4JNEA

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hsp70 CHAPERONE DnaK
publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jneA05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jneA04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jneA03
2ITMA 2E1ZA 4WV5A 2Q2RA 1E4GT 4H03B 5EX5A 3VGMA 3KHYA 1HKBA 3IUCA 4H5VA 4BR9A 4HWIA 3IMXA 3WXJA 2IVNA 3KVGA 3P4IA 1ATRA 4XH1A 4BRIA 3ZX3A 3DPQA 4BR5A 1HX1A 2QWNA 4BRNA 3L4IA 4FO0A 4BR4A 4PL7A 3C7NB 4BROA 4WQ4C 2IIRA 5AZJA 2A3ZA 4CBWA 3WEEA 2P9PA 1BA0A 2D0PA 2QWMA 5EVZA 1DKYA 3T48A 1IG8A 3HZ6A 5BN9A 3HBTA 4HYBA 3VEVA 1QHAA 1BUPA 1GLJO 3QDKA 2YI1A 3I33A 3UKRB 1QQMA 3CJ7A 4JD2A 3U8XA 2GTDA 3CI5A 3C7NA 5E26A 3ZEUB 1QZ5A 1ESVA 3MN9A 4CZJA 3B8AX 4I6MB 1YUWA 2AP1A 4EZRA 5AZIA 4B1XB 1NM1A 1J6ZA 4ISFA 3WQUA 3RSEA 1RDWX 1JCGA 1LCUA 4B1YB 2A42A 3JS6A 3DAWA 3T4AG 2UYTA 1E4FT 4JAXA 2HMPA 7HSCA 3VF4A 2ASMA 1MWMA 3WUHA 5FPNA 3CERA 1QZ6A 1DEJA 4H5WA 1WUAA 5LJWA 4I6MA 1CZAN 1BO5O 3UKUA 2IVOA 4WV7A 4Y0WA 5BPNA 2ZGYA 3C0BA 1GLDG 3D7EO 4F01A 2Q0UA 4PKGA 1V4TA 4JHDB 1TUYA 3MDQA 3DXMB 3SMPA 1NGFA 2W41A 4CZEA 2VCPA 3MN7A 3OHRA 4PKIA 3QFUA 4BRKA 4CZIA 3DXKB 3IFRA 4WQ5A 1Z6RA 2NZTA 4BGBA 1X9JA 3WXIA 3L6QA 3LDNA 4FOIA 2V51B 3O1WA 4EZVA 4A2BA 2CGKA 3CJ9A 4IJAA 3T49A 1U2VB 2OP6A 5BRHA 3H6EA 2Q97A 4BRQA 4CD3A 3VGLA 1HJOA 1XUPO 3DPPA 4NB4A 1BWFO 4Z94A 5AQOA 4EZXA 4JHDA 5AQXA 3VGKA 2P9SB 4BC5A 4BREA 1D4XA 4BG9A 2QM1A 3SK3A 5B8HA 3O5BA 3EZWA 2ZGZA 1QQNA 2FSNA 5BREA 1BA1A 3M1FA 3R9PA 1GLBG 2P9LB 2AA4A 3ATVA 2CH5A 3QNJA 3M6GA 4RWTA 3H3NO 1U2VA 4EZUA 3O8MA 5AFUH 3O6WA 4QS8A 5CE3A 1RGIA 4BRCA 5BPLA 3T46A 1XC3A 4NO7A 4XH5A 4FWOA 4L3QA 4FOEA 1V4SA 1DKGD 1GLAG 2J4RA 3VEWA 1HKCA 1GLCG 4FWQA 3ULEB 4BRMA 3FZMA 2IVPA 4CZLA 3VF6A 3GG4A 2NLXA 3LDPA 1C0GA 4EZZA 3ZX0A 3TU5A 5AQHA 3U9ZA 4K41A 3GE1A 1NGHA 2QWLA 3GDQA 1SAZA 1ZC6A 2E1YA 4IZ9A 5AQFA 3FZHA 1ZBSA 1Y64A 4R5GA 2HOEA 3BF1A 3F9MA 3O80A 3QBXA 1HPMA 5AQQA 3HM8A 1DKXA 3WXLA 4FL9A 2P9NB 3QFPA 1NLVA 1KAZA 3IDHA 4BRHA 2P9KA 4PKHA 2WUSA 4B1ZA 4XEIA 5F0XA 1S22A 3LM2A 3R8EA 3ULEA 4AM7A 3CJCA 5AQKA 1MDUB 3U9DA 2FLOA 4BRPA 4CD1A 4ISEA 1Q18A 4BVPA 5AQLA 3QBWA 3ENHA 4BC4A 2ZWHA 1KXPA 2P9UB 3VENA 4BRLA 2QFFA 3AY9A 4H6HA 3FFKB 3H46O 4HTLA 4ISGA 1T6CA 2Q31A 2E2NA 3DOBA 5AQRA 1MA9B 2FSKA 1SQKA 3ZX2A 3O1BA 4DQ8A 1U00A 3JXUA 4WQ5C 4MLHA 4H0OA 3U4LA 2V7ZA 5AQGA 1HKGA 4R5KA 2FF3B 4FWMA 1NGAA 3H0XA 4YDUA 3QMLA 5EXWA 2BPRA 3UKRA 2GEMA 4H0PA 3H3OB 4MO5A 1GLEG 1TYQB 4M7XA 3ZEUA 4C23A 3FZLA 3L3OM 5AQUA 1DKZA 4CJ7A 5AFUA 3A8YA 5FPDA 3DPOA 3UB5A 4F9OA 1EQYA 3MK6A 2A6AA 4FWPA 3M3ZA 1T6DA 4H6IA 4BR2A 2ASOA 3N8EA 2BUPA 1YAGA 1ATNA 4K42A 3FGUA 3DQGA 4EHTA 3I8BA 3FLCO 4EAHD 1TYQA 1NGJA 4EZOA 1HLUA 1NGBA 2PBDA 1BG3A 3O4WA 2E2QA 1S3XA 3GBTA 5ADXH 2V7YA 4BQZA 5JMVA 2VYPA 4H0XB 2E2PA 3VERA 3VETA 4EIAA 1NGEA 4H0TB 4BQLA 4H5NA 3VPZA 5F1XA 1OKJA 2KHOA 3DXMA 4O8KA 2CH6A 3CJBA 2D1KA 4FWKA 4BRDA 4K43A 5E84A 3DXKA 5AQPA 3FZKA 2CGJA 1KAYA 3FR0A 4FPBA 4EFHA 4PO2A 1CKRA 2YCHA 3O08A 1NBWA 3FZFA 4JNFA 2OANA 1JCEA 3T47A 2Q1NA 1C0FA 5FPMA 2P9IB 4EZNA 3MN5A 3BEXA 4B1WB 3SMSA 3FE1A 4JWIA 2F9TA 3CQXA 1DG4A 1GLLO 2P9SA 2D0OA 4EZWA 1JCFA 2A41A 2QWRA 3CETA 3LM9A 5AQWA 3MMVA 3DWLA 3G25A 3ENOA 4BVOA 2CGLA 4CBXA 2P9LA 2YHWA 3KZBA 5BPMA 2W40A 4JNEA 4A61A 1G99A 1SZ2A 2H3GX 2P9IA 4FWRA 5KPRA 4EZSA 1H1VA 2GUPA 2DPNA 3J8AA 1WOQA 1BDGA 4FWLA 4FPAA 5AZJB 4JWDA 2BTFA 2F9WA 1NGDA 5AQVA 3W0LA 4YDUC 4JWCA 5JLHA 5KQ8A 3HI0A 3WEEB 2P9PB 4EHUA 5AQMA 4BRGA 4RCHA 3ZETB 4CZHA 2HF3A 2E2OA 2GWKA 4IO8A 1P8ZA 5AQZA 4AM6A 4XH4A 2WINM 3EN9A 1BOTO 4CZFA 3AAQA 5AQYA 2I7NA 4JD2B 5FPEA 4FWSA 5JLFA 4QS7A 4E1JA 5BR9A 1BPRA 4E81A 3CQYA 3AAPA 1LOTB 3D2FB 3VESA 5AZIB 3R6MA 2P9NA 5JICA 4BRFA 5F2RA 5I9EB 4CBUA 3RSEB 4EZYA 2FXUA 3TPQA 4R5JA 4BC2A 5ADXA 4IWVA 2A40A 3BP8A 1Z05A 1T44A 3CJ1A 3EL2A 5EY4A 3ZETA 2Q36A 1XQSC 2HF4A 1U6ZA 4HY9A 4FSVA 3GOIA 4CZGA 3H1QA 4MO4A 3OHXM 2A5XA 3LL3A 4CI6A 3LDQA 3LDOA 3A5OC 5BN8A 5AQSA 2P9UA 3A0IX 3EKUA 5AQTA 3A5LC 1YVNA 5KPTA 4R5LA 3D2FA 5LJVA 3SJHA 3UKUB 5TKYA 5AQJA 3L0QA 3WQTA 3CJAA 2YHYA 3MN6A 4H0VB 4IJNA 4M7YA 2YJEA 4H5TA 1ATSA 3DJCA 3VF2A 2QWQA 1DGKN 2ZF5O 1Q5LA 4WQ4A 3HSCA 4H5RA 2QW9A 1K8KB 2YHXA 1KAXA 2V52B 3BUZB 4M63C 4CZKA 1X3MA 5AQNA 1NMDA 4H0YB 2Q0RA 3VEYA 3SLCA 5KQDA 4R5IA 3UE5A 4GY2B 2GWJA 3W3DA 2QWPA 3ID8A 4PL8A 3QICA 1BU6O 4B1UB 5AR0A 2E20A 1X3NA 2YJFA 3WXKA 3VEXA 4BR0A 3D2EB 1YXQA 3H45C 4QS9A 1NGCA 1R59O 2ASPA 2FSJA 1K8KA 1ZXOA 5EOYA 4BR7A 3GL1A 4DB3A 4B1VA 3CHWA 2NRHA 3WT0A 4A2AA 4JWEA 3A5NC 3S41A 3AARA 4JN4A 4CZMA 4EZPA 2E88A 1NGIA 4DCHA 3VEOA 4BGAA 4A62A 1IJJA 2EWSA 1MWKA 3EKSA 4DHYA 4LC9B 4B9QA 3BF3A 1GLFO 4BG8A 4RTFD 4EZTA 4K25A 1HUXA 5ELZA 2I7PA 3ATUA 3VEZA 2GELA 2QWOA 4O5FA 3D2EA 3CIPA 4FWNA 4J8FA 2D4WA 4BRAA 3EO3A 4MLEA 1NWKA 2QXLA 5AQIA 2PAVA 3H1VX 3QB0A 3MCPA 4WYBA 1QQOA 4IXCA 2E8AA 4GNIA 3VOVA 5BRFA 5KPZA 4EZQA 1TUUA 3LDLA 5LY3A 5BRDA 1NGGA 2VWBA 3A5MC 2P9KB 4BC3A 1RFQA 3HTVA 2FF6A 4F00A 4KBOA
chains in the Genus database with same CATH superfamily
5EX5A 4WV5A 1E4GT 4H03B 3T19A 3KHYA 2YNGA 1C1BA 3HPGA 4Z4EA 2GF4A 2JWLA 3KVGA 4EP4A 4DFPA 2OYQA 4BRIA 2PY5A 3S3MA 4JI3K 3TSQA 1K6YA 3K5LA 3LWLA 4E7JA 3L4IA 4R79A 4FO0A 2X5CA 1SKWA 4OKJA 4BROA 2GUIA 3OK8A 2HHXA 3LP1A 3OBWA 4CBWA 1GOBA 2P9PA 1VQ7N 2D0PA 4WCEL 4N5SA 5M1OA 3ZSYA 1RBUA 3T48A 2F7TA 1IG8A 4CJPA 2E6MA 3TABA 3DLGA 1QQMA 5FLEX 3U8XA 4LF8K 1UPXA 3CI5A 3OW2M 4UY8O 3MN9A 1B92A 4OO1J 5C10A 2Q12A 2WYIA 4EZRA 4HVJA 4FK2A 3K5MA 1YI2N 4ISFA 3VQEA 4CJKA 3DI6A 4IOAL 3AA5X 3K57A 3NDKA 3NE6A 4FYDA 4FZZA 2GX9A 3Q7BA 1OAOA 1QHTA 4IOCL 3TTCA 1W2BM 4N76A 1EKEA 4JLHA 3VTIA 1E4FT 2O8BB 3VF4A 3F9KA 1MWMA 2NRZA 3CM6A 3VKHA 3QA8A 1GOCA 3HVRA 1E9VA 3PLTA 1DEJA 4H5WA 4KB0A 3VQ4A 5CYMA 2G8KA 1WSHA 3F7WA 1WB9A 3C0BA 4DSJA 4F01A 2Q0UA 4I2PA 1JLFA 4PKGA 4JHDB 3LP0A 1WSFA 1J53A 3MDQA 4DLEA 1NGFA 1S72N 5MLCQ 4BRKA 1VQKN 3DXKB 4DSLA 3IFRA 1S6PA 4B9VA 4KTQA 4BGBA 5CYQA 4GV6A 3WXIA 4DU4A 4JL9A 1ZWWA 4DF4A 1U2VB 3AV9A 1RT1A 3AVFA 3H6EA 1SU6A 4CD3A 4OLBA 4MQDA 3HPHA 2KFNA 5I3UA 1LWFA 4FLTA 1BWFO 2HBJA 3PX6A 3VGKA 1Q81O 2BE2A 2YL9A 4C8NA 3AVJA 2QM1A 4CEOA 3AVLA 2ZGZA 1QQNA 4FLUA 1Q9YA 2VG7A 1T3VA 3M1FA 3MEDA 2CH5A 1ILYA 3AGRA 2F4VK 3I01A 3M6GA 2IGIA 1X1PA 3H3NO 4RG8A 3O6WA 1HNXK 2O4IA 4FW1A 1VHXA 1XC3A 4LY7A 1V4SA 1GLAG 3P1GA 3SUPA 3BVVA 4OVLA 2ZJRL 4F2RA 5HROA 1KQSM 3LDPA 3HAJA 1TAQA 3IKMA 3RMBA 2UUAK 3TU5A 4KAZA 2E1YA 5AQFA 1D9DA 1XMQK 3IG1A 3PY8A 1ZBSA 3QBXA 1XNQK 1DKXA 3WXLA 2QK9A 4IM3A 1I4TA 2P9NB 4J2EA 3QFPA 5IWAK 2P9KA 1IH7A 4DR1K 4KO0A 4XEIA 3SUNA 2PZSA 4FJLA 2D0BA 3R8EA 3ULEA 2OCEA 4DV4K 1NK8A 1Z25A 4IBNA 1VQON 2FLOA 4I1QA 4BRPA 3O3NB 3VQPA 4FZOA 3CCVN 1Q18A 2X74A 4BVPA 3ZT1A 3O9TA 4DSEA 3QBWA 2HMIA 2X6SA 4CJQA 4CJRA 2P9UB 3OYGA 4I7FA 4ISGA 4BRLA 3H46O 3KK7A 4HTLA 1L3VA 2Q31A 1GNTA 4BWJA 4CEEA 3CVRA 3DOBA 1HJRA 5AQRA 1GNLA 3CFPA 4DQ8A 1U00A 3JXUA 3SCXA 2V7ZA 5A2QO 3AO3A 2G8VA 4DR7K 4FJNA 2FF3B 4FWMA 1KLMA 3ZSRA 3OBYA 4CERA 4CJFA 2GEMA 3S3NA 3I0SA 1JJ2M 2EX3A 4DS5A 1ZBLA 4E72A 2GA9D 3QINA 3WXMB 3FZLA 3L3OM 2XY5A 3A8YA 2C08A 4JI1K 4F9OA 2A6AA 1TL3A 4BR2A 1NNEA 1NOYA 3EE9A 4BWMA 3KLGA 1SKSA 4K8XA 2WBNA 3CM5A 2O8BA 1E1DA 3SAHA 3DQGA 4EHTA 4LFCK 4ATMA 1VQMN 3C65A 4DTXA 4B3OA 4EZOA 3DLHA 1O7DB 3NFAA 1HLUA 3PO5A 2PBDA 1BG3A 2I5JA 2IS3A 4BQZA 5JMVA 4E89A 3THWB 3TSUA 3HJFA 4CHOA 3VPZA 3SI6A 4DYLA 3OTOK 4BE7B 4BRDA 3DXKA 1W97L 3FZKA 2F1AA 4KHUA 2CGJA 3OYKA 4MDBA 1KAYA 4FPBA 3KAVA 3L4QA 1RBVA 4O0JA 3D52A 2JGUA 2OANA 4JKFA 5M1FA 1TQSA 1NK7A 2WOMA 3SUQA 4CF9A 4FM1A 1I3AA 1GLLO 2A1RA 4FJ7A 2YHBA 2YL6A 3CETA 3OS0A 3SV4A 3QIPA 4LF5K 4CK3A 1RDCA 2YHWA 4FJ9A 2G8FA 4AZ6A 2RPIA 4OPJA 5FRMA 2P9IA 4CGHA 4DKWA 1H1VA 2FBVA 4DTJA 1NK4A 1WOQA 4FWLA 4FPAA 1ASWA 2PYLA 4JWCA 5CZ1A 3V9UA 4U7BA 1LWEA 4EHUA 5AQMA 4CJLA 3OJUA 4AZCA 2NUBA 4KKOA 3LALA 3EZ5A 3SUOA 1L5UA 1J5EK 2BDPA 3EN9A 3AAQA 5AQYA 5FPEA 1NJIO 2KZMA 4V19S 3E01A 2E6LA 5C2DA 4PY5A 2F18A 2P9NA 4BRFA 4CJ4A 2D1LA 2OZNB 3B52X 5I9EB 3KAWA 4CBUA 3RSEB 4EZYA 3K5NA 4ILHA 4IWVA 1YTUA 4LFBK 4BDYA 3HSTB 4YOUA 4FJXA 2JNSA 3GOIA 4D8JA 4CZGA 3K58A 2G8HA 1YWMA 1RDDA 4MO4A 3P31A 3D51A 2Z0OA 2P9UA 1VQ9N 5AQTA 2QKBA 1TKXA 1KLNA 1YVNA 3D2FA 3SJHA 3DRRA 4M7YA 4H8KA 4FLXA 1ATSA 1RTHA 1A5XA 3MX5A 3VF2A 