WBD A;  4KO0 A;  3OK8 A;  5AQH A;  4LSL A;  4AHV A;  2E2N A;  1X9W A;  4BWM A;  3WQU A;  1WSG A;  4JYA K;  4FLV A;  1CLQ A;  4FJK A;  1U2V A;  1W0H A;  5MLC Q;  3ZT2 A;  3ER8 C;  4J2A A;  1DLO A;  3ZET A;  4JV5 K;  5C2F A;  4BEC A;  1WN7 A;  4Z4F A;  4QS7 A;  2X3X A;  1S5J A;  1NK5 A;  4CJF A;  3G25 A;  4GW6 A;  5ADX H;  3HM8 A;  3DDF A;  1KC8 O;  4DTX A;  4FOE A;  1VRT A;  1VQM N;  4KIK B;  3JYT A;  2Q1N A;  4IFY A;  2GV9 A;  3E9L A;  3THY A;  3HST B;  3SI6 A;  2QEX N;  4YNQ A;  2FSJ A;  3DJC A;  3D0P A;  3BF3 A;  3ZSQ A;  3OYC A;  2A41 A;  2YNF A;  4O5B A;  2HHI A;  3EKS A;  4BG9 A;  1EP4 A;  2F7Q A;  2GEM A;  3HAI A;  5AZJ A;  4ELV A;  2Q2R A;  3CJC A;  4YDU A;  1S9G A;  1NK7 A;  4G1Q A;  2VG7 A;  3KHY A;  1YI2 N;  3SAG A;  2E4L A;  3LDL A;  4B9L A;  3O9R A;  1SU8 A;  4CI6 A;  4BRD A;  5E26 A;  2XY7 A;  1KAX A;  1KLM A;  2YI1 A;  4BRF A;  3VGM A;  4ILH B;  4CER A;  1YJ9 N;  7HSC A;  4DV7 K;  1P90 A;  2OPS A;  5AQN A;  4FWO A;  5GAH P;  3HK2 A;  2QKK A;  2RN2 A;  4NLC A;  3BLB A;  1XQS C;  3MAQ A;  1ATN A;  5GAE P;  5HRR A;  1MU2 A;  1IKW A;  3LZJ A;  1XMO K;  3QEP A;  1QSL A;  1RBS A;  4OX9 K;  4ISE A;  3QWE A;  1SV5 A;  2OA8 A;  4NXM K;  3G6E N;  4WPC A;  1IJJ A;  1NGF A;  3DLB A;  4H0O A;  3T1Y K;  3SJH A;  3PO5 A;  4DSK A;  3CCU N;  3VA0 A;  1ZBF A;  2B4J A;  4CGI A;  4IFV A;  3V1Q A;  4H5V A;  4B1V A;  1E3M A;  1NLV A;  4EZP A;  3SAH A;  3DRR A;  3QB0 A;  4CZE A;  2PMR A;  4BR4 A;  2Y1I A;  4B3R K;  5C2D A;  3SJJ A;  4RW8 A;  4CF8 A;  3U9D A;  3K2P A;  4FK4 A;  4EZ9 A;  3RR8 A;  2OTJ N;  4DV0 K;  4R5G A;  1GLC G;  2E6M A;  2VGN A;  3VQ4 A;  4DS5 A;  3PX0 A;  4CD1 A;  3CME N;  3T47 A;  3HAJ A;  3K57 A;  1BU6 O;  4RTF D;  1OVY A;  4I6M A;  1N6Q A;  3R8E A;  4N76 A;  3CV5 A;  2O8C B;  2MI7 A;  1YT3 A;  2DPN A;  1CXQ A;  3AY9 A;  5JVH L;  1XMQ K;  4CJ7 A;  1W9H A;  4IBN A;  2HHT A;  1KLN A;  4CZJ A;  5J2Q A;  1TQT A;  3AO3 A;  3TAG A;  4DV2 K;  4WPE A;  4AM6 A;  4DQQ A;  4DQI A;  2P5O A;  4CJ5 A;  4B9M A;  1HYV A;  2CGK A;  5KTQ A;  1OH6 A;  2RAJ A;  1V4T A;  3BUQ A;  3VQD A;  2GF4 A;  1DKZ A;  2F8S A;  2NRX A;  1W2B M;  4I7F A;  3VQ7 A;  4BRK A;  4ILH A;  4CJW A;  3CF5 L;  1VQO N; 