1DGKN 1T8EA 1Q5LA 4H5RA 3M8PA 2YHXA 1S9EA 4NYNA 1KRPA 2V52B 4IFVA 3OYMA 1XI1A 1X3MA 1C1CA 4H0YB 3F73A 1OA0A 1BHLA 5KQDA 3UE5A 1S1VA 3DX3A 2PYJA 4B9MA 4IWOA 2QWPA 4PUOA 2YX6A 3ID8A 1RT4A 3QICA 2E20A 3L3PA 1X3NA 1VSFA 2D0AA 3RRHA 3ID6A 3V9SA 3QEWA 2Z1IA 3H45C 3C6TA 1K8KA 4NCGA 1BQNA 2VG6A 4HCCA 3I2WA 5J2MA 2NRHA 3CCLN 3S9HA 3AARA 3VQ7A 4EZPA 3AO5A 4N41A 1NK6A 3MECA 4G6QA 4BGAA 1TK5A 1MWKA 3IRXA 4Z4FA 4B9QA 3R1XA 4BG8A 4KB1A 4M3UA 4FJIA 4NLBA 4K25A 4JK9A 2I7PA 3VEZA 4AHSA 3MWPA 1SL0A 1NJXA 1JLGA 4LSLA 4CJUA 2PAVA 4KPYA 4M0MA 3RV1A 4AQYK 3KJVA 5DMRA 3QETA 1SS6A 1URUA 5BRFA 3CMAN 3VQBA 1N34K 2DFHA 4E7KA 5DK5A 5BRDA 4JKGB 4ILIA 4KHSA 1VQ4N 3HTVA 4CECA 5JVHL 4RW7A 2RKIA 4PA1A 1IKWA 3IUCA 4BR9A 5BR8K 3TAMA 4HWIA 3IMXA 2IVNA 1HQUA 4XH1A 4E1NA 2VGNA 1HX1A 2QWNA 4DU1A 4BRNA 2B5JA 3NGYA 3ZT2A 4ZHRA 4DTRA 3THXB 4FJHA 4PL7A 1OH8A 3NAEA 3JYTA 4WQ4C 4IO9L 2A3ZA 1W0HA 4GKJK 5FIGA 4M3ZA 3VTHA 3P38A 3PV8A 3P5JA 3SJJA 1DKYA 2ZM6K 5BN9A 2E5LK 3AGKA 3ENBA 4ZTJA 2VWJA 3ER9B 1QHAA 1BUPA 3QDKA 2YI1A 3SAFA 3I33A 3SBTA 4M42A 2E4LA 2O8EB 2GTDA 4JRPA 3VQAA 3CFRA 2WC9A 3C7NA 5E26A 3O3FA 1ESVA 3I55N 4F8RA 1NM1A 2FYVA 2FICA 1J6ZA 3P39A 1IKYA 2HNDA 1UA1A 4CEZA 3RSEA 3EJPA 1LCUA 3E9OA 5HP1A 3A98A 3LMFA 1BL3A 3CKDA 3NVKA 2OBMA 3DAWA 4HHTA 1SL1A 3T4AG 3OYLA 4DTUA 3SYVA 2QXFA 2PY6A 1QZ6A 1P90A 5LJWA 1U47A 4GKKK 2EHGA 3BVTA 2RF2A 3BUPA 2IVOA 4WV7A 4DTOA 1KCFA 4J2DA 3D0PA 2YL8A 2D5RA 1V4TA 3NGZA 4DV5K 1JLBA 3DXMB 1O1WA 2VCPA 3MN7A 4JRQA 3HAIA 3AA2A 4O8UA 1Y2OA 4WQ5A 1Z6RA 3TSPA 4FXDA 4ELTA 2V51B 2XY7A 3O1WA 1QSSA 4A2BA 1VK0A 4IM0A 3CCSN 1KSPA 2NNWA 4IJAA 3MXIA 3QIOA 3TTDA 4HUGA 5BRHA 3VQ9A 2OPQA 4KH5A 2DTUA 1HYZA 1XUPO 3LZJA 3DPPA 5J2PA 4NPHA 1NMNA 1HR0K 3DM2A 1JL2A 4KHYA 1BA1A 3ZT0A 3CF5L 2P9LB 5E41A 3ZEDA 3ATVA 5HOOA 3HYFA 3RPMA 3NF8A 4FW2A 1SV5A 3T69A 4EZUA 3O8MA 5AFUH 1RGIA 4BRCA 3DOLA 1LAVA 4IEEA 1JL1A 4NO7A 4MDAA 3DOKA 1M1KO 4XH5A 4FWOA 3F2KA 1DKGD 2J4RA 2Z1GA 1HKCA 4BRMA 3ULEB 4K8ZA 3VF6A 5HL7L 3GG4A 2NLXA 2Z1HA 3KK3A 1E2UA 1C0GA 4LF7K 3U9ZA 3EE8A 5AQHA 3VMFB 1NGHA 3GDQA 1SAZA 3QERA 4LD0A 4OKEA 4M3RA 4X66K 4R5GA 3F9MA 2F1BA 3O80A 3SQ0A 1HPMA 4XIUA 1IKVA 2NRXA 1HWWA 3HM8A 4JKGA 3CYGA 2NRTA 1NLVA 1JKHA 3VQ5A 4Z4CA 1WNSA 4PKHA 3HP6A 2P1JA 2WUSA 4DV7K 1S22A 3LM2A 3BLBA 1S6QA 4CHPA 3U3YA 1KC8O 2G8IA 3VQ6A 5AQKA 1BISA 5KGWA 4JS4A 4CD1A 4AHCA 4ISEA 4CEAA 3SQ4A 3D45A 5AQLA 1O13A 3LDSA 2XY8A 4NQIA 2ZWHA 5GAHP 1YJNN 3VENA 3THXA 2EX3B 2X3WA 3UIQA 2QFFA 3JSMA 4H6HA 2EWFA 2IAJA 4UQGA 4GV3A 2E2NA 1K8AO 3ZX2A 4CFBA 3O1BA 4MLHA 1HNVA 5AQGA 1TAUA 5HRNA 4ELUA 2HNZA 2HHTA 1NGAA 3L2WA 3H0XA 1ZBFA 3QMLA 4GW6A 3O3GA 1EWRA 4H0PA 4CJWA 2O8EA 1N33K 2YIBA 3KTQA 3TARA 4KREA 3OY9A 3MWTA 1W9MA 3V81A 5AQUA 5AFUA 3DPOA 3MK6A 4M3TA 4FWPA 3M3ZA 3MEGA 3AVIA 5H1SQ 2WFBA 3N8EA 2BUPA 1XHXA 3V9WA 3CZNA 3HOTA 4Q5VA 1RNHA 4BE2A 4EAHD 1TYQA 4NLCA 4E7IA 2FBYA 1SUQA 2B6AA 1IO2A 5HLFA 5ADXH 2V7YA 3NF7A 2YKTA 3VETA 5SWMA 3CZSA 2RAJA 4B9NA 3CCEN 3DXMA 3O9UA 2CH6A 4DV2K 3CJBA 2D1KA 4FWKA 4JKCA 4K43A 5AQPA 4DV1K 1TQTA 4AH9A 3FR0A 3LPTA 4EFHA 3O08A 3FZFA 3QNOA 1JCEA 1HYVA 3T47A 5FPMA 1N5YA 2P9IB 4A5AA 4CE9A 4FVUA 3Q84A 4AHRA 3E66A 2UUCK 5J1EA 3BGRA 3EJRA 3ULDA 5GAGP 4I43A 2F9TA 4DFJA 1JXBA 1DG4A 3WNEA 2D0OA 1T05A 4AZCB 4EZWA 4ILJA 4AZ7A 1LQ7A 2QWRA 5AQWA 2JNKA 3DWLA 4CFCA 4CJSA 4CBXA 2P9LA 1SUFA 5LL6Z 4JNEA 1W7AA 4A61A 4KRFA 1RCHA 1G99A 3HT3A 2MI7A 4FWRA 1ASVA 3AO2A 1B9DA 2GUPA 4I2QA 4KV8A 5KQ8A 3K5OA 3E9PA 3HI0A 5HRPA 3WEEB 3EJTA 4ILHB 3TR8A 2YIAA 4E0DA 4CZHA 4JKEA 2HF3A 4ICLA 2E2OA 2GWKA 4AHUA 3FD9A 5AQZA 4FWSA 5JLFA 3T7ZA 1WDZA 3MEEA 4WPCA 2D0CA 3DX0A 2EFLA 3D2FB 3VESA 5AZIB 3R6MA 4DQPA 2BANA 3L2QA 1RDAA 4CIFA 1FJGK 2FXUA 1WSEA 2YHAA 5ADXA 3T3FA 3ZETA 1Q8IA 1T44A 3EL2A 2Q36A 1C0UA 1XQSC 2HF4A 4CGIA 4HY9A 3K2PA 3SPZA 1VSHA 1Q82O 2A5XA 3LDQA 5BN8A 3A5OC 1Q7YO 3DMJA 2DY4A 3A5LC 1X9WA 4C1NK 4YOTA 5KPTA 4R5LA 1BIZA 1U45A 5TKYA 4TSXA 5C24A 3CJAA 3MN6A 4HTUA 2OA8A 3EJQA 2YJEA 1XHZA 3O9RA 4YY3K 2ZF5O 1ZBUA 3HSCA 4FJ5A 2HSTA 3CCRN 1K8KB 4AVMA 2BGGA 4EP5A 4WFBL 1JLQA 4Z4GA 1KAXA 2UU9K 2HB5A 3PLAA 4FM0A 2O8FB 5GAEP 4R5IA 1J54A 2NCZA 4IEIA 4OX9K 2ALWA 3QO9A 3W3DA 3BVXA 2W42A 1L3TA 4OGCA 5AR0A 4E3SA 3D4YA 3VQCA 1X04A 2YJFA 4YFUA 1D8YA 4DR6K 2LM0A 1YXQA 2A1SA 2BH1A 4QS9A 1R59O 2FSJA 1G15A 3HXMA 1N32K 4K0KK 4B1VA 2OTJN 2JWKA 3CHWA 4A2AA 5C2FA 3T1AA 3C6AA 3SAGA 1DLOA 4JN4A 4CZMA 3VEOA 3VQ8A 3J81O 4AHVA 1IJJA 1EXQA 2EWSA 3QEPA 2HVIA 4FLZA 4LC9B 3BF3A 1GLFO 2RHKA 4JI4K 1QSYA 1HUXA 4DV3K 1VRTA 2QWOA 3D2EA 4MFBA 4M3YA 4FWNA 3HP9A 3PSFA 4BRAA 4DFMA 4FJJA 1QQCA 3EO3A 3V9ZA 1VSJA 3H1VX 1WAJA 3QB0A 4JKAA 1S1XA 3MCPA 4C1NI 2W00A 1QQOA 4IXCA 2KFZA 4JI5K 4QAGA 3RMDA 3VOVA 1XWLA 2ZJPL 5KPZA 1TUUA 2YIVX 1XMOK 4KFBA 4QCLA 1RBRA 2F96A 4BC3A 1TQUA 2FF6A 1DT9A 5SZTA 4KBOA 2YLAA 4FJMA 1KVAA 3AVAA 4B3MK 1TVRA 1SU8A 3NF9A 2R7YA 3G6EN 3AVBA 3DRSA 3M8QA 4BEBA 4Y1CA 3WXJA 4KI6A 3P4IA 2O8DB 1ATRA 4CJEA 3DPQA 3WNHA 3CFOA 3SBTB 5KRSA 4DR3K 1N6QA 2QEXN 1YITN 4BR4A 4BACA 4HR1B 3C7NB 4DQQA 4Z4IA 1IV0A 1LW0A 3QNNA 5GIOA 4A59A 3AVHA 1UA0A 3LANA 1GN9A 3CCMN 4OLAA 1XNRK 1NOZA 3UITA 3AA4A 3LZIA 1KTQA 3WEEA 3RRGA 5D3GA 1BA0A 1QVGM 5AJ3K 3THYB 4IG0A 3HBTA 4DTNA 4HYBA 3MCAB 1W9HA 1U49A 4X65K 3VEVA 3K0SA 3UKRB 3T1HK 3CJ7A 3DYTA 3KK2A 3A2FA 1JLEA 3D4ZA 1YUWA 2AP1A 5AZIA 1DTTA 4FJGA 4B9UA 1TKDA 2O8CA 4IWQA 1JCGA 4B1YB 2QKWA 2A42A 3JS6A 4GVEA 2QTDA 4WFNL 2FBTA 1TK8A 1Q86O 4CK2A 3TAGA 3ZLJA 2ZQBA 4JAXA 7HSCA 1O7DC 1RTJA 2HVHA 5FPNA 4KH6A 4W5NA 1NK0A 4N56A 4IM2A 1T7PA 4DU3A 4Z0UA 4I6MA 1SU7A 4CEQA 2OTLN 3B51X 1CZAN 1REVA 3KKRA 4DUZK 3JAMO 1OH6A 1L3UA 4ID5A 3D7EO 1GLDG 1CLQA 3DRPA 1OH5A 3OWGA 3AVCA 1WAFA 3E1YA 1QX1A 1C0MA 1VAZA 3LAMA 3TWHA 3ACOA 3OHRA 4F3TA 3ASMA 1S1TA 3QFUA 3R3LA 4PKIA 1T03A 5HRSA 4F2SA 3Q0KA 4BDZA 1HNIA 3P83D 3OYFA 1IKXA 1X9JA 3L6QA 4FOIA 3NHGA 3ZCMA 2CGKA 3CJ9A 5FLXO 3OYDA 5M1KA 3WNFA 2Z8YA 1RTDA 2O8FA 4JI6K 1SL2A 1RT2A 2Q97A 4A5BA 2LSNA 2VG5A 4BRQA 3CG7A 3VGLA 1HJOA 3BY5A 4F4KA 2KKZA 4NB4A 1QS4A 3LAKA 5AQOA 3C95A 4AZIA 2P9SB 4BREA 1D4XA 4B9TA 4KHNA 3SK3A 5B8HA 3O5BA 2OW7A 3EZWA 1RT7A 4IFEA 2ATQA 2P51A 3R9PA 1GLBG 3FFIA 4CEFA 3BUDA 3T1YK 2RT6A 3QEVA 3QNJA 3AO4A 4RWTA 4Q0BA 5K14A 2YI8A 4H8SA 5CE3A 4CW7B 3QLHA 4CESA 5BPLA 3PX4A 2VWKA 4IDHA 3CQ8A 1RTIA 1KVBA 4JI8K 1JXEA 4IG3A 4O0IA 3VEWA 1GLCG 1X03A 3FZMA 2IVPA 3O3HA 3CAZA 4C8KA 1HNZK 1MU2A 4KIKA 3HO1A 1IBLK 3HK2A 3V9XA 4CCHA 4HCBA 2QWLA 4CJTA 3H08A 1Y97A 5C12A 4IZ9A 3S3OA 4B8AB 3FZHA 4NCBA 4FLYA 3BF1A 3KLFA 2HOEA 2F7OA 4AZHA 4DUYK 4FL9A 4CK1A 4BRHA 2ND0A 1KAZA 1VRUA 2YNFA 4U67L 4X64K 1U4BA 1FKPA 4IDKA 2WTUA 4PWDA 4B1ZA 5F0XA 4I9LA 1LWCA 1MDUB 1C6VA 2NRWA 1ZBIA 5C5BA 4CJ5A 2O8DA 1YHQN 4FZPA 3DDGA 1U48A 4YORA 3AY9A 2KLAA 3FFKB 4AILC 2C1GA 4HR1A 2AJQA 4CF1A 3TAPA 3OYHA 3VEBA 4WQ5C 3PIPL 3U4LA 1CXQA 3SZ2A 1I4LA 3OJSA 1LV5A 1BGXT 3SQ1A 3KDRA 4W5RA 3THYA 2JLEA 1A5WA 1B9FA 4YDUA 3NVMA 2F7QA 5EXWA 2BPRA 1TK0A 5LMNK 3UKRA 3RTVA 2Z1JA 3AVMA 1ZYQA 3QESA 1S9GA 1TYQB 3BVUA 1C1AA 4M3XA 1DKZA 4CJ7A 3RR8A 1EX4A 2UXBK 5FPDA 1GOAA 1EQYA 5JENA 1D9FA 2YLLA 5JVGL 3MAQA 1NJZA 2NRRA 1YAGA 2YKNA 4CEDA 1ATNA 2DFEA 1C0TA 5J2QA 3FGUA 3I8BA 4B08A 3OS2A 4FM3A 3G71N 4UDXX 3PO4A 1NGJA 1NGBA 3O4WA 2FBXA 2E2QA 3AO1A 3C94A 1E3MA 2W6LA 3G0ZA 2VYPA 4Y1DA 5CY4A 4FJ8A 3VERA 4DWIA 4EIAA 1NGEA 2HNYA 4H0TB 4BQLA 2RAKA 5C42A 4OKKA 2W6KA 4KHWA 4NCAA 2HHUA 3BVWA 3M5RA 4B8CA 1CKRA 4DR2K 3F5TA 1VSIA 1R33A 4EZNA 1X9SA 4AZBA 3BEXA 2GBZA 4B9LA 1NKEA 4DQSA 4B1WB 5GINA 3SMSA 3AVGA 4JWIA 4W5QA 4FM2A 3CXCM 3SNNA 3C6UA 1KD1O 2P9SA 2A41A 2O0I1 4Z4HA 1NK9A 3KZBA 1IG9A 5DM6L 1TGOA 4PHTX 1TKTA 3Q7CA 3M3WA 4JI2K 3ZT3A 4CVNE 4ZTFA 3ER8C 1VQPN 4E19A 5KPRA 3HL8A 3J8AA 2DPNA 3I04A 1RBTA 2OW6A 4O44A 5AZJB 2UXDK 4JWDA 4RW4A 5JLHA 1OVYA 5KTQA 3OYAA 1IBKK 4AF1A 3J80O 1CZBA 4BRGA 3ZETB 4ILGB 4JI0K 3MXMA 4KI4A 1WSJA 3U6FA 2HHSA 4XH4A 2WINM 4DMNA 4BDPA 1BOTO 2I7NA 4JD2B 3L3UA 4QS7A 4E1JA 3M8RA 1BPRA 3CCJN 2VQFK 4E81A 4XJXA 3OVNA 3AAPA 5JICA 3KD5E 1KVCA 5F2RA 4C8OA 2F8TA 3K9JA 1JLAA 3TPQA 3QEXA 3GI7A 2A40A 1TKZA 1Z05A 3CJ1A 1UWBA 4FZSA 1VSKA 1KFDA 1U6ZA 3CC4N 5GIPA 3ISNC 4BY9C 4LFAK 4CF2A 2WONA 1K9MO 5KRTA 2ND1A 3OHXM 4CI6A 5TKWA 4M41A 3LDOA 1YJ9N 3A0IX 3EKUA 3LPUA 1BCOA 3CYMA 4A57A 2P5GA 3UKUB 1CZ9A 