#chains in the Genus database with same CATH homology
 3JXU A;  3VGK A;  4H0V B;  2ASM A;  4RWT A;  5TKY A;  5HL7 L;  5HOO A;  3RSE A;  1ZBS A;  4Y0W A;  4IWQ A;  3I01 A;  1YXQ A;  3MCA B;  3P31 A;  4FWS A;  4BRA A;  4PKH A;  2JWL A;  3WXK A;  3CCS N;  1GLL O;  3AGK A;  5AQU A;  1Q5L A;  1BA1 A;  5LY3 A;  3IUC A;  4H0Y B;  4JK9 A;  4YOT A;  1DKX A;  2BPR A;  3A8Y A;  3FE1 A;  4CZI A;  4EZN A;  3VEO A;  5H1S Q;  4AM7 A;  3HRG A;  4G6Q A;  3W0L A;  4O8U A;  3GOI A;  4YOY A;  1YAG A;  4UDX X;  2ZGZ A;  2C1G A;  1G99 A;  4K25 A;  2QWL A;  4GV9 A;  3P4I A;  3D2E A;  5FPD A;  1U00 A;  5BRF A;  2ZJR L;  4GVE A;  1K8K B;  2HF3 A;  4MDB A;  4CZF A;  4A61 A;  4IOC L;  2JWK A;  3E9O A;  3IDH A;  1OA1 A;  3CC7 N;  1VQK N;  5C15 A;  2QA4 N;  3CI5 A;  1K8A O;  3CC2 N;  3VMF B;  3EZW A;  3KVG A;  3QML A;  3ENO A;  5AQK A;  1NMD A;  1W97 L;  3DXM B;  1OAO A;  5AQL A;  3UKR A;  3VTH A;  4H5N A;  4C1N I;  3DPO A;  3MCP A;  5BRH A;  3FR0 A;  2WUS A;  3MK6 A;  3WXM B;  2GWJ A;  5CHI A;  3D2F A;  3H1Q A;  4FWK A;  3VGL A;  2J4R A;  3BP8 A;  1Z6R A;  4HTL A;  4O8K A;  2ND1 A;  4JKB A;  3VF4 A;  3CD6 N;  1VQ6 N;  4BR2 A;  3TU5 A;  2P9I A;  4ISF A;  5JLH A;  3TTC A;  4JKA A;  3ULE B;  4JKC A;  3O6W A;  4EHT A;  5GIP A;  3A98 A;  2E20 A;  1BPR A;  3C65 A;  5KPR A;  1GNT A;  1EO1 A;  1NJI O;  3GDQ A;  3OWG A;  4C23 A;  3O9S A;  4BRI A;  3ATU A;  1RDW X;  1V4S A;  4FWQ A;  3T46 A;  2Q0R A;  1VAZ A;  5AQO A;  4DQ8 A;  4BE7 B;  4HR1 A;  3AAQ A;  4M7X A;  3ID8 A;  1SAZ A;  4IWO A;  4EZQ A;  4KIK A;  4BC2 A;  4CBW A;  4IOA L;  3W3D A;  4WV7 A;  1Y64 A;  3OBW A;  1WUA A;  3T4A G;  3CJA A;  3QFP A;  4FVU A;  4HWI A;  1CKR A;  1SZ2 A;  3QBX A;  5C12 A;  5ADX A;  2E88 A;  1DKG D;  1D4X A;  2BH1 A;  4JAX A;  4GY2 B;  3P38 A;  4BC3 A;  1NGA A;  1RGI A;  4JEP A;  5C10 A;  3DLL L;  1ZYL A;  3M5R A;  1BOT O;  2HBK A;  3L6Q A;  5CE3 A;  3CCL N;  2OTL N;  2YIB A;  5BRE A;  1ESV A;  4CZK A;  3PIP L;  4JD2 A;  5AQG A;  1NWK A;  2GEL A;  3TSU A;  3L4Q A;  4R79 A;  4B1Z A;  4I6M B;  1X3N A;  4B1Y B;  3QIC A;  4EIA A;  4JKH A;  3DXK