4CF8A 5AQJA 4JK8A 3WQTA 3C6HA 2YHYA 4NSWA 4H0VB 3BDPA 4IOXA 2QA4N 3OYCA 4H5TA 3OYEA 1J9AA 2QWQA 4DTSA 2NRVA 1F21A 3KLIA 3OYBA 2QW9A 4ELVA 4AZGA 2HBLA 1R34A 1N36K 5AQNA 1NMDA 2DFFA 3CV5A 2Q0RA 3DYAA 2QKKA 3SLCA 5IT9O 1S1WA 1XC9A 2HBMA 1BIUA 4BE1A 4YNQA 3AA3A 3KD1E 4B1UB 4I9QA 3OYIA 3O9SA 3DX4A 4O4GA 4DV0K 3NH2A 3EY1A 3WXKA 2PMRA 3VEXA 4CHZA 4DLGA 4BR0A 3D2EB 1WSIA 1BI4A 1NGCA 3CC2N 1ZXOA 5EOYA 3WT0A 4JI7K 1TV6A 4GVMA 3KIOA 3A5NC 4NYFA 3S41A 3TAQA 2WYHA 1NGIA 4CIEA 3OA9A 4A62A 2ETJA 4FLVA 3EKSA 4RTFD 1ZYLA 2GV9A 3ATUA 4H4OA 1J5OA 2GELA 2FC0A 3ALYA 2X78A 3CIPA 4CHQA 1RILA 4JV5K 4J8FA 2D4WA 4MLEA 4KH4A 1WN7A 5I42A 1BQMA 2N3KA 3MXJA 4OPKA 2B4JA 4G1QA 4GNIA 1YVUA 5LY3A 3SQ2A 4J2AA 1NGGA 2RE2A 1RFQA 2F7PA 3BUIA 2ITMA 2E1ZA 2Q2RA 4WE1A 3KLEA 1JLCA 1WSGA 3VGMA 5HRRA 1PS3A 4FZYA 3QE6A 1HKBA 4H5VA 4JLCA 4IKFA 4KHQA 4JK7A 1YJWN 3I56N 3ZX3A 2HHQA 4BR5A 3AVKA 3PUFA 5C0YA 2XRIA 4JS5A 3CD6N 1YIJN 4ID1A 1LAWA 2OPRA 1VSEA 3ITHA 2IIRA 1VSLA 3SOGA 5AZJA 3SPYA 3ZSZA 2O8CB 3SBSA 3NH0A 1FK9A 4BE0A 4E7HA 1VQ8N 1HNWK 1UAXA 2QWMA 5EVZA 4DF8A 2HHWA 4ILGA 3HZ6A 1M90O 1QWUA 3PIOL 1S1UA 4B3RK 4DR4K 4LF4K 1HTYA 1GLJO 3L2RA 3DLEA 4JD2A 4C8LA 1I39A 3ZEUB 1QZ5A 5HBMA 4CZJA 5FRNA 3B8AX 2XO7A 4I6MB 2UXCK 4WFAL 2EFKA 4B1XB 3QEIA 3J7ZO 1BCMA 4JEPA 3THVA 3WQUA 2C1IA 1RDWX 4CFDA 2QI2A 5EU7A 4O55A 3VQDA 2UYTA 3NBPA 2HMPA 2HHHK 2ASMA 3WUHA 3O3OB 3HRGA 3OYJA 4CF0A 4MQ3A 3LP3A 1WLJA 3CERA 4FJKA 5DM7L 2D4CA 1WUAA 3VQQA 2YNHA 1N8RO 1BO5O 3UKUA 4DQIA 3D6RA 3N4QA 4J2BA 4Y0WA 5BPNA 2ZGYA 2KW4A 1I94K 3V1RA 1TUYA 2HBKA 5C25A 1ZBHA 3SMPA 4CZEA 3V4IA 4FK4A 2W41A 2YI9A 4JKBA 3ZSWA 3L3VA 3CPEA 4CZIA 5J2NA 3RMAA 2NZTA 4DS4A 3O3MB 3LDNA 4HUFA 3J7YP 4EZVA 5C15A 1MJGA 2YKMA 4AZ5A 3T49A 2OP6A 3RR7A 4JKDA 4RW6A 1NG9A 3N4PA 2G8UA 4L8RB 4YOYA 4Z94A 2P5OA 4EZXA 4JHDA 1RT5A 4KTWA 5FDLA 5AQXA 2ZE2A 4BC5A 2ITGA 4BG9A 3KK1A 4YOXA 4KIKB 2HW3A 2FSNA 4WF9L 1QSLA 3HPOA 5BREA 3PSIA 5M1PA 2AA4A 4B3SK 2IDOA 2PFUA 4FVMA 1U2VA 4QS8A 4FLWA 3ERCC 5M1NA 4IWPA 3T46A 4G9ZA 3NF6A 4L3QA 4FOEA 3J7AP 1KFSA 4YOVA 4FWQA 4CZLA 1NK5A 2XY6A 3LVTA 1NJWA 2O4GA 4WPEA 3LLLA 4EZZA 4DSKA 3ZX0A 5JS2A 4OPHA 4K41A 4EZ9A 3GE1A 5C5BB 1EETA 3NCIA 2Y1IA 1TQWA 5CR4A 4X62K 2OZMA 1ZC6A 2OZSA 2YNIA 1Y64A 1R5EA 5AQQA 2XHBA 1VQNN 1EWQA 4DR5K 2GAFD 3IDHA 3HVTA 3BZKA 1NU0A 4HUEA 2G8WA 4AM7A 3CJCA 1VSMA 1YT3A 3U9DA 4CGFA 4NXMK 3ENHA 4JYAK 1LW2A 4BC4A 2OBLA 1KXPA 1HMVA 3E9LA 3CC7N 1T6CA 4OGEA 2VQEK 2KTQA 1RDUA 3IS9A 3L2VA 4IFYA 1MA9B 2FSKA 3G9GA 1SQKA 5CZ2A 1WBBA 4CEBA 5GADP 4H0OA 3G10A 1HKGA 3NGIA 4R5KA 1X9MA 2KQ2A 4E7LA 4LF9K 3CPWM 4AHTA 3O4NA 3ZYYX 3TAEA 1Z26A 4KTZA 4DV6K 2KZZA 4LSNA 4BNEA 3ZT4A 3H3OB 4MO5A 1GLEG 4OPAA 4M7XA 2V0OA 3ZEUA 4C23A 4DQRA 1TQVA 2ZJQL 3VA3A 3UB5A 4R5PA 1QE1A 3VEAA 1T6DA 1OH7A 4FZXC 4H6IA 4DCNC 3EJUA 4O5BA 4E1MA 2ASOA 3BZCA 4CGGA 4C8MA 4K42A 3RMCA 4DTMA 2X3XA 1RBSA 3DX2A 3FLCO 1A5VA 3ZSXA 3LWMA 2ZXQA 3V6DA 1S3XA 3GBTA 1QWNA 3RV0A 4H0XB 2E2PA 1SKRA 1NJYA 5F1XA 4H5NA 4F3OA 1OKJA 2KHOA 1K73O 4BECA 1ITGA 4O8KA 4QOZB 1HYSA 3I39X 5E84A 3TI0A 4JKHA 3WNGA 1YF5L 3DX1A 3KLHA 4PO2A 2YCHA 1NBWA 4CIGA 3G4SN 1FKOA 2OPSA 4JNFA 4RW8A 2Q1NA 1C0FA 5FROA 3ZSOA 3MN5A 2OPPA 1TL1A 3FE1A 3KWIA 4YHHK 4RW9A 3THWA 4AKVA 3CQXA 1OVQA 1JCFA 3NH1A 3LM9A 3ZEFA 3G25A 3MMVA 3ENOA 4BVOA 2RAIA 3DLKA 3DLLL 2CGLA 2LXYA 3O9QA 5BPMA 3TAFA 2W40A 3IAYA 3KKSA 1UOCA 1SZ2A 2H3GX 4EZSA 3SYZA 3L2UA 3V1OA 3ZSVA 4W5OA 1BDGA 2BTFA 2F9WA 5AQVA 1NGDA 3W0LA 4YDUC 4EZ6A 2P9PB 1FXXA 5LMUK 3RWUA 1QVFM 4RCHA 2IOCA 3S5TA 4IO8A 1P8ZA 2X3VA 3B53X 3RVCA 4AM6A 1JQKA 4DTPA 1VSDA 3CMEN 4CZFA 1VQ5N 5KGXA 5BR9A 3HM9A 1HXKA 4M45A 4DFKA 3CQYA 3ZSQA 3K59A 3U3GA 1LOTB 3OYNA 1HRHA 4DSIA 4IW0A 4B3TK 4M3WA 1QTMA 4R5JA 4BC2A 4YOWA 3BP8A 5EY4A 2F8SA 3HAHA 4N47A 4B9SA 1RDBA 1CXUA 4GV9A 3B6PA 4CJ3A 4CGDA 4FSVA 1VQLN 3VN5A 1DTQA 3LP2A 1RT6A 5M1QA 3H1QA 3LL3A 4CGJA 5AQSA 4E3CA 3B6OA 3K9KA 2UUBK 4DSFA 5LJVA 2ZD1A 4LH5A 3VA0A 3L8BA 3L0QA 2IC3A 4IJNA 3QWEA 2OO2A 2Z0VA 3DJCA 2YL5A 2X6NA 4UDYX 3SBGA 3TTFA 2Z0NA 5KBPA 4WQ4A 1L3SA 1BI4B 3I8DA 2Q3SA 5T7BA 3BUZB 3MX2A 4M63C 4CZKA 1FW6A 1NKBA 4FCYA 3VEYA 3DDFA 3M8SA 4GY2B 2GWJA 4PL8A 1BU6O 4LF6K 4PQUA 3PX0A 1I49A 3KWGA 3D50A 1U04A 1Q9XA 1ASUA 2ASPA 4BR7A 4CHYA 3GL1A 4DB3A 3AVNA 1D5AA 1S5JA 4CHNA 3EYZA 4JWEA 3DLBA 3SV3A 3EEQA 4H4MA 3CCUN 2RN2A 2E88A 4DCHA 3EJSA 5KI6A 1NKCA 4DG1A 4KHPK 4DHYA 1EO1A 3V1QA 1WBDA 4EZTA 3QNIA 5JS1A 4GMJB 5ELZA 3O4QA 3CCQN 1R0AA 3HOSA 4O5FA 1IBMK 2Y1JA 3I0RA 1HPZA 4CFAA 1YTAA 4OJRA 3TANA 4CJVA 5CHIA 1NWKA 2F7RA 2ELBA 2YV0X 2QXLA 3ABHA 5AQIA 2VGMA 2HHIA 4WYBA 4W5TA 4LH4A 1HQEA 4NXNK 2E8AA 1VQ6N 1I4DA 2Q13A 3BUBA 4EZQA 3LDLA 1RT3A 2VWBA 3A5MC 1EP4A 3DLRA 4FK0A 2P9KB 2HHVA 3BUQA 1OA1A 4F00A 3NMUA 3OS1A
chains in the Genus database with same CATH topology
2ITMA 2E1ZA 4WV5A 2Q2RA 1E4GT 4H03B 5EX5A 3VGMA 3KHYA 1SU8A 3G6EN 1HKBA 3IUCA 2JWLA 4H5VA 4BR9A 4BEBA 4JLCA 3IMXA 4HWIA 3WXJA 2IVNA 3KVGA 3P4IA 4JK7A 1YJWN 1ATRA 4XH1A 4BRIA 3I56N 2VGNA 3ZX3A 3DPQA 3TSQA 4BR5A 1HX1A 2QWNA 4BRNA 3SBTB 5C0YA 3L4IA 1YITN 2QEXN 4R79A 4FO0A 3CD6N 4BR4A 2X5CA 4PL7A 1YIJN 4HR1B 3C7NB 4BROA 4WQ4C 2IIRA 5GIOA 4A59A 4IO9L 1GN9A 3CCMN 5AZJA 3OBWA 3UITA 2A3ZA 4CBWA 3WEEA 2P9PA 5FIGA 1VQ7N 3VTHA 3P38A 3SBSA 1BA0A 2D0PA 4WCEL 1VQ8N 5M1OA 1QVGM 2QWMA 5EVZA 1DKYA 3T48A 2F7TA 4ILGA 1IG8A 3HZ6A 3HBTA 5BN9A 3AGKA 4HYBA 3ENBA 3MCAB 3PIOL 1M90O 3VEVA 3ER9B 1QHAA 1BUPA 1GLJO 3QDKA 2YI1A 3SAFA 3I33A 3SBTA 3UKRB 1QQMA 5FLEX 3CJ7A 4JD2A 3U8XA 2GTDA 1UPXA 3CI5A 2WC9A 3OW2M 3C7NA 5E26A 3ZEUB 1QZ5A 1ESVA 3MN9A 4CZJA 4UY8O 3I55N 3B8AX 4OO1J 4I6MB 1YUWA 2AP1A 5C10A 4EZRA 5AZIA 4B1XB 1NM1A 4WFAL 1J6ZA 3P39A 3J7ZO 1YI2N 4ISFA 4JEPA 3WQUA 3RSEA 4IOAL 2C1IA 4IWQA 1JCGA 1RDWX 1LCUA 4B1YB 2QI2A 3E9OA 2A42A 3A98A 3JS6A 3LMFA 2GX9A 4GVEA 2QTDA 3Q7BA 4WFNL 1OAOA 4IOCL 3NVKA 1Q86O 2OBMA 3TTCA 1W2BM 3DAWA 3T4AG 2UYTA 1E4FT 4JAXA 3VTIA 2HMPA 7HSCA 3VF4A 2ASMA 1MWMA 3O3OB 3HRGA 3WUHA 2NRZA 5FPNA 2PY6A 3VKHA 4KH6A 3QA8A 3CERA 1QZ6A 1P90A 4IM2A 1E9VA 1DEJA 4H5WA 1WUAA 5LJWA 5DM7L 4I6MA 1SU7A 2OTLN 1N8RO 3B51X 1CZAN 1BO5O 3UKUA 2IVOA 4WV7A 3D6RA 3N4QA 4Y0WA 3F7WA 5BPNA 2ZGYA 3C0BA 1GLDG 3D7EO 4F01A 3OWGA 2Q0UA 4PKGA 1V4TA 4JHDB 1TUYA 2HBKA 3MDQA 3DXMB 3E1YA 1NGFA 1VAZA 2W41A 3SMPA 4CZEA 2VCPA 2YI9A 3MN7A 3OHRA 1S72N 4JKBA 3R3LA 4O8UA 3QFUA 4PKIA 5MLCQ 4BRKA 4CZIA 3CPEA 3DXKB 3IFRA 4WQ5A 1VQKN 1Z6RA 2NZTA 4BGBA 4GV6A 3TSPA 1X9JA 3WXIA 3O3MB 3L6QA 3LDNA 4FOIA 2V51B 3O1WA 4EZVA 5C15A 4A2BA 1MJGA 4JL9A 2CGKA 4IM0A 3CJ9A 3CCSN 2NNWA 4IJAA 3T49A 5M1KA 1U2VB 2Z8YA 3TTDA 2OP6A 5BRHA 4JKDA 3H6EA 1SU6A 2Q97A 4A5BA 4KH5A 4BRQA 4CD3A 4MQDA 3VGLA 1HJOA 1XUPO 3N4PA 2KKZA 3DPPA 4NB4A 4YOYA 1BWFO 4NPHA 4Z94A 5AQOA 4EZXA 2HBJA 4JHDA 5AQXA 3VGKA 2P9SB 4BC5A 4BREA 1D4XA 1Q81O 4BG9A 2QM1A 3SK3A 5B8HA 3O5BA 3EZWA 4YOXA 2ZGZA 4KIKB 1QQNA 2FSNA 4WF9L 1T3VA 1BA1A 3M1FA 4IFEA 5BREA 3R9PA 5M1PA 3CF5L 1GLBG 2P9LB 2AA4A 3ZEDA 2RT6A 2CH5A 3ATVA 2PFUA 3AGRA 5HOOA 3QNJA 1ILYA 3I01A 3M6GA 4RWTA 3H3NO 1U2VA 3T69A 4EZUA 3O8MA 2YI8A 3O6WA 4QS8A 5AFUH 3ERCC 5CE3A 1RGIA 5M1NA 4IWPA 4BRCA 5BPLA 3T46A 4IEEA 4IDHA 1XC3A 4NO7A 4G9ZA 4MDAA 1M1KO 4XH5A 4FWOA 4L3QA 4FOEA 1V4SA 1DKGD 3F2KA 1GLAG 2J4RA 3VEWA 1HKCA 4YOVA 1GLCG 4FWQA 3ULEB 4BRMA 3FZMA 2IVPA 4CZLA 2ZJRL 3VF6A 5HL7L 3GG4A 1KQSM 2NLXA 4KIKA 3LDPA 1E2UA 1C0GA 4EZZA 3IKMA 3ZX0A 3TU5A 3EE8A 4OPHA 4K41A 5AQHA 3U9ZA 3GE1A 3VMFB 1NGHA 2QWLA 3GDQA 5C12A 1SAZA 5CR4A 1ZC6A 2E1YA 4IZ9A 5AQFA 3FZHA 1ZBSA 1Y64A 4R5GA 2HOEA 3BF1A 3F9MA 3O80A 3QBXA 1HPMA 5AQQA 1VQNN 2NRXA 3HM8A 1DKXA 3WXLA 4IM3A 4FL9A 4JKGA 2GAFD 2P9NB 2NRTA 3QFPA 2ND0A 1KAZA 1NLVA 3IDHA 4BRHA 2P9KA 4U67L 4PKHA 2WUSA 4B1ZA 4XEIA 5F0XA 1S22A 3LM2A 3R8EA 3ULEA 1KC8O 4AM7A 3CJCA 5AQKA 1MDUB 3U9DA 2NRWA 1VQON 2FLOA 4BRPA 3O3NB 4CD1A 4ISEA 3CCVN 1Q18A 4BVPA 3O9TA 5AQLA 3QBWA 1O13A 3ENHA 1YHQN 4BC4A 1YJNN 2OBLA 1KXPA 2ZWHA 4YORA 2P9UB 3VENA 5GAHP 2EX3B 3E9LA 4BRLA 2QFFA 2KLAA 4H6HA 3AY9A 3FFKB 3H46O 3KK7A 2EWFA 4HR1A 4HTLA 3CC7N 1T6CA 2Q31A 1GNTA 1RDUA 2E2NA 1K8AO 4GV3A 3DOBA 5AQRA 1MA9B 1GNLA 2FSKA 1SQKA 3ZX2A 3O1BA 4DQ8A 1U00A 3JXUA 3VEBA 4WQ5C 4MLHA 5GADP 3PIPL 4H0OA 3U4LA 2V7ZA 5AQGA 1HKGA 4R5KA 3KDRA 2FF3B 4FWMA 1NGAA 3CPWM 3H0XA 4YDUA 3NVMA 3OBYA 3ZYYX 3QMLA 5EXWA 2BPRA 3UKRA 2GEMA 4H0PA 1JJ2M 2YIBA 3H3OB 4MO5A 2GA9D 1GLEG 1TYQB 4M7XA 4OPAA 3MWTA 3ZEUA 4C23A 3WXMB 3FZLA 3L3OM 1W9MA 2ZJQL 5AQUA 1DKZA 4CJ7A 5AFUA 3A8YA 5FPDA 3DPOA 3UB5A 4F9OA 1EQYA 3MK6A 2A6AA 3VEAA 4FWPA 3M3ZA 5JVGL 1T6DA 4H6IA 4BR2A 5H1SQ 2WFBA 3EE9A 2NRRA 2ASOA 3N8EA 2BUPA 1YAGA 1ATNA 4K42A 2WBNA 1E1DA 3FGUA 3SAHA 3DQGA 4EHTA 3HOTA 3I8BA 3FLCO 1VQMN 4FM3A 4EAHD 4UDXX 3G71N 3C65A 1TYQA 1NGJA 4NLCA 4EZOA 1HLUA 1NGBA 2PBDA 1BG3A 3O4WA 2E2QA 1S3XA 3GBTA 5ADXH 2V7YA 4BQZA 5JMVA 2VYPA 3RV0A 4H0XB 2E2PA 3VERA 3VETA 3TSUA 4EIAA 1NGEA 4H0TB 4BQLA 4H5NA 3VPZA 5F1XA 3CCEN 1OKJA 2KHOA 3DXMA 3O9UA 1K73O 4BECA 4BE7B 4O8KA 2CH6A 3CJBA 2D1KA 4FWKA 4JKCA 4BRDA 4K43A 3I39X 5E84A 3DXKA 1W97L 5AQPA 3FZKA 4JKHA 2CGJA 3M5RA 1YF5L 4MDBA 1KAYA 3FR0A 3KAVA 3L4QA 4FPBA 4EFHA 4PO2A 1CKRA 2YCHA 3O08A 1NBWA 3FZFA 3G4SN 4JNFA 2OANA 1JCEA 3F5TA 4JKFA 3T47A 2Q1NA 1C0FA 5FPMA 5M1FA 2P9IB 4EZNA 4A5AA 3MN5A 3BEXA 4FVUA 3E66A 4B1WB 5GINA 3SMSA 3FE1A 4JWIA 3KWIA 5GAGP 3CXCM 4I43A 2F9TA 1KD1O 3CQXA 1DG4A 1GLLO 2P9SA 2D0OA 4EZWA 1JCFA 2A41A 4ILJA 2QWRA 3CETA 3LM9A 5AQWA 3ZEFA 3DWLA 3G25A 3MMVA 3ENOA 4BVOA 3DLLL 2CGLA 4CBXA 2P9LA 1SUFA 3O9QA 2YHWA 3KZBA 5BPMA 5DM6L 2W40A 4JNEA 4A61A 4PHTX 3Q7CA 1G99A 3ER8C 1VQPN 1SZ2A 2H3GX 2P9IA 4FWRA 5KPRA 4DKWA 4EZSA 1H1VA 2GUPA 2DPNA 3J8AA 3I04A 1WOQA 1BDGA 4FWLA 4FPAA 5AZJB 4JWDA 2BTFA 2F9WA 1NGDA 5AQVA 1OVYA 4YDUC 4JWCA 3W0LA 3E9PA 5JLHA 5KQ8A 4AF1A 3HI0A 3WEEB 2P9PB 4U7BA 4ILHB 4EHUA 2YIAA 5AQMA 1QVFM 4BRGA 4RCHA 3ZETB 4JKEA 4CZHA 2HF3A 2E2OA 4ILGB 2GWKA 4IO8A 1P8ZA 3B53X 3FD9A 5AQZA 3RVCA 4AM6A 4XH4A 2WINM 1JQKA 3EN9A 1BOTO 3CMEN 4CZFA 1VQ5N 3AAQA 5AQYA 2I7NA 4JD2B 5FPEA 4FWSA 5JLFA 1NJIO 4QS7A 4E1JA 3T7ZA 5BR9A 1BPRA 3CCJN 4E81A 4ISGA 4XJXA 3CQYA 5C2DA 3AAPA 1LOTB 3D2FB 3VESA 5AZIB 3R6MA 2P9NA 5JICA 4BRFA 4IW0A 5F2RA 3B52X 5I9EB 3KAWA 4CBUA 3K9JA 3RSEB 4EZYA 2FXUA 3TPQA 4ILHA 4R5JA 4BC2A 5ADXA 4IWVA 3GI7A 4YOWA 2A40A 3BP8A 1Z05A 1T44A 3CJ1A 3EL2A 5EY4A 3ZETA 2Q36A 1XQSC 2HF4A 4GV9A 1U6ZA 4HY9A 4YOUA 5GIPA 4FSVA 3CC4N 2JNSA 3GOIA 1VQLN 4BY9C 4D8JA 4CZGA 1K9MO 5M1QA 3H1QA 4MO4A 1Q82O 2ND1A 3OHXM 2A5XA 3LL3A 3P31A 5TKWA 3LDQA 3LDOA 3A5OC 4CI6A 5BN8A 1YJ9N 1Q7YO 5AQSA 1VQ9N 2P9UA 3A0IX 3EKUA 5AQTA 3A5LC 4E3CA 4C1NK 4YOTA 1YVNA 5KPTA 4R5LA 3K9KA 3D2FA 5LJVA 3SJHA 4A57A 3UKUB 5TKYA 5AQJA 4JK8A 3L0QA 3WQTA 3CJAA 3C6HA 2YHYA 3MN6A 4H0VB 4IJNA 4IOXA 4M7YA 2QA4N 2YJEA 4H5TA 1ATSA 3DJCA 3MX5A 3VF2A 2QWQA 1DGKN 3O9RA 4UDYX 2ZF5O 2NRVA 3SBGA 1Q5LA 3TTFA 4WQ4A 3HSCA 4H5RA 2QW9A 2HSTA 3CCRN 1K8KB 2YHXA 4WFBL 2HBLA 1KAXA 2V52B 3BUZB 3MX2A 4M63C 4CZKA 1X3MA 5AQNA 1NMDA 4H0YB 2Q0RA 3PLAA 1OA0A 5GAEP 3VEYA 3SLCA 5KQDA 4R5IA 4IEIA 2NCZA 3UE5A 4GY2B 2GWJA 2HBMA 4IWOA 2QWPA 3W3DA 2YX6A 3ID8A 4PL8A 3QICA 1BU6O 4B1UB 5AR0A 2E20A 3O9SA 1X3NA 2YJFA 3WXKA 3VEXA 3ID6A 4BR0A 2LM0A 3D2EB 3KWGA 1YXQA 3H45C 2BH1A 4QS9A 1NGCA 1R59O 2ASPA 2FSJA 1K8KA 1ZXOA 5EOYA 4BR7A 3CC2N 3GL1A 4DB3A 4B1VA 2OTJN 2JWKA 3CHWA 2NRHA 3WT0A 4A2AA 4JWEA 5C2FA 3CCLN 3A5NC 3C6AA 3S41A 3AARA 3SAGA 4JN4A 4CZMA 4EZPA 3CCUN 2E88A 1NGIA 4DCHA 3VEOA 4G6QA 4BGAA 3OA9A 4A62A 1IJJA 2EWSA 1MWKA 3EKSA 2C1GA 4DHYA 1EO1A 4LC9B 4B9QA 3BF3A 1GLFO 3R1XA 4RTFD 4EZTA 4BG8A 2RHKA 4NLBA 4K25A 1ZYLA 1HUXA 4JK9A 5ELZA 2I7PA 3ATUA 3VEZA 3CCQN 2GELA 3HOSA 2QWOA 4O5FA 3D2EA 3MWPA 3CIPA 4FWNA 4J8FA 2D4WA 4BRAA 5CHIA 3EO3A 4MLEA 4KH4A 1NWKA 2QXLA 5AQIA 2PAVA 2N3KA 3H1VX 2VGMA 3QB0A 4JKAA 3MCPA 4WYBA 4C1NI 2W00A 4M0MA 3RV1A 1QQOA 4IXCA 2E8AA 1VQ6N 1SS6A 4GNIA 3VOVA 5BRFA 3CMAN 5KPZA 2ZJPL 4EZQA 1TUUA 3LDLA 2YIVX 5LY3A 5BRDA 4JKGB 1NGGA 4ILIA 2VWBA 3A5MC 2P9KB 2RE2A 4BC3A 1RFQA 3HTVA 2FF6A 1OA1A 4F00A 1DT9A 5JVHL 1VQ4N 4KBOA 3NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITM A;  2E1Z A;  4WV5 A;  2Q2R A;  1E4G T;  4H03 B;  5EX5 A;  3VGM A;  3KHY A;  1HKB A;  3IUC A;  4H5V A;  4BR9 A;  4HWI A;  3IMX A;  3WXJ A;  2IVN A;  3KVG A;  3P4I A;  1ATR A;  4XH1 A;  4BRI A;  3ZX3 A;  3DPQ A;  4BR5 A;  1HX1 A;  2QWN A;  4BRN A;  3L4I A;  4FO0 A;  4BR4 A;  4PL7 A;  3C7N B;  4BRO A;  4WQ4 C;  2IIR A;  5AZJ A;  2A3Z A;  4CBW A;  3WEE A;  2P9P A;  1BA0 A;  2D0P A;  2QWM A;  5EVZ A;  1DKY A;  3T48 A;  1IG8 A;  3HZ6 A;  5BN9 A;  3HBT A;  4HYB A;  3VEV A;  1QHA A;  1BUP A;  1GLJ O;  3QDK A;  2YI1 A;  3I33 A;  3UKR B;  1QQM A;  3CJ7 A;  4JD2 A;  3U8X A;  2GTD A;  3CI5 A;  3C7N A;  5E26 A;  3ZEU B;  1QZ5 A;  1ESV A;  3MN9 A;  4CZJ A;  3B8A X;  4I6M B;  1YUW A;  2AP1 A;  4EZR A;  5AZI A;  4B1X B;  1NM1 A;  1J6Z A;  4ISF A;  3WQU A;  3RSE A;  1RDW X;  1JCG A;  1LCU A;  4B1Y B;  2A42 A;  3JS6 A;  3DAW A;  3T4A G;  2UYT A;  1E4F T;  4JAX A;  2HMP A;  7HSC A;  3VF4 A;  2ASM A;  1MWM A;  3WUH A;  5FPN A;  3CER A;  1QZ6 A;  1DEJ A;  4H5W A;  1WUA A;  5LJW A;  4I6M A;  1CZA N;  1BO5 O;  3UKU A;  2IVO A;  4WV7 A;  4Y0W A;  5BPN A;  2ZGY A;  3C0B A;  1GLD G;  3D7E O;  4F01 A;  2Q0U A;  4PKG A;  1V4T A;  4JHD B;  1TUY A;  3MDQ A;  3DXM B;  3SMP A;  1NGF A;  2W41 A;  4CZE A;  2VCP A;  3MN7 A;  3OHR A;  4PKI A;  3QFU A;  4BRK A;  4CZI A;  3DXK B;  3IFR A;  4WQ5 A;  1Z6R A;  2NZT A;  4BGB A;  1X9J A;  3WXI A;  3L6Q A;  3LDN A;  4FOI A;  2V51 B;  3O1W A;  4EZV A;  4A2B A;  2CGK A;  3CJ9 A;  4IJA A;  3T49 A;  1U2V B;  2OP6 A;  5BRH A;  3H6E A;  2Q97 A;  4BRQ A;  4CD3 A;  3VGL A;  1HJO A;  1XUP O;  3DPP A;  4NB4 A;  1BWF O;  4Z94 A;  5AQO A;  4EZX A;  4JHD A;  5AQX A;  3VGK A;  2P9S B;  4BC5 A;  4BRE A;  1D4X A;  4BG9 A;  2QM1 A;  3SK3 A;  5B8H A;  3O5B A;  3EZW A;  2ZGZ A;  1QQN A;  2FSN A;  5BRE A;  1BA1 A;  3M1F A;  3R9P A;  1GLB G;  2P9L B;  2AA4 A;  3ATV A;  2CH5 A;  3QNJ A;  3M6G A;  4RWT A;  3H3N O;  1U2V A;  4EZU A;  3O8M A;  5AFU H;  3O6W A;  4QS8 A;  5CE3 A;  1RGI A;  4BRC A;  5BPL A;  3T46 A;  1XC3 A;  4NO7 A;  4XH5 A;  4FWO A;  4L3Q A;  4FOE A;  1V4S A;  1DKG D;  1GLA G;  2J4R A;  3VEW A;  1HKC A;  1GLC G;  4FWQ A;  3ULE B;  4BRM A;  3FZM A;  2IVP A;  4CZL A;  3VF6 A;  3GG4 A;  2NLX A;  3LDP A;  1C0G A;  4EZZ A;  3ZX0 A;  3TU5 A;  5AQH A;  3U9Z A;  4K41 A;  3GE1 A;  1NGH A;  2QWL A;  3GDQ A;  1SAZ A;  1ZC6 A;  2E1Y A;  4IZ9 A;  5AQF A;  3FZH A;  1ZBS A;  1Y64 A;  4R5G A;  2HOE A;  3BF1 A;  3F9M A;  3O80 A;  3QBX A;  1HPM A;  5AQQ A;  3HM8 A;  1DKX A;  3WXL A;  4FL9 A;  2P9N B;  3QFP A;  1NLV A;  1KAZ A;  3IDH A;  4BRH A;  2P9K A;  4PKH A;  2WUS A;  4B1Z A;  4XEI A;  5F0X A;  1S22 A;  3LM2 A;  3R8E A;  3ULE A;  4AM7 A;  3CJC A;  5AQK A;  1MDU B;  3U9D A;  2FLO A;  4BRP A;  4CD1 A;  4ISE A;  1Q18 A;  4BVP A;  5AQL A;  3QBW A;  3ENH A;  4BC4 A;  2ZWH A;  1KXP A;  2P9U B;  3VEN A;  4BRL A;  2QFF A;  3AY9 A;  4H6H A;  3FFK B;  3H46 O;  4HTL A;  4ISG A;  1T6C A;  2Q31 A;  2E2N A;  3DOB A;  5AQR A;  1MA9 B;  2FSK A;  1SQK A;  3ZX2 A;  3O1B A;  4DQ8 A;  1U00 A;  3JXU A;  4WQ5 C;  4MLH A;  4H0O A;  3U4L A;  2V7Z A;  5AQG A;  1HKG A;  4R5K A;  2FF3 B;  4FWM A;  1NGA A;  3H0X A;  4YDU A;  3QML A;  5EXW A;  2BPR A;  3UKR A;  2GEM A;  4H0P A;  3H3O B;  4MO5 A;  1GLE G;  1TYQ B;  4M7X A;  3ZEU A;  4C23 A;  3FZL A;  3L3O M;  5AQU A;  1DKZ A;  4CJ7 A;  5AFU A;  3A8Y A;  5FPD A;  3DPO A;  3UB5 A;  4F9O A;  1EQY A;  3MK6 A;  2A6A A;  4FWP A;  3M3Z A;  1T6D A;  4H6I A;  4BR2 A;  2ASO A;  3N8E A;  2BUP A;  1YAG A;  1ATN A;  4K42 A;  3FGU A;  3DQG A;  4EHT A;  3I8B A;  3FLC O;  4EAH D;  1TYQ A;  1NGJ A;  4EZO A;  1HLU A;  1NGB A;  2PBD A;  1BG3 A;  3O4W A;  2E2Q A;  1S3X A;  3GBT A;  5ADX H;  2V7Y A;  4BQZ A;  5JMV A;  2VYP A;  4H0X B;  2E2P A;  3VER A;  3VET A;  4EIA A;  1NGE A;  4H0T B;  4BQL A;  4H5N A;  3VPZ A;  5F1X A;  1OKJ A;  2KHO A;  3DXM A;  4O8K A;  2CH6 A;  3CJB A;  2D1K A;  4FWK A;  4BRD A;  4K43 A;  5E84 A;  3DXK A;  5AQP A;  3FZK A;  2CGJ A;  1KAY A;  3FR0 A;  4FPB A;  4EFH A;  4PO2 A;  1CKR A;  2YCH A;  3O08 A;  1NBW A;  3FZF A;  4JNF A;  2OAN A;  1JCE A;  3T47 A;  2Q1N A;  1C0F A;  5FPM A;  2P9I B;  4EZN A;  3MN5 A;  3BEX A;  4B1W B;  3SMS A;  3FE1 A;  4JWI A;  2F9T A;  3CQX A;  1DG4 A;  1GLL O;  2P9S A;  2D0O A;  4EZW A;  1JCF A;  2A41 A;  2QWR A;  3CET A;  3LM9 A;  5AQW A;  3MMV A;  3DWL A;  3G25 A;  3ENO A;  4BVO A;  2CGL A;  4CBX A;  2P9L A;  2YHW A;  