A;  2KLA A;  3OA9 A;  3ENB A;  3SAF A;  3CJB A;  4IWV A;  3SBT B;  3H1V X;  4FWL A;  2QXL A;  3G71 N;  3C7N B;  2RT6 A;  5EXW A;  2A5X A;  2EX3 B;  2GUP A;  3CQX A;  3KZB A;  3LM2 A;  2QW9 A;  2QWM A;  1QZ6 A;  3CMA N;  4DCH A;  4QS8 A;  2FF6 A;  1VQ7 N;  3QA8 A;  1NM1 A;  3VEV A;  3T48 A;  3F5T A;  3VET A;  2GTD A;  3QBW A;  5AFU H;  3TSP A;  4FPB A;  4IFE A;  2P9L A;  3T69 A;  1CZA N;  5BRD A;  1YJN N;  3CCE N;  4CBU A;  4L3Q A;  2WC9 A;  2P9S A;  5GAD P;  2LM0 A;  3I55 N;  4IM3 A;  3O9U A;  1M1K O;  1VQ5 N;  2NZT A;  1E4G T;  4R5L A;  4D8J A;  1HPM A;  1S22 A;  2BTF A;  1KAZ A;  3BEX A;  3D2F B;  2Q31 A;  4M7Y A;  2V7Y A;  4I43 A;  4XH1 A;  1K9M O;  3MN5 A;  4PL7 A;  4PKG A;  3UKR B;  5BPL A;  1YVN A;  4BVO A;  2P9K B;  4IO8 A;  1OA0 A;  4WF9 L;  2E2O A;  2ZJP L;  1VQ9 N;  4GNI A;  3DPQ A;  3ERC C;  3O3N B;  2NNW A;  2NRR A;  3SBS A;  2ZF5 O;  3O5B A;  5AR0 A;  3R9P A;  3MWT A;  4CZG A;  2CH5 A;  3DOB A;  3CCV N;  3VF2 A;  1MA9 B;  3HOT A;  4FWM A;  5GIO A;  2W40 A;  1C0G A;  1OKJ A;  4BG8 A;  2QWR A;  2UYT A;  5F2R A;  3VER A;  3WUH A;  1SU6 A;  4JN4 A;  4FWP A;  2P9N B;  3HSC A;  3ZEF A;  1JCG A;  3M1F A;  4C1N K;  3FZL A;  4FOI A;  2P9I B;  4FPA A;  4BRP A;  4CZL A;  1GLA G;  4EZS A;  4WQ5 A;  2ZGY A;  3HZ6 A;  3O9T A;  5DM7 L;  4YOU A;  2PBD A;  4K43 A;  2WIN M;  1TUU A;  4DHY A;  4IOX A;  1WOQ A;  2RE2 A;  3CQY A;  3DXM A;  1JJ2 M;  4AF1 A;  1JCE A;  1ZXO A;  2ASO A;  5AQW A;  4BR5 A;  4WQ4 C;  4A5B A;  4BY9 C;  1N8R O;  3FFK B;  1YUW A;  3I8B A;  4RCH A;  3PIO L;  2YJE A;  3Q7B A;  3CXC M;  1Q81 O;  1SS6 A;  4JWC A;  3MX2 A;  5TKW A;  2P9U B;  3ENH A;  3TTD A;  3E1Y A;  5AZI A;  5JIC A;  1XUP O;  2IVP A;  3BUZ B;  4IW0 A;  3O3O B;  2HST A;  3JS6 A;  3LDO A;  5GIN A;  5AQF A;  4YOX A;  3CCR N;  3I33 A;  3KWI A;  5AQS A;  4BRO A;  4PO2 A;  2IVN A;  5AQJ A;  4BQL A;  4FSV A;  1KAY A;  4CBX A;  1QQO A;  5BPN A;  4ILG B;  5DM6 L;  3LMF A;  3KDR A;  1C0F A;  1SQK A;  3VEN A;  3SMP A;  4GV3 A;  1NGI A;  5AZI B;  1RDU A;  4KH4 A;  2QM1 A;  3CER A;  3C6H A;  2Z8Y A;  2E1Y A;  1QZ5 A;  4EFH A;  2I7N A;  2YX6 A;  4IJN A;  3RSE B;  2ASP A;  