3KZB A;  5BPM A;  2W40 A;  4JNE A;  4A61 A;  1G99 A;  1SZ2 A;  2H3G X;  2P9I A;  4FWR A;  5KPR A;  4EZS A;  1H1V A;  2GUP A;  2DPN A;  3J8A A;  1WOQ A;  1BDG A;  4FWL A;  4FPA A;  5AZJ B;  4JWD A;  2BTF A;  2F9W A;  1NGD A;  5AQV A;  3W0L A;  4YDU C;  4JWC A;  5JLH A;  5KQ8 A;  3HI0 A;  3WEE B;  2P9P B;  4EHU A;  5AQM A;  4BRG A;  4RCH A;  3ZET B;  4CZH A;  2HF3 A;  2E2O A;  2GWK A;  4IO8 A;  1P8Z A;  5AQZ A;  4AM6 A;  4XH4 A;  2WIN M;  3EN9 A;  1BOT O;  4CZF A;  3AAQ A;  5AQY A;  2I7N A;  4JD2 B;  5FPE A;  4FWS A;  5JLF A;  4QS7 A;  4E1J A;  5BR9 A;  1BPR A;  4E81 A;  3CQY A;  3AAP A;  1LOT B;  3D2F B;  3VES A;  5AZI B;  3R6M A;  2P9N A;  5JIC A;  4BRF A;  5F2R A;  5I9E B;  4CBU A;  3RSE B;  4EZY A;  2FXU A;  3TPQ A;  4R5J A;  4BC2 A;  5ADX A;  4IWV A;  2A40 A;  3BP8 A;  1Z05 A;  1T44 A;  3CJ1 A;  3EL2 A;  5EY4 A;  3ZET A;  2Q36 A;  1XQS C;  2HF4 A;  1U6Z A;  4HY9 A;  4FSV A;  3GOI A;  4CZG A;  3H1Q A;  4MO4 A;  3OHX M;  2A5X A;  3LL3 A;  4CI6 A;  3LDQ A;  3LDO A;  3A5O C;  5BN8 A;  5AQS A;  2P9U A;  3A0I X;  3EKU A;  5AQT A;  3A5L C;  1YVN A;  5KPT A;  4R5L A;  3D2F A;  5LJV A;  3SJH A;  3UKU B;  5TKY A;  5AQJ A;  3L0Q A;  3WQT A;  3CJA A;  2YHY A;  3MN6 A;  4H0V B;  4IJN A;  4M7Y A;  2YJE A;  4H5T A;  1ATS A;  3DJC A;  3VF2 A;  2QWQ A;  1DGK N;  2ZF5 O;  1Q5L A;  4WQ4 A;  3HSC A;  4H5R A;  2QW9 A;  1K8K B;  2YHX A;  1KAX A;  2V52 B;  3BUZ B;  4M63 C;  4CZK A;  1X3M A;  5AQN A;  1NMD A;  4H0Y B;  2Q0R A;  3VEY A;  3SLC A;  5KQD A;  4R5I A;  3UE5 A;  4GY2 B;  2GWJ A;  3W3D A;  2QWP A;  3ID8 A;  4PL8 A;  3QIC A;  1BU6 O;  4B1U B;  5AR0 A;  2E20 A;  1X3N A;  2YJF A;  3WXK A;  3VEX A;  4BR0 A;  3D2E B;  1YXQ A;  3H45 C;  4QS9 A;  1NGC A;  1R59 O;  2ASP A;  2FSJ A;  1K8K A;  1ZXO A;  5EOY A;  4BR7 A;  3GL1 A;  4DB3 A;  4B1V A;  3CHW A;  2NRH A;  3WT0 A;  4A2A A;  4JWE A;  3A5N C;  3S41 A;  3AAR A;  4JN4 A;  4CZM A;  4EZP A;  2E88 A;  1NGI A;  4DCH A;  3VEO A;  4BGA A;  4A62 A;  1IJJ A;  2EWS A;  1MWK A;  3EKS A;  4DHY A;  4LC9 B;  4B9Q A;  3BF3 A;  1GLF O;  4BG8 A;  4RTF D;  4EZT A;  4K25 A;  1HUX A;  5ELZ A;  2I7P A;  3ATU A;  3VEZ A;  2GEL A;  2QWO A;  4O5F A;  3D2E A;  3CIP A;  4FWN A;  4J8F A;  2D4W A;  4BRA A;  3EO3 A;  4MLE A;  1NWK A;  2QXL A;  5AQI A;  2PAV A;  3H1V X;  3QB0 A;  3MCP A;  4WYB A;  1QQO A;  4IXC A;  2E8A A;  4GNI A;  3VOV A;  5BRF A;  5KPZ A;  4EZQ A;  1TUU A;  3LDL A;  5LY3 A;  5BRD A;  1NGG A;  2VWB A;  3A5M C;  2P9K B;  4BC3 A;  1RFQ A;  3HTV A;  2FF6 A;  4F00 A;  4KBO A; 
#chains in the Genus database with same CATH topology
 5EX5 A;  4WV5 A;  1E4G T;  4H03 B;  3T19 A;  3KHY A;  2YNG A;  1C1B A;  3HPG A;  4Z4E A;  2GF4 A;  2JWL A;  3KVG A;  4EP4 A;  4DFP A;  2OYQ A;  4BRI A;  2PY5 A;  3S3M A;  4JI3 K;  3TSQ A;  1K6Y A;  3K5L A;  3LWL A;  4E7J A;  3L4I A;  4R79 A;  4FO0 A;  2X5C A;  1SKW A;  4OKJ A;  4BRO A;  2GUI A;  3OK8 A;  2HHX A;  3LP1 A;  3OBW A;  4CBW A;  1GOB A;  2P9P A;  1VQ7 N;  2D0P A;  4WCE L;  4N5S A;  5M1O A;  3ZSY A;  1RBU A;  3T48 A;  2F7T A;  1IG8 A;  4CJP A;  2E6M A;  3TAB A;  3DLG A;  1QQM A;  5FLE X;  3U8X A;  4LF8 K;  1UPX A;  3CI5 A;  3OW2 M;  4UY8 O;  3MN9 A;  1B92 A;  4OO1 J;  5C10 A;  2Q12 A;  2WYI A;  4EZR A;  4HVJ A;  4FK2 A;  3K5M A;  1YI2 N;  4ISF A;  3VQE A;  4CJK A;  3DI6 A;  4IOA L;  3AA5 X;  3K57 A;  3NDK A;  3NE6 A;  4FYD A;  4FZZ A;  2GX9 A;  3Q7B A;  1OAO A;  1QHT A;  4IOC L;  3TTC A;  1W2B M;  4N76 A;  1EKE A;  4JLH A;  3VTI A;  1E4F T;  2O8B B;  3VF4 A;  3F9K A;  1MWM A;  2NRZ A;  3CM6 A;  3VKH A;  3QA8 A;  1GOC A;  3HVR A;  1E9V A;  3PLT A;  1DEJ A;  4H5W A;  4KB0 A;  3VQ4 A;  5CYM A;  2G8K A;  1WSH A;  3F7W A;  1WB9 A;  3C0B A;  4DSJ A;  4F01 A;  2Q0U A;  4I2P A;  1JLF A;  4PKG A;  4JHD B;  3LP0 A;  1WSF A;  1J53 A;  3MDQ A;  4DLE A;  1NGF A;  1S72 N;  5MLC Q;  4BRK A;  1VQK N;  3DXK B;  4DSL A;  3IFR A;  1S6P A;  4B9V A;  4KTQ A;  4BGB A;  5CYQ A;  4GV6 A;  3WXI A;  4DU4 A;  4JL9 A;  1ZWW A;  4DF4 A;  1U2V B;  3AV9 A;  1RT1 A;  3AVF A;  3H6E A;  1SU6 A;  4CD3 A;  4OLB A;  4MQD A;  3HPH A;  2KFN A;  5I3U A;  1LWF A;  4FLT A;  1BWF O;  2HBJ A;  3PX6 A;  3VGK A;  1Q81 O;  2BE2 A;  2YL9 A;  4C8N A;  3AVJ A;  2QM1 A;  4CEO A;  3AVL A;  2ZGZ A;  1QQN A;  4FLU A;  1Q9Y A;  2VG7 A;  1T3V A;  3M1F A;  3MED A;  2CH5 A;  1ILY A;  3AGR A;  2F4V K;  3I01 A;  3M6G A;  2IGI A;  1X1P A;  3H3N O;  4RG8 A;  3O6W A;  1HNX K;  2O4I A;  4FW1 A;  1VHX A;  1XC3 A;  4LY7 A;  1V4S A;  1GLA G;  3P1G A;  3SUP A;  3BVV A;  4OVL A;  2ZJR L;  4F2R A;  5HRO A;  1KQS M;  3LDP A;  3HAJ A;  1TAQ A;  3IKM A;  3RMB A;  2UUA K;  3TU5 A;  4KAZ A;  2E1Y A;  5AQF A;  1D9D A;  1XMQ K;  3IG1 A;  3PY8 A;  1ZBS A;  3QBX A;  1XNQ K;  1DKX A;  3WXL A;  2QK9 A;  4IM3 A;  1I4T A;  2P9N B;  4J2E A;  3QFP A;  5IWA K;  2P9K A;  1IH7 A;  4DR1 K;  4KO0 A;  4XEI A;  3SUN A;  2PZS A;  4FJL A;  2D0B A;  3R8E A;  3ULE A;  2OCE A;  4DV4 K;  1NK8 A;  1Z25 A;  4IBN A;  1VQO N;  2FLO A;  4I1Q A;  4BRP A;  3O3N B;  3VQP A;  4FZO A;  3CCV N;  1Q18 A;  2X74 A;  4BVP A;  3ZT1 A;  3O9T A;  4DSE A;  3QBW A;  2HMI A;  2X6S A;  4CJQ A;  4CJR A;  2P9U B;  3OYG A;  4I7F A;  4ISG A;  4BRL A;  3H46 O;  3KK7 A;  4HTL A;  1L3V A;  2Q31 A;  1GNT A;  4BWJ A;  4CEE A;  3CVR A;  3DOB A;  1HJR A;  5AQR A;  1GNL A;  3CFP A;  4DQ8 A;  1U00 A;  3JXU A;  3SCX A;  2V7Z A;  5A2Q O;  3AO3 A;  2G8V A;  4DR7 K;  4FJN A;  2FF3 B;  4FWM A;  1KLM A;  3ZSR A;  3OBY A;  4CER A;  4CJF A;  2GEM A;  3S3N A;  3I0S A;  1JJ2 M;  2EX3 A;  4DS5 A;  1ZBL A;  4E72 A;  2GA9 D;  3QIN A;  3WXM B;  3FZL A;  3L3O M;  2XY5 A;  3A8Y A;  2C08 A;  4JI1 K;  4F9O A;  2A6A A;  1TL3 A;  4BR2 A;  1NNE A;  1NOY A;  3EE9 A;  4BWM A;  3KLG A;  1SKS A;  4K8X A;  2WBN A;  3CM5 A;  2O8B A;  1E1D A;  3SAH A;  3DQG A;  4EHT A;  4LFC K;  4ATM A;  1VQM N;  3C65 A;  4DTX A;  4B3O A;  4EZO A;  3DLH A;  1O7D B;  3NFA A;  1HLU A;  3PO5 A;  2PBD A;  1BG3 A;  2I5J A;  2IS3 A;  4BQZ A;  5JMV A;  4E89 A;  3THW B;  3TSU A;  3HJF A;  4CHO A;  3VPZ A;  3SI6 A;  4DYL A;  3OTO K;  4BE7 B;  4BRD A;  3DXK A;  1W97 L;  3FZK A;  2F1A A;  4KHU A;  2CGJ A;  3OYK A;  4MDB A;  1KAY A;  4FPB A;  3KAV A;  3L4Q A;  1RBV A;  4O0J A;  3D52 A;  2JGU A;  2OAN A;  4JKF A;  5M1F A;  1TQS A;  1NK7 A;  2WOM A;  3SUQ A;  4CF9 A;  4FM1 A;  1I3A A;  1GLL O;  2A1R A;  4FJ7 A;  2YHB A;  2YL6 A;  3CET A;  3OS0 A;  3SV4 A;  3QIP A;  4LF5 K;  4CK3 A;  1RDC A;  2YHW A;  4FJ9 A;  2G8F A;  4AZ6 A;  2RPI A;  4OPJ A;  5FRM A;  2P9I A;  4CGH A;  4DKW A;  1H1V A;  2FBV A;  4DTJ A;  1NK4 A;  1WOQ A;  4FWL A;  4FPA A;  1ASW A;  2PYL A;  4JWC A;  5CZ1 A;  3V9U A;  4U7B A;  1LWE A;  4EHU A;  5AQM A;  4CJL A;  3OJU A;  4AZC A;  2NUB A;  4KKO A;  3LAL A;  3EZ5 A;  3SUO A;  1L5U A;  1J5E K;  2BDP A;  3EN9 A;  3AAQ A;  5AQY A;  5FPE A;  1NJI O;  2KZM A;  4V19 S;  3E01 A;  2E6L A;  5C2D A;  4PY5 A;  2F18 A;  2P9N A;  4BRF A;  4CJ4 A;  2D1L A;  2OZN B;  3B52 X;  5I9E B;  3KAW A;  4CBU A;  3RSE B;  4EZY A;  3K5N A;  4ILH A;  4IWV A;  1YTU A;  4LFB K;  4BDY A;  3HST B;  4YOU A;  4FJX A;  2JNS A;  3GOI A;  4D8J A;  4CZG A;  3K58 A;  2G8H A;  1YWM A;  1RDD A;  4MO4 A;  3P31 A;  3D51 A;  2Z0O A;  2P9U A;  1VQ9 N;  5AQT A;  2QKB A;  1TKX A;  1KLN A;  1YVN A;  3D2F A;  3SJH A;  3DRR A;  4M7Y A;  4H8K A;  4FLX A;  1ATS A;  1RTH A;  1A5X A;  3MX5 A;  3VF2 A;  1DGK N;  1T8E A;  1Q5L A;  4H5R A;  3M8P A;  2YHX A;  1S9E A;  4NYN A;  1KRP A;  2V52 B;  4IFV A;  3OYM A;  1XI1 A;  1X3M A;  1C1C A;  4H0Y B;  3F73 A;  1OA0 A;  1BHL A;  5KQD A;  3UE5 A;  1S1V A;  3DX3 A;  2PYJ A;  4B9M A;  4IWO A;  2QWP A;  4PUO A;  2YX6 A;  3ID8 A;  1RT4 A;  3QIC A;  2E20 A;  3L3P A;  1X3N A;  1VSF A;  2D0A A;  3RRH A;  3ID6 A;  3V9S A;  3QEW A;  2Z1I A;  3H45 C;  3C6T A;  1K8K A;  4NCG A;  1BQN A;  2VG6 A;  4HCC A;  3I2W A;  5J2M A;  2NRH A;  3CCL N;  3S9H A;  3AAR A;  3VQ7 A;  4EZP A;  3AO5 A;  4N41 A;  1NK6 A;  3MEC A;  4G6Q A;  4BGA A;  1TK5 A;  1MWK A;  3IRX A;  4Z4F A;  4B9Q A;  3R1X A;  4BG8 A;  4KB1 A;  4M3U A;  4FJI A;  4NLB A;  4K25 A;  4JK9 A;  2I7P A;  3VEZ A;  4AHS A;  3MWP A;  1SL0 A;  1NJX A;  1JLG A;  4LSL A;  4CJU A;  2PAV A;  4KPY A;  4M0M A;  3RV1 A;  4AQY K;  3KJV A;  5DMR A;  3QET A;  1SS6 A;  1URU A;  5BRF A;  3CMA N;  3VQB A;  1N34 K;  2DFH A;  4E7K A;  5DK5 A;  5BRD A;  4JKG B;  4ILI A;  4KHS A;  1VQ4 N;  3HTV A;  4CEC A;  5JVH L;  4RW7 A;  2RKI A;  4PA1 A;  1IKW A;  3IUC A;  4BR9 A;  5BR8 K;  3TAM A;  4HWI A;  3IMX A;  2IVN A;  1HQU A;  4XH1 A;  4E1N A;  2VGN A;  1HX1 A;  2QWN A;  4DU1 A;  4BRN A;  2B5J A;  3NGY A;  3ZT2 A;  4ZHR A;  4DTR A;  3THX B;  4FJH A;  4PL7 A;  1OH8 A;  3NAE A;  3JYT A;  4WQ4 C;  4IO9 L;  2A3Z A;  1W0H A;  4GKJ K;  5FIG A;  4M3Z A;  3VTH A;  3P38 A;  3PV8 A;  3P5J A;  3SJJ A;  1DKY A;  2ZM6 K;  5BN9 A;  2E5L K;  3AGK A;  3ENB A;  4ZTJ A;  2VWJ A;  3ER9 B;  1QHA A;  1BUP A;  3QDK A;  2YI1 A;  3SAF A;  3I33 A;  3SBT A;  4M42 A;  2E4L A;  2O8E B;  2GTD A;  4JRP A;  3VQA A;  3CFR A;  2WC9 A;  3C7N A;  5E26 A;  3O3F A;  1ESV A;  3I55 N;  4F8R A;  1NM1 A;  2FYV A;  2FIC A;  1J6Z A;  3P39 A;  1IKY A;  2HND A;  1UA1 A;  4CEZ A;  3RSE A;  3EJP A;  1LCU A;  3E9O A;  5HP1 A;  3A98 A;  3LMF A;  1BL3 A;  3CKD A;  3NVK A;  2OBM A;  3DAW A;  4HHT A;  1SL1 A;  3T4A G;  3OYL A;  4DTU A;  3SYV A;  2QXF A;  2PY6 A;  1QZ6 A;  1P90 A;  5LJW A;  1U47 A;  4GKK K;  2EHG A;  3BVT A;  2RF2 A;  3BUP A;  2IVO A;  4WV7 A;  4DTO A;  1KCF A;  4J2D A;  3D0P A;  2YL8 A;  2D5R A;  1V4T A;  3NGZ A;  4DV5 K;  1JLB A;  3DXM B;  1O1W A;  2VCP A;  3MN7 A;  4JRQ A;  3HAI A;  3AA2 A;  4O8U A;  1Y2O A;  4WQ5 A;  1Z6R A;  3TSP A;  4FXD A;  4ELT A;  2V51 B;  2XY7 A;  3O1W A;  1QSS A;  4A2B A;  1VK0 A;  4IM0 A;  3CCS N;  1KSP A;  2NNW A;  4IJA A;  3MXI A;  3QIO A;  3TTD A;  4HUG A;  5BRH A;  3VQ9 A;  2OPQ A;  4KH5 A;  2DTU A;  1HYZ A;  1XUP O;  3LZJ A;  3DPP A;  5J2P A;  4NPH A;  1NMN A;  1HR0 K;  3DM2 A;  1JL2 A;  4KHY A;  1BA1 A;  3ZT0 A;  3CF5 L;  2P9L B;  5E41 A;  3ZED A;  3ATV A;  5HOO A;  3HYF A;  3RPM A;  3NF8 A;  4FW2 A;  1SV5 A;  3T69 A;  4EZU A;  3O8M A;  5AFU H;  1RGI A;  4BRC A;  3DOL A;  1LAV A;  4IEE A;  1JL1 A;  4NO7 A;  4MDA A;  3DOK A;  1M1K O;  4XH5 A;  4FWO A;  3F2K A;  1DKG D;  2J4R A;  2Z1G A;  1HKC A;  4BRM A;  3ULE B;  4K8Z A;  3VF6 A;  5HL7 L;  3GG4 A;  2NLX A;  2Z1H A;  3KK3 A;  1E2U A;  1C0G A;  4LF7 K;  3U9Z A;  3EE8 A;  5AQH A;  3VMF B;  1NGH A;  3GDQ A;  1SAZ A;  3QER A;  4LD0 A;  4OKE A;  4M3R A;  4X66 K;  4R5G A;  3F9M A;  2F1B A;  3O80 A;  3SQ0 A;  1HPM A;  4XIU A;  1IKV A;  2NRX A;  1HWW A;  3HM8 A;  4JKG A;  3CYG A;  2NRT A;  1NLV A;  1JKH A;  3VQ5 A;  4Z4C A;  1WNS A;  4PKH A;  3HP6 A;  2P1J A;  2WUS A;  4DV7 K;  1S22 A;  3LM2 A;  3BLB A;  1S6Q A;  4CHP A;  3U3Y A;  1KC8 O;  2G8I A;  3VQ6 A;  5AQK A;  1BIS A;  5KGW A;  4JS4 A;  4CD1 A;  4AHC A;  4ISE A;  4CEA A;  3SQ4 A;  3D45 A;  5AQL A;  1O13 A;  3LDS A;  2XY8 A;  4NQI A;  2ZWH A;  5GAH P;  1YJN N;  3VEN A;  3THX A;  2EX3 B;  2X3W A;  3UIQ A;  2QFF A;  3JSM A;  4H6H A;  2EWF A;  2IAJ A;  4UQG A;  4GV3 A;  2E2N A;  1K8A O;  3ZX2 A;  4CFB A;  3O1B A;  4MLH A;  1HNV A;  5AQG A;  1TAU A;  5HRN A;  4ELU A;  2HNZ A;  2HHT A;  1NGA A;  3L2W A;  3H0X A;  1ZBF A;  3QML A;  4GW6 A;  3O3G A;  1EWR A;  4H0P A;  4CJW A;  2O8E A;  1N33 K;  2YIB A;  3KTQ A;  3TAR A;  4KRE A;  3OY9 A;  3MWT A;  1W9M A;  3V81 A;  5AQU A;  5AFU A;  3DPO A;  3MK6 A;  4M3T A;  4FWP A;  3M3Z A;  3MEG A;  3AVI A;  5H1S Q;  2WFB A;  3N8E A;  2BUP A;  1XHX A;  3V9W A;  3CZN A;  3HOT A;  4Q5V A;  1RNH A;  4BE2 A;  4EAH D;  1TYQ A;  4NLC A;  4E7I A;  2FBY A;  1SUQ A;  2B6A A;  1IO2 A;  5HLF A;  5ADX H;  2V7Y A;  3NF7 A;  2YKT A;  3VET A;  5SWM A;  3CZS A;  2RAJ A;  4B9N A;  3CCE N;  3DXM A;  3O9U A;  2CH6 A;  4DV2 K;  3CJB A;  2D1K A;  4FWK A;  4JKC A;  4K43 A;  5AQP A;  4DV1 K;  1TQT A;  4AH9 A;  3FR0 A;  3LPT A;  4EFH A;  3O08 A;  3FZF A;  3QNO A;  1JCE A;  1HYV A;  3T47 A;  5FPM A;  1N5Y A;  2P9I B;  4A5A A;  4CE9 A;  4FVU A;  3Q84 A;  4AHR A;  3E66 A;  2UUC K;  5J1E A;  3BGR A;  3EJR A;  3ULD A;  5GAG P;  4I43 A;  2F9T A;  4DFJ A;  1JXB A;  1DG4 A;  3WNE A;  2D0O A;  1T05 A;  4AZC B;  4EZW A;  4ILJ A;  4AZ7 A;  1LQ7 A;  2QWR A;  5AQW A;  2JNK A;  3DWL A;  4CFC A;  4CJS A;  4CBX A;  2P9L A;  1SUF A;  5LL6 Z;  4JNE A;  1W7A A;  4A61 A;  4KRF A;  1RCH A;  1G99 A;  3HT3 A;  2MI7 A;  4FWR A;  1ASV A;  3AO2 A;  1B9D A;  2GUP A;  4I2Q A;  4KV8 A;  5KQ8 A;  3K5O A;  3E9P A;  3HI0 A;  5HRP A;  3WEE B;  3EJT A;  4ILH B;  3TR8 A;  2YIA A;  4E0D A;  4CZH A;  4JKE A;  2HF3 A;  4ICL A;  2E2O A;  2GWK A;  4AHU A;  3FD9 A;  5AQZ A;  4FWS A;  5JLF A;  3T7Z A;  1WDZ A;  3MEE A;  4WPC A;  2D0C A;  3DX0 A;  2EFL A;  3D2F B;  3VES A;  5AZI B;  3R6M A;  4DQP A;  2BAN A;  3L2Q A;  1RDA A;  4CIF A;  1FJG K;  2FXU A;  1WSE A;  2YHA A;  5ADX A;  3T3F A;  3ZET A;  1Q8I A;  1T44 A;  3EL2 A;  2Q36 A;  1C0U A;  1XQS C;  2HF4 A;  4CGI A;  4HY9 A;  3K2P A;  3SPZ A;  1VSH A;  1Q82 O;  2A5X A;  3LDQ A;  5BN8 A;  3A5O C;  1Q7Y O;  3DMJ A;  2DY4 A;  3A5L C;  1X9W A;  4C1N K;  4YOT A;  5KPT A;  4R5L A;  1BIZ A;  1U45 A;  5TKY A;  4TSX A;  5C24 A;  3CJA A;  3MN6 A;  4HTU A;  2OA8 A;  3EJQ A;  2YJE A;  1XHZ A;  3O9R A;  4YY3 K;  2ZF5 O;  1ZBU A;  3HSC A;  4FJ5 A;  2HST A;  3CCR N;  1K8K B;  4AVM A;  2BGG A;  4EP5 A;  4WFB L;  1JLQ A;  4Z4G A;  1KAX A;  2UU9 K;  2HB5 A;  3PLA A;  4FM0 A;  2O8F B;  5GAE P;  4R5I A;  1J54 A;  2NCZ A;  4IEI A;  4OX9 K;  2ALW A;  3QO9 A;  3W3D A;  3BVX A;  2W42 A;  1L3T A;  4OGC A;  5AR0 A;  4E3S A;  3D4Y A;  3VQC A;  1X04 A;  2YJF A;  4YFU A;  1D8Y A;  4DR6 K;  2LM0 A;  1YXQ A;  2A1S A;  2BH1 A;  4QS9 A;  1R59 O;  2FSJ A;  1G15 A;  3HXM A;  1N32 K;  4K0K K;  4B1V A;  2OTJ N;  2JWK A;  3CHW A;  4A2A A;  5C2F A;  3T1A A;  3C6A A;  3SAG A;  1DLO A;  4JN4 A;  4CZM A;  3VEO A;  3VQ8 A;  3J81 O;  4AHV A;  1IJJ A;  1EXQ A;  2EWS A;  3QEP A;  2HVI A;  4FLZ A;  4LC9 B;  3BF3 A;  1GLF O;  2RHK A;  4JI4 K;  1QSY A;  1HUX A;  4DV3 K;  1VRT A;  2QWO A;  3D2E A;  4MFB A;  4M3Y A;  4FWN A;  3HP9 A;  3PSF A;  4BRA A;  4DFM A;  4FJJ A;  1QQC A;  3EO3 A;  3V9Z A;  1VSJ A;  3H1V X;  1WAJ A;  3QB0 A;  4JKA A;  1S1X A;  3MCP A;  4C1N I;  2W00 A;  1QQO A;  4IXC A;  2KFZ A;  4JI5 K;  4QAG A;  3RMD A;  3VOV A;  1XWL A;  2ZJP L;  5KPZ A;  1TUU A;  2YIV X;  1XMO K;  4KFB A;  4QCL A;  1RBR A;  2F96 A;  4BC3 A;  1TQU A;  2FF6 A;  1DT9 A;  5SZT A;  4KBO A;  2YLA A;  4FJM A;  1KVA A;  3AVA A;  4B3M K;  1TVR A;  1SU8 A;  3NF9 A;  2R7Y A;  3G6E N;  3AVB A;  3DRS A;  3M8Q A;  4BEB A;  4Y1C A;  3WXJ A;  4KI6 A;  3P4I A;  2O8D B;  1ATR A;  4CJE A;  3DPQ A;  3WNH A;  3CFO A;  3SBT B;  5KRS A;  4DR3 K;  1N6Q A;  2QEX N;  1YIT N;  4BR4 A;  4BAC A;  4HR1 B;  3C7N B;  4DQQ A;  4Z4I A;  1IV0 A;  1LW0 A;  3QNN A;  5GIO A;  4A59 A;  3AVH A;  1UA0 A;  3LAN A;  1GN9 A;  3CCM N;  4OLA A;  1XNR K;  1NOZ A;  3UIT A;  3AA4 A;  3LZI A;  1KTQ A;  3WEE A;  3RRG A;  5D3G A;  1BA0 A;  1QVG M;  5AJ3 K;  3THY B;  4IG0 A;  3HBT A;  4DTN A;  4HYB A;  3MCA B;  1W9H A;  1U49 A;  4X65 K;  3VEV A;  3K0S A;  3UKR B;  3T1H K;  3CJ7 A;  3DYT A;  3KK2 A;  3A2F A;  1JLE A;  3D4Z A;  1YUW A;  2AP1 A;  5AZI A;  1DTT A;  4FJG A;  4B9U A;  1TKD A;  2O8C A;  4IWQ A;  1JCG A;  4B1Y B;  2QKW A;  2A42 A;  3JS6 A;  4GVE A;  2QTD A;  4WFN L;  2FBT A;  1TK8 A;  1Q86 O;  4CK2 A;  3TAG A;  3ZLJ A;  2ZQB A;  4JAX A;  7HSC A;  1O7D C;  1RTJ A;  2HVH A;  5FPN A;  4KH6 A;  4W5N A;  1NK0 A;  4N56 A;  4IM2 A;  1T7P A;  4DU3 A;  4Z0U A;  4I6M A;  1SU7 A;  4CEQ A;  2OTL N;  3B51 X;  1CZA N;  1REV A;  3KKR A;  4DUZ K;  3JAM O;  1OH6 A;  1L3U A;  4ID5 A;  3D7E O;  1GLD G;  1CLQ A;  3DRP A;  1OH5 A;  3OWG A;  3AVC A;  1WAF A;  3E1Y A;  1QX1 A;  1C0M A;  1VAZ A;  3LAM A;  3TWH A;  3ACO A;  3OHR A;  4F3T A;  3ASM A;  1S1T A;  3QFU A;  3R3L A;  4PKI A;  1T03 A;  5HRS A;  4F2S A;  3Q0K A;  4BDZ A;  1HNI A;  3P83 D;  3OYF A;  1IKX A;  1X9J A;  3L6Q A;  4FOI A;  3NHG A;  3ZCM A;  2CGK A;  3CJ9 A;  5FLX O;  3OYD A;  5M1K A;  3WNF A;  2Z8Y A;  1RTD A;  2O8F A;  4JI6 K;  1SL2 A;  1RT2 A;  2Q97 A;  4A5B A;  2LSN A;  2VG5 A;  4BRQ A;  3CG7 A;  3VGL A;  1HJO A;  3BY5 A;  4F4K A;  2KKZ A;  4NB4 A;  1QS4 A;  3LAK A;  5AQO A;  3C95 A;  4AZI A;  