4MDA A;  2Q36 A;  1QVF M;  3M3Z A;  1SUF A;  2NRW A;  2GX9 A;  2P9K A;  4JD2 B;  5BN8 A;  3B53 X;  2D0P A;  4JKG A;  3DAW A;  1HUX A;  1TYQ A;  3VEX A;  3LDQ A;  3H45 C;  5EY4 A;  2JNS A;  4YOV A;  4IEE A;  1VQL N;  3ZX2 A;  1YHQ N;  4PKI A;  4FO0 A;  2NRT A;  3WEE A;  3WXJ A;  3O4W A;  4MLE A;  3OBY A;  1QHA A;  4EZY A;  4BRQ A;  4UDY X;  3O1B A;  3MDQ A;  4JL9 A;  2H3G X;  3L0Q A;  4KH5 A;  5FIG A;  5AQR A;  2QWP A;  2FLO A;  2CGJ A;  3EO3 A;  4IDH A;  3ZX3 A;  3HOS A;  2Q0U A;  4H03 B;  3Q7C A;  2KHO A;  4KH6 A;  1HLU A;  2HF4 A;  3CCQ N;  1X3M A;  2F7T A;  3UE5 A;  3G4S N;  1GNL A;  2ITM A;  3CJ7 A;  3F2K A;  4BRC A;  4EZO A;  2YCH A;  4H0P A;  4A5A A;  1T44 A;  3N4Q A;  2YIA A;  4IJA A;  5GAG P;  4WQ4 A;  4F00 A;  3A5L C;  4BRM A;  3CPW M;  4JWI A;  2EWS A;  3E9P A;  3TTF A;  3O8M A;  1HKB A;  1KQS M;  4DB3 A;  3T49 A;  4XH4 A;  4JKE A;  1U6Z A;  3IFR A;  3OHX M;  1NGE A;  4JHD B;  4M63 C;  5M1Q A;  1QVG M;  1J6Z A;  1RFQ A;  2OAN A;  4MO4 A;  2HBL A;  3I39 X;  3CJ1 A;  3CHW A;  2IIR A;  5EX5 A;  2F9W A;  1ATR A;  2YHY A;  3QFU A;  3R1X A;  4YOR A;  4IXC A;  3WT0 A;  1LOT B;  4WFA L;  5AQP A;  3VOV A;  1H1V A;  3RV1 A;  2HMP A;  3EKU A;  3MN9 A;  4M0M A;  4HR1 B;  1E4F T;  2AA4 A;  4CD3 A;  1XC3 A;  3QNJ A;  1T6C A;  1DEJ A;  2E2Q A;  4B1X B;  4DKW A;  1MJG A;  5M1K A;  1BG3 A;  3C0B A;  3DXK B;  4KBO A;  3CC4 N;  4U7B A;  1YIT N;  1EQY A;  1GLF O;  3UKU A;  1HJO A;  1TYQ B;  5AQQ A;  4NB4 A;  4ILJ A;  5M1F A;  4A59 A;  5KQ8 A;  4JLC A;  3VF6 A;  5BR9 A;  2V52 B;  2AP1 A;  2NRH A;  2W41 A;  5M1O A;  3ATV A;  2NRZ A;  4A57 A;  3U9Z A;  4BC4 A;  4BR7 A;  1KD1 O;  4H5W A;  3I04 A;  1GLE G;  3UB5 A;  4CZH A;  3A5M C;  3CET A;  3VEY A;  4EZT A;  4JKF A;  3R3L A;  5LJW A;  1UPX A;  2P9L B;  3GL1 A;  4IEI A;  2I7P A;  3EN9 A;  1TUY A;  2HBM A;  3KK7 A;  3QDK A;  1VQN N;  4EZV A;  1Q18 A;  5ELZ A;  5I9E B;  4K42 A;  2QTD A;  3FZK A;  3F9M A;  3L4I A;  4LC9 B;  2P9N A;  4JNE A;  1Q86 O;  2WFB A;  3A5O C;  2QFF A;  3ZEU A;  3FD9 A;  3CCM N;  2KKZ A;  5AQX A;  2HBJ A;  4E3C A;  5AQZ A;  3F7W A;  1ATS A;  1K8K A;  3VEA A;  2E8A A;  5KPZ A;  