2P9S B;  4BRE A;  1D4X A;  4B9T A;  4KHN A;  3SK3 A;  5B8H A;  3O5B A;  2OW7 A;  3EZW A;  1RT7 A;  4IFE A;  2ATQ A;  2P51 A;  3R9P A;  1GLB G;  3FFI A;  4CEF A;  3BUD A;  3T1Y K;  2RT6 A;  3QEV A;  3QNJ A;  3AO4 A;  4RWT A;  4Q0B A;  5K14 A;  2YI8 A;  4H8S A;  5CE3 A;  4CW7 B;  3QLH A;  4CES A;  5BPL A;  3PX4 A;  2VWK A;  4IDH A;  3CQ8 A;  1RTI A;  1KVB A;  4JI8 K;  1JXE A;  4IG3 A;  4O0I A;  3VEW A;  1GLC G;  1X03 A;  3FZM A;  2IVP A;  3O3H A;  3CAZ A;  4C8K A;  1HNZ K;  1MU2 A;  4KIK A;  3HO1 A;  1IBL K;  3HK2 A;  3V9X A;  4CCH A;  4HCB A;  2QWL A;  4CJT A;  3H08 A;  1Y97 A;  5C12 A;  4IZ9 A;  3S3O A;  4B8A B;  3FZH A;  4NCB A;  4FLY A;  3BF1 A;  3KLF A;  2HOE A;  2F7O A;  4AZH A;  4DUY K;  4FL9 A;  4CK1 A;  4BRH A;  2ND0 A;  1KAZ A;  1VRU A;  2YNF A;  4U67 L;  4X64 K;  1U4B A;  1FKP A;  4IDK A;  2WTU A;  4PWD A;  4B1Z A;  5F0X A;  4I9L A;  1LWC A;  1MDU B;  1C6V A;  2NRW A;  1ZBI A;  5C5B A;  4CJ5 A;  2O8D A;  1YHQ N;  4FZP A;  3DDG A;  1U48 A;  4YOR A;  3AY9 A;  2KLA A;  3FFK B;  4AIL C;  2C1G A;  4HR1 A;  2AJQ A;  4CF1 A;  3TAP A;  3OYH A;  3VEB A;  4WQ5 C;  3PIP L;  3U4L A;  1CXQ A;  3SZ2 A;  1I4L A;  3OJS A;  1LV5 A;  1BGX T;  3SQ1 A;  3KDR A;  4W5R A;  3THY A;  2JLE A;  1A5W A;  1B9F A;  4YDU A;  3NVM A;  2F7Q A;  5EXW A;  2BPR A;  1TK0 A;  5LMN K;  3UKR A;  3RTV A;  2Z1J A;  3AVM A;  1ZYQ A;  3QES A;  1S9G A;  1TYQ B;  3BVU A;  1C1A A;  4M3X A;  1DKZ A;  4CJ7 A;  3RR8 A;  1EX4 A;  2UXB K;  5FPD A;  1GOA A;  1EQY A;  5JEN A;  1D9F A;  2YLL A;  5JVG L;  3MAQ A;  1NJZ A;  2NRR A;  1YAG A;  2YKN A;  4CED A;  1ATN A;  2DFE A;  1C0T A;  5J2Q A;  3FGU A;  3I8B A;  4B08 A;  3OS2 A;  4FM3 A;  3G71 N;  4UDX X;  3PO4 A;  1NGJ A;  1NGB A;  3O4W A;  2FBX A;  2E2Q A;  3AO1 A;  3C94 A;  1E3M A;  2W6L A;  3G0Z A;  2VYP A;  4Y1D A;  5CY4 A;  4FJ8 A;  3VER A;  4DWI A;  4EIA A;  1NGE A;  2HNY A;  4H0T B;  4BQL A;  2RAK A;  5C42 A;  4OKK A;  2W6K A;  4KHW A;  4NCA A;  2HHU A;  3BVW A;  3M5R A;  4B8C A;  1CKR A;  4DR2 K;  3F5T A;  1VSI A;  1R33 A;  4EZN A;  1X9S A;  4AZB A;  3BEX A;  2GBZ A;  4B9L A;  1NKE A;  4DQS A;  4B1W B;  5GIN A;  3SMS A;  3AVG A;  4JWI A;  4W5Q A;  4FM2 A;  3CXC M;  3SNN A;  3C6U A;  1KD1 O;  2P9S A;  2A41 A;  2O0I 1;  4Z4H A;  1NK9 A;  3KZB A;  1IG9 A;  5DM6 L;  1TGO A;  4PHT X;  1TKT A;  3Q7C A;  3M3W A;  4JI2 K;  3ZT3 A;  4CVN E;  4ZTF A;  3ER8 C;  1VQP N;  4E19 A;  5KPR A;  3HL8 A;  3J8A A;  2DPN A;  3I04 A;  1RBT A;  2OW6 A;  4O44 A;  5AZJ B;  2UXD K;  4JWD A;  4RW4 A;  5JLH A;  1OVY A;  5KTQ A;  3OYA A;  1IBK K;  4AF1 A;  3J80 O;  1CZB A;  4BRG A;  3ZET B;  4ILG B;  4JI0 K;  3MXM A;  4KI4 A;  1WSJ A;  3U6F A;  2HHS A;  4XH4 A;  2WIN M;  4DMN A;  4BDP A;  1BOT O;  2I7N A;  4JD2 B;  3L3U A;  4QS7 A;  4E1J A;  3M8R A;  1BPR A;  3CCJ N;  2VQF K;  4E81 A;  4XJX A;  3OVN A;  3AAP A;  5JIC A;  3KD5 E;  1KVC A;  5F2R A;  4C8O A;  2F8T A;  3K9J A;  1JLA A;  3TPQ A;  3QEX A;  3GI7 A;  2A40 A;  1TKZ A;  1Z05 A;  3CJ1 A;  1UWB A;  4FZS A;  1VSK A;  1KFD A;  1U6Z A;  3CC4 N;  5GIP A;  3ISN C;  4BY9 C;  4LFA K;  4CF2 A;  2WON A;  1K9M O;  5KRT A;  2ND1 A;  3OHX M;  4CI6 A;  5TKW A;  4M41 A;  3LDO A;  1YJ9 N;  3A0I X;  3EKU A;  3LPU A;  1BCO A;  3CYM A;  4A57 A;  2P5G A;  3UKU B;  1CZ9 A;  4CF8 A;  5AQJ A;  4JK8 A;  3WQT A;  3C6H A;  2YHY A;  4NSW A;  4H0V B;  3BDP A;  4IOX A;  2QA4 N;  3OYC A;  4H5T A;  3OYE A;  1J9A A;  2QWQ A;  4DTS A;  2NRV A;  1F21 A;  3KLI A;  3OYB A;  2QW9 A;  4ELV A;  4AZG A;  2HBL A;  1R34 A;  1N36 K;  5AQN A;  1NMD A;  2DFF A;  3CV5 A;  2Q0R A;  3DYA A;  2QKK A;  3SLC A;  5IT9 O;  1S1W A;  1XC9 A;  2HBM A;  1BIU A;  4BE1 A;  4YNQ A;  3AA3 A;  3KD1 E;  4B1U B;  4I9Q A;  3OYI A;  3O9S A;  3DX4 A;  4O4G A;  4DV0 K;  3NH2 A;  3EY1 A;  3WXK A;  2PMR A;  3VEX A;  4CHZ A;  4DLG A;  4BR0 A;  3D2E B;  1WSI A;  1BI4 A;  1NGC A;  3CC2 N;  1ZXO A;  5EOY A;  3WT0 A;  4JI7 K;  1TV6 A;  4GVM A;  3KIO A;  3A5N C;  4NYF A;  3S41 A;  3TAQ A;  2WYH A;  1NGI A;  4CIE A;  3OA9 A;  4A62 A;  2ETJ A;  4FLV A;  3EKS A;  4RTF D;  1ZYL A;  2GV9 A;  3ATU A;  4H4O A;  1J5O A;  2GEL A;  2FC0 A;  3ALY A;  2X78 A;  3CIP A;  4CHQ A;  1RIL A;  4JV5 K;  4J8F A;  2D4W A;  4MLE A;  4KH4 A;  1WN7 A;  5I42 A;  1BQM A;  2N3K A;  3MXJ A;  4OPK A;  2B4J A;  4G1Q A;  4GNI A;  1YVU A;  5LY3 A;  3SQ2 A;  4J2A A;  1NGG A;  2RE2 A;  1RFQ A;  2F7P A;  3BUI A;  2ITM A;  2E1Z A;  2Q2R A;  4WE1 A;  3KLE A;  1JLC A;  1WSG A;  3VGM A;  5HRR A;  1PS3 A;  4FZY A;  3QE6 A;  1HKB A;  4H5V A;  4JLC A;  4IKF A;  4KHQ A;  4JK7 A;  1YJW N;  3I56 N;  3ZX3 A;  2HHQ A;  4BR5 A;  3AVK A;  3PUF A;  5C0Y A;  2XRI A;  4JS5 A;  3CD6 N;  1YIJ N;  4ID1 A;  1LAW A;  2OPR A;  1VSE A;  3ITH A;  2IIR A;  1VSL A;  3SOG A;  5AZJ A;  3SPY A;  3ZSZ A;  2O8C B;  3SBS A;  3NH0 A;  1FK9 A;  4BE0 A;  4E7H A;  1VQ8 N;  1HNW K;  1UAX A;  2QWM A;  5EVZ A;  4DF8 A;  2HHW A;  4ILG A;  3HZ6 A;  1M90 O;  1QWU A;  3PIO L;  1S1U A;  4B3R K;  4DR4 K;  4LF4 K;  1HTY A;  1GLJ O;  3L2R A;  3DLE A;  4JD2 A;  4C8L A;  1I39 A;  3ZEU B;  1QZ5 A;  5HBM A;  4CZJ A;  5FRN A;  3B8A X;  2XO7 A;  4I6M B;  2UXC K;  4WFA L;  2EFK A;  4B1X B;  3QEI A;  3J7Z O;  1BCM A;  4JEP A;  3THV A;  3WQU A;  2C1I A;  1RDW X;  4CFD A;  2QI2 A;  5EU7 A;  4O55 A;  3VQD A;  2UYT A;  3NBP A;  2HMP A;  2HHH K;  2ASM A;  3WUH A;  3O3O B;  3HRG A;  3OYJ A;  4CF0 A;  4MQ3 A;  3LP3 A;  1WLJ A;  3CER A;  4FJK A;  5DM7 L;  2D4C A;  1WUA A;  3VQQ A;  2YNH A;  1N8R O;  1BO5 O;  3UKU A;  4DQI A;  3D6R A;  3N4Q A;  4J2B A;  4Y0W A;  5BPN A;  2ZGY A;  2KW4 A;  1I94 K;  3V1R A;  1TUY A;  2HBK A;  5C25 A;  1ZBH A;  3SMP A;  4CZE A;  3V4I A;  4FK4 A;  2W41 A;  2YI9 A;  4JKB A;  3ZSW A;  3L3V A;  3CPE A;  4CZI A;  5J2N A;  3RMA A;  2NZT A;  4DS4 A;  3O3M B;  3LDN A;  4HUF A;  3J7Y P;  4EZV A;  5C15 A;  1MJG A;  2YKM A;  4AZ5 A;  3T49 A;  2OP6 A;  3RR7 A;  4JKD A;  4RW6 A;  1NG9 A;  3N4P A;  2G8U A;  4L8R B;  4YOY A;  4Z94 A;  2P5O A;  4EZX A;  4JHD A;  1RT5 A;  4KTW A;  5FDL A;  5AQX A;  2ZE2 A;  4BC5 A;  2ITG A;  4BG9 A;  3KK1 A;  4YOX A;  4KIK B;  2HW3 A;  2FSN A;  4WF9 L;  1QSL A;  3HPO A;  5BRE A;  3PSI A;  5M1P A;  2AA4 A;  4B3S K;  2IDO A;  2PFU A;  4FVM A;  1U2V A;  4QS8 A;  4FLW A;  3ERC C;  5M1N A;  4IWP A;  3T46 A;  4G9Z A;  3NF6 A;  4L3Q A;  4FOE A;  3J7A P;  1KFS A;  4YOV A;  4FWQ A;  4CZL A;  1NK5 A;  2XY6 A;  3LVT A;  1NJW A;  2O4G A;  4WPE A;  3LLL A;  4EZZ A;  4DSK A;  3ZX0 A;  5JS2 A;  4OPH A;  4K41 A;  4EZ9 A;  3GE1 A;  5C5B B;  1EET A;  3NCI A;  2Y1I A;  1TQW A;  5CR4 A;  4X62 K;  2OZM A;  1ZC6 A;  2OZS A;  2YNI A;  1Y64 A;  1R5E A;  5AQQ A;  2XHB A;  1VQN N;  1EWQ A;  4DR5 K;  2GAF D;  3IDH A;  3HVT A;  3BZK A;  1NU0 A;  4HUE A;  2G8W A;  4AM7 A;  3CJC A;  1VSM A;  1YT3 A;  3U9D A;  4CGF A;  4NXM K;  3ENH A;  4JYA K;  1LW2 A;  4BC4 A;  2OBL A;  1KXP A;  1HMV A;  3E9L A;  3CC7 N;  1T6C A;  4OGE A;  2VQE K;  2KTQ A;  1RDU A;  3IS9 A;  3L2V A;  4IFY A;  1MA9 B;  2FSK A;  3G9G A;  1SQK A;  5CZ2 A;  1WBB A;  4CEB A;  5GAD P;  4H0O A;  3G10 A;  1HKG A;  3NGI A;  4R5K A;  1X9M A;  2KQ2 A;  4E7L A;  4LF9 K;  3CPW M;  4AHT A;  3O4N A;  3ZYY X;  3TAE A;  1Z26 A;  4KTZ A;  4DV6 K;  2KZZ A;  4LSN A;  4BNE A;  3ZT4 A;  3H3O B;  4MO5 A;  1GLE G;  4OPA A;  4M7X A;  2V0O A;  3ZEU A;  4C23 A;  4DQR A;  1TQV A;  2ZJQ L;  3VA3 A;  3UB5 A;  4R5P A;  1QE1 A;  3VEA A;  1T6D A;  1OH7 A;  4FZX C;  4H6I A;  4DCN C;  3EJU A;  4O5B A;  4E1M A;  2ASO A;  3BZC A;  4CGG A;  4C8M A;  4K42 A;  3RMC A;  4DTM A;  2X3X A;  1RBS A;  3DX2 A;  3FLC O;  1A5V A;  3ZSX A;  3LWM A;  2ZXQ A;  3V6D A;  1S3X A;  3GBT A;  1QWN A;  3RV0 A;  4H0X B;  2E2P A;  1SKR A;  1NJY A;  5F1X A;  4H5N A;  4F3O A;  1OKJ A;  2KHO A;  1K73 O;  4BEC A;  1ITG A;  4O8K A;  4QOZ B;  1HYS A;  3I39 X;  5E84 A;  3TI0 A;  4JKH A;  3WNG A;  1YF5 L;  3DX1 A;  3KLH A;  4PO2 A;  2YCH A;  1NBW A;  4CIG A;  3G4S N;  1FKO A;  2OPS A;  4JNF A;  4RW8 A;  2Q1N A;  1C0F A;  5FRO A;  3ZSO A;  3MN5 A;  2OPP A;  1TL1 A;  3FE1 A;  3KWI A;  4YHH K;  4RW9 A;  3THW A;  4AKV A;  3CQX A;  1OVQ A;  1JCF A;  3NH1 A;  3LM9 A;  3ZEF A;  3G25 A;  3MMV