1MWM A;  1JCF A;  3GG4 A;  3O3M B;  3D6R A;  4U67 L;  4MO5 A;  2V7Z A;  4H6H A;  3LDN A;  1M90 O;  4OPH A;  4XEI A;  3SLC A;  1YF5 L;  3OHR A;  2ZWH A;  3H3N O;  3O80 A;  2P9P A;  4Z94 A;  4FL9 A;  5AQV A;  1NGJ A;  2NLX A;  4JK8 A;  2VCP A;  4GV6 A;  2A6A A;  2YJF A;  2YIV X;  4K41 A;  4R5K A;  3AGR A;  1HKC A;  2P9U A;  3GE1 A;  1BO5 O;  4WFN L;  2WBN A;  3L3O M;  5EVZ A;  1QQM A;  2Q97 A;  3DWL A;  5LJV A;  2FSN A;  2PFU A;  3N4P A;  3ZX0 A;  1SU7 A;  2P9P B;  4IWP A;  1NGD A;  5AZJ B;  2VWB A;  2X5C A;  1GLB G;  1P8Z A;  1QQN A;  3T7Z A;  3RVC A;  3AAR A;  3U8X A;  4BRE A;  4H5R A;  5AQH A;  3B52 X;  2IVO A;  1DKY A;  3GBT A;  1KXP A;  2E2N A;  2QI2 A;  3FZH A;  4BEB A;  3WQU A;  3NVM A;  3CIP A;  1GLD G;  3A5N C;  5AQT A;  4ILG A;  3ZYY X;  1U2V A;  1S72 N;  1ZC6 A;  3IKM A;  1IG8 A;  2VGM A;  3KAW A;  5MLC Q;  3D2E B;  3LL3 A;  1HKG A;  3ER8 C;  1VQP N;  2YI9 A;  3HTV A;  3O9Q A;  4JKG B;  3ZET A;  3NVK A;  3KWG A;  5C2F A;  5EOY A;  3ULE A;  4BEC A;  3FLC O;  4WCE L;  4QS7 A;  5JVG L;  1Q7Y O;  3WEE B;  4JHD A;  1MWK A;  3G25 A;  2GAF D;  5ADX H;  3HM8 A;  1DT9 A;  1NBW A;  2D0O A;  4JKD A;  5KPT A;  4WFB L;  1KC8 O;  4FOE A;  4ILI A;  2NRV A;  1LCU A;  2QWO A;  3LDP A;  3ZET B;  3N8E A;  4KIK B;  2CGL A;  1BDG A;  2Q1N A;  3U4L A;  4YOW A;  1VQM N;  3B8A X;  4MQD A;  3E9L A;  4O5F A;  3R6M A;  4A2B A;  1Z05 A;  2D1K A;  1HX1 A;  3M6G A;  4B1U B;  5JLF A;  1R59 O;  4A2A A;  2QEX N;  5AFU A;  2FSJ A;  3DJC A;  4IO9 L;  3NMU A;  3VEB A;  3BF3 A;  3IMX A;  2PAV A;  4BRN A;  4BRH A;  2A41 A;  3I56 N;  2N3K A;  1T6D A;  3MMV A;  1VQ8 N;  1NGC A;  2E1Z A;  3EKS A;  4QS9 A;  4JNF A;  1DGK N;  4BG9 A;  4IM2 A;  2GWK A;  4J8F A;  5BPM A;  2A42 A;  4BRG A;  4NLB A;  4BGB A;  2GEM A;  4BR9 A;  5AZJ A;  3HBT A;  2Q2R A;  3CJC A;  4YDU A;  2BUP A;  3UIT A;  5M1N A;  2RHK A;  5FPE A;  3SMS A;  4WYB A;  1GN9 A;  2NCZ A;  3SBG A;  3KHY A;  3H46 O;  2GA9 D;  3H6E A;  3EE9 A;  4BC5 A;  4BGA A;  2D4W A;  5B8H A;  3GI7 A;  3SAG A;  1YI2 N;  3LDL A;  1E2U A;  3O9R A;  3TSQ A;  1SU8 A;  3DQG A;  3WQT A;  4BRD A;  3ZED A;  5FPM A;  2YHX A;  1NGB A;  5FLE X;  4CI6 A;  4OO1 J;  4H0X B;  2A40 A;  1KAX A;  4MLH A;  2YI1 A;  5E26 A;  4B1W B;  4BRF A;  5F1X A;  5KQD A;  3DPP A;  3VGM A;  4ILH B;  3K9J A;  3UKU B;  1YJ9 N;  7HSC A;  1P90 A;  1BUP A;  1U2V B;  2QWQ A;  3O08 A;  5AQN A;  4A62 A;  5F0X A;  4WV5 A;  3EL2 A;  4FWO A;  5GAH P;  4EAH D;  3ER9 B;  5BN9 A;  3MWP A;  3C7N A;  2YHW A;  2FSK A;  3FZF A;  4NLC A;  1X9J A;  1XQS C;  4UY8 O;  5C0Y A;  3AAP A;  1ATN A;  1GLJ O;  5GAE P;  3S41 A;  4R5I A;  3VTI A;  4YDU C;  4F9O A;  1Q82 O;  3FGU A;  3VES A;  4BRL A;  4PHT X;  4ISE A;  3WXL A;  5AQY A;  3FZM A;  1BWF O;  3G6E N;  3CCJ N;  1NGF A;  1IJJ A;  3CJ9 A;  1T3V A;  3TPQ A;  4E1J A;  1VQ4 N;  2W00 A;  4H0O A;  4FWR A;  2EWF A;  3SJH A;  2ND0 A;  3BF1 A;  3CCU N;  3P39 A;  4EZR A;  2QWN A;  3C6A A;  1W9M A;  1BA0 A;  4PL8 A;  3VEW A;  4H5V A;  4B1V A;  1NLV A;  1YIJ N;  4EZP A;  5CR4 A;  4F01 A;  3HI0 A;  4XH5 A;  2OBM A;  3QB0 A;  3SAH A;  4JWE A;  1O13 A;  2PY6 A;  4CZE A;  3PLA A;  4H6I A;  4BR4 A;  3CPE A;  4B9Q A;  4FWN A;  5C2D A;  2OBL A;  3U9D A;  2HOE A;  5JMV A;  5M1P A;  2ZJQ L;  3MX5 A;  2FF3 B;  4IZ9 A;  3RV0 A;  3H0X A;  1NGG A;  2OTJ N;  4HY9 A;  4R5G A;  5AQI A;  4EZZ A;  1GLC G;  2VGN A;  3A0I X;  4H0T B;  3VEZ A;  3SBT A;  4CD1 A;  3T47 A;  3SK3 A;  3CME N;  4IM0 A;  4EZW A;  1BU6 O;  4XJX A;  3VPZ A;  4FM3 A;  4RTF D;  1OVY A;  4I6M A;  3R8E A;  3MN6 A;  4EZU A;  3ID6 A;  2OP6 A;  3VKH A;  2V51 B;  3K9K A;  4G9Z A;  1ILY A;  2F9T A;  2YI8 A;  2DPN A;  1S3X A;  3D7E O;  3AY9 A;  4JK7 A;  4EHU A;  4CJ7 A;  5JVH L;  4ISG A;  4E81 A;  5FPN A;  3E66 A;  2P9S B;  4OPA A;  4CZJ A;  3B51 X;  1MDU B;  1NGH A;  4BR0 A;  1DG4 A;  5AQM A;  4JWD A;  4AM6 A;  1E1D A;  2A3Z A;  4EZX A;  4R5J A;  2CH6 A;  2CGK A;  4CZM A;  3J7Z O;  3WXI A;  1YJW N;  2C1I A;  1V4T A;  4BVP A;  5E84 A;  4HYB A;  2E2P A;  1DKZ A;  3OW2 M;  3EE8 A;  2VYP A;  1E9V A;  4NO7 A;  4H5T A;  4BQZ A;  4WQ5 C;  4NPH A;  3LM9 A;  2NRX A;  3J8A A;  1K73 O;  1W2B M;  3MN7 A;  4BRK A;  2FXU A;  4ILH A;  3KAV A;  3H3O B;  3ZEU B;  3CF5 L;  3O1W A;  1JQK A;  1VQO N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...