A;  3ENO A;  4BVO A;  2RAI A;  3DLK A;  3DLL L;  2CGL A;  2LXY A;  3O9Q A;  5BPM A;  3TAF A;  2W40 A;  3IAY A;  3KKS A;  1UOC A;  1SZ2 A;  2H3G X;  4EZS A;  3SYZ A;  3L2U A;  3V1O A;  3ZSV A;  4W5O A;  1BDG A;  2BTF A;  2F9W A;  5AQV A;  1NGD A;  3W0L A;  4YDU C;  4EZ6 A;  2P9P B;  1FXX A;  5LMU K;  3RWU A;  1QVF M;  4RCH A;  2IOC A;  3S5T A;  4IO8 A;  1P8Z A;  2X3V A;  3B53 X;  3RVC A;  4AM6 A;  1JQK A;  4DTP A;  1VSD A;  3CME N;  4CZF A;  1VQ5 N;  5KGX A;  5BR9 A;  3HM9 A;  1HXK A;  4M45 A;  4DFK A;  3CQY A;  3ZSQ A;  3K59 A;  3U3G A;  1LOT B;  3OYN A;  1HRH A;  4DSI A;  4IW0 A;  4B3T K;  4M3W A;  1QTM A;  4R5J A;  4BC2 A;  4YOW A;  3BP8 A;  5EY4 A;  2F8S A;  3HAH A;  4N47 A;  4B9S A;  1RDB A;  1CXU A;  4GV9 A;  3B6P A;  4CJ3 A;  4CGD A;  4FSV A;  1VQL N;  3VN5 A;  1DTQ A;  3LP2 A;  1RT6 A;  5M1Q A;  3H1Q A;  3LL3 A;  4CGJ A;  5AQS A;  4E3C A;  3B6O A;  3K9K A;  2UUB K;  4DSF A;  5LJV A;  2ZD1 A;  4LH5 A;  3VA0 A;  3L8B A;  3L0Q A;  2IC3 A;  4IJN A;  3QWE A;  2OO2 A;  2Z0V A;  3DJC A;  2YL5 A;  2X6N A;  4UDY X;  3SBG A;  3TTF A;  2Z0N A;  5KBP A;  4WQ4 A;  1L3S A;  1BI4 B;  3I8D A;  2Q3S A;  5T7B A;  3BUZ B;  3MX2 A;  4M63 C;  4CZK A;  1FW6 A;  1NKB A;  4FCY A;  3VEY A;  3DDF A;  3M8S A;  4GY2 B;  2GWJ A;  4PL8 A;  1BU6 O;  4LF6 K;  4PQU A;  3PX0 A;  1I49 A;  3KWG A;  3D50 A;  1U04 A;  1Q9X A;  1ASU A;  2ASP A;  4BR7 A;  4CHY A;  3GL1 A;  4DB3 A;  3AVN A;  1D5A A;  1S5J A;  4CHN A;  3EYZ A;  4JWE A;  3DLB A;  3SV3 A;  3EEQ A;  4H4M A;  3CCU N;  2RN2 A;  2E88 A;  4DCH A;  3EJS A;  5KI6 A;  1NKC A;  4DG1 A;  4KHP K;  4DHY A;  1EO1 A;  3V1Q A;  1WBD A;  4EZT A;  3QNI A;  5JS1 A;  4GMJ B;  5ELZ A;  3O4Q A;  3CCQ N;  1R0A A;  3HOS A;  4O5F A;  1IBM K;  2Y1J A;  3I0R A;  1HPZ A;  4CFA A;  1YTA A;  4OJR A;  3TAN A;  4CJV A;  5CHI A;  1NWK A;  2F7R A;  2ELB A;  2YV0 X;  2QXL A;  3ABH A;  5AQI A;  2VGM A;  2HHI A;  4WYB A;  4W5T A;  4LH4 A;  1HQE A;  4NXN K;  2E8A A;  1VQ6 N;  1I4D A;  2Q13 A;  3BUB A;  4EZQ A;  3LDL A;  1RT3 A;  2VWB A;  3A5M C;  1EP4 A;  3DLR A;  4FK0 A;  2P9K B;  2HHV A;  3BUQ A;  1OA1 A;  4F00 A;  3NMU A;  3OS1 A; 
#chains in the Genus database with same CATH homology
 2ITM A;  2E1Z A;  4WV5 A;  2Q2R A;  1E4G T;  4H03 B;  5EX5 A;  3VGM A;  3KHY A;  1SU8 A;  3G6E N;  1HKB A;  3IUC A;  2JWL A;  4H5V A;  4BR9 A;  4BEB A;  4JLC A;  3IMX A;  4HWI A;  3WXJ A;  2IVN A;  3KVG A;  3P4I A;  4JK7 A;  1YJW N;  1ATR A;  4XH1 A;  4BRI A;  3I56 N;  2VGN A;  3ZX3 A;  3DPQ A;  3TSQ A;  4BR5 A;  1HX1 A;  2QWN A;  4BRN A;  3SBT B;  5C0Y A;  3L4I A;  1YIT N;  2QEX N;  4R79 A;  4FO0 A;  3CD6 N;  4BR4 A;  2X5C A;  4PL7 A;  1YIJ N;  4HR1 B;  3C7N B;  4BRO A;  4WQ4 C;  2IIR A;  5GIO A;  4A59 A;  4IO9 L;  1GN9 A;  3CCM N;  5AZJ A;  3OBW A;  3UIT A;  2A3Z A;  4CBW A;  3WEE A;  2P9P A;  5FIG A;  1VQ7 N;  3VTH A;  3P38 A;  3SBS A;  1BA0 A;  2D0P A;  4WCE L;  1VQ8 N;  5M1O A;  1QVG M;  2QWM A;  5EVZ A;  1DKY A;  3T48 A;  2F7T A;  4ILG A;  1IG8 A;  3HZ6 A;  3HBT A;  5BN9 A;  3AGK A;  4HYB A;  3ENB A;  3MCA B;  3PIO L;  1M90 O;  3VEV A;  3ER9 B;  1QHA A;  1BUP A;  1GLJ O;  3QDK A;  2YI1 A;  3SAF A;  3I33 A;  3SBT A;  3UKR B;  1QQM A;  5FLE X;  3CJ7 A;  4JD2 A;  3U8X A;  2GTD A;  1UPX A;  3CI5 A;  2WC9 A;  3OW2 M;  3C7N A;  5E26 A;  3ZEU B;  1QZ5 A;  1ESV A;  3MN9 A;  4CZJ A;  4UY8 O;  3I55 N;  3B8A X;  4OO1 J;  4I6M B;  1YUW A;  2AP1 A;  5C10 A;  4EZR A;  5AZI A;  4B1X B;  1NM1 A;  4WFA L;  1J6Z A;  3P39 A;  3J7Z O;  1YI2 N;  4ISF A;  4JEP A;  3WQU A;  3RSE A;  4IOA L;  2C1I A;  4IWQ A;  1JCG A;  1RDW X;  1LCU A;  4B1Y B;  2QI2 A;  3E9O A;  2A42 A;  3A98 A;  3JS6 A;  3LMF A;  2GX9 A;  4GVE A;  2QTD A;  3Q7B A;  4WFN L;  1OAO A;  4IOC L;  3NVK A;  1Q86 O;  2OBM A;  3TTC A;  1W2B M;  3DAW A;  3T4A G;  2UYT A;  1E4F T;  4JAX A;  3VTI A;  2HMP A;  7HSC A;  3VF4 A;  2ASM A;  1MWM A;  3O3O B;  3HRG A;  3WUH A;  2NRZ A;  5FPN A;  2PY6 A;  3VKH A;  4KH6 A;  3QA8 A;  3CER A;  1QZ6 A;  1P90 A;  4IM2 A;  1E9V A;  1DEJ A;  4H5W A;  1WUA A;  5LJW A;  5DM7 L;  4I6M A;  1SU7 A;  2OTL N;  1N8R O;  3B51 X;  1CZA N;  1BO5 O;  3UKU A;  2IVO A;  4WV7 A;  3D6R A;  3N4Q A;  4Y0W A;  3F7W A;  5BPN A;  2ZGY A;  3C0B A;  1GLD G;  3D7E O;  4F01 A;  3OWG A;  2Q0U A;  4PKG A;  1V4T A;  4JHD B;  1TUY A;  2HBK A;  3MDQ A;  3DXM B;  3E1Y A;  1NGF A;  1VAZ A;  2W41 A;  3SMP A;  4CZE A;  2VCP A;  2YI9 A;  3MN7 A;  3OHR A;  1S72 N;  4JKB A;  3R3L A;  4O8U A;  3QFU A;  4PKI A;  5MLC Q;  4BRK A;  4CZI A;  3CPE A;  3DXK B;  3IFR A;  4WQ5 A;  1VQK N;  1Z6R A;  2NZT A;  4BGB A;  4GV6 A;  3TSP A;  1X9J A;  3WXI A;  3O3M B;  3L6Q A;  3LDN A;  4FOI A;  2V51 B;  3O1W A;  4EZV A;  5C15 A;  4A2B A;  1MJG A;  4JL9 A;  2CGK A;  4IM0 A;  3CJ9 A;  3CCS N;  2NNW A;  4IJA A;  3T49 A;  5M1K A;  1U2V B;  2Z8Y A;  3TTD A;  2OP6 A;  5BRH A;  4JKD A;  3H6E A;  1SU6 A;  2Q97 A;  4A5B A;  4KH5 A;  4BRQ A;  4CD3 A;  4MQD A;  3VGL A;  1HJO A;  1XUP O;  3N4P A;  2KKZ A;  3DPP A;  4NB4 A;  4YOY A;  1BWF O;  4NPH A;  4Z94 A;  5AQO A;  4EZX A;  2HBJ A;  4JHD A;  5AQX A;  3VGK A;  2P9S B;  4BC5 A;  4BRE A;  1D4X A;  1Q81 O;  4BG9 A;  2QM1 A;  3SK3 A;  5B8H A;  3O5B A;  3EZW A;  4YOX A;  2ZGZ A;  4KIK B;  1QQN A;  2FSN A;  4WF9 L;  1T3V A;  1BA1 A;  3M1F A;  4IFE A;  5BRE A;  3R9P A;  5M1P A;  3CF5 L;  1GLB G;  2P9L B;  2AA4 A;  3ZED A;  2RT6 A;  2CH5 A;  3ATV A;  2PFU A;  3AGR A;  5HOO A;  3QNJ A;  1ILY A;  3I01 A;  3M6G A;  4RWT A;  3H3N O;  1U2V A;  3T69 A;  4EZU A;  3O8M A;  2YI8 A;  3O6W A;  4QS8 A;  5AFU H;  3ERC C;  5CE3 A;  1RGI A;  5M1N A;  4IWP A;  4BRC A;  5BPL A;  3T46 A;  4IEE A;  4IDH A;  1XC3 A;  4NO7 A;  4G9Z A;  4MDA A;  1M1K O;  4XH5 A;  4FWO A;  4L3Q A;  4FOE A;  1V4S A;  1DKG D;  3F2K A;  1GLA G;  2J4R A;  3VEW A;  1HKC A;  4YOV A;  1GLC G;  4FWQ A;  3ULE B;  4BRM A;  3FZM A;  2IVP A;  4CZL A;  2ZJR L;  3VF6 A;  5HL7 L;  3GG4 A;  1KQS M;  2NLX A;  4KIK A;  3LDP A;  1E2U A;  1C0G A;  4EZZ A;  3IKM A;  3ZX0 A;  3TU5 A;  3EE8 A;  4OPH A;  4K41 A;  5AQH A;  3U9Z A;  3GE1 A;  3VMF B;  1NGH A;  2QWL A;  3GDQ A;  5C12 A;  1SAZ A;  5CR4 A;  1ZC6 A;  2E1Y A;  4IZ9 A;  5AQF A;  3FZH A;  1ZBS A;  1Y64 A;  4R5G A;  2HOE A;  3BF1 A;  3F9M A;  3O80 A;  3QBX A;  1HPM A;  5AQQ A;  1VQN N;  2NRX A;  3HM8 A;  1DKX A;  3WXL A;  4IM3 A;  4FL9 A;  4JKG A;  2GAF D;  2P9N B;  2NRT A;  3QFP A;  2ND0 A;  1KAZ A;  1NLV A;  3IDH A;  4BRH A;  2P9K A;  4U67 L;  4PKH A;  2WUS A;  4B1Z A;  4XEI A;  5F0X A;  1S22 A;  3LM2 A;  3R8E A;  3ULE A;  1KC8 O;  4AM7 A;  3CJC A;  5AQK A;  1MDU B;  3U9D A;  2NRW A;  1VQO N;  2FLO A;  4BRP A;  3O3N B;  4CD1 A;  4ISE A;  3CCV N;  1Q18 A;  4BVP A;  3O9T A;  5AQL A;  3QBW A;  1O13 A;  3ENH A;  1YHQ N;  4BC4 A;  1YJN N;  2OBL A;  1KXP A;  2ZWH A;  4YOR A;  2P9U B;  3VEN A;  5GAH P;  2EX3 B;  3E9L A;  4BRL A;  2QFF A;  2KLA A;  4H6H A;  3AY9 A;  3FFK B;  3H46 O;  3KK7 A;  2EWF A;  4HR1 A;  4HTL A;  3CC7 N;  1T6C A;  2Q31 A;  1GNT A;  1RDU A;  2E2N A;  1K8A O;  4GV3 A;  3DOB A;  5AQR A;  1MA9 B;  1GNL A;  2FSK A;  1SQK A;  3ZX2 A;  3O1B A;  4DQ8 A;  1U00 A;  3JXU A;  3VEB A;  4WQ5 C;  4MLH A;  5GAD P;  3PIP L;  4H0O A;  3U4L A;  2V7Z A;  5AQG A;  1HKG A;  4R5K A;  3KDR A;  2FF3 B;  4FWM A;  1NGA A;  3CPW M;  3H0X A;  4YDU A;  3NVM A;  3OBY A;  3ZYY X;  3QML A;  5EXW A;  2BPR A;  3UKR A;  2GEM A;  4H0P A;  1JJ2 M;  2YIB A;  3H3O B;  4MO5 A;  2GA9 D;  1GLE G;  1TYQ B;  4M7X A;  4OPA A;  3MWT A;  3ZEU A;  4C23 A;  3WXM B;  3FZL A;  3L3O M;  1W9M A;  2ZJQ L;  5AQU A;  1DKZ A;  4CJ7 A;  5AFU A;  3A8Y A;  5FPD A;  3DPO A;  3UB5 A;  4F9O A;  1EQY A;  3MK6 A;  2A6A A;  3VEA A;  4FWP A;  3M3Z A;  5JVG L;  1T6D A;  4H6I A;  4BR2 A;  5H1S Q;  2WFB A;  3EE9 A;  2NRR A;  2ASO A;  3N8E A;  2BUP A;  1YAG A;  1ATN A;  4K42 A;  2WBN A;  1E1D A;  3FGU A;  3SAH A;  3DQG A;  4EHT A;  3HOT A;  3I8B A;  3FLC O;  1VQM N;  4FM3 A;  4EAH D;  4UDX X;  3G71 N;  3C65 A;  1TYQ A;  1NGJ A;  4NLC A;  4EZO A;  1HLU A;  1NGB A;  2PBD A;  1BG3 A;  3O4W A;  2E2Q A;  1S3X A;  3GBT A;  5ADX H;  2V7Y A;  4BQZ A;  5JMV A;  2VYP A;  3RV0 A;  4H0X B;  2E2P A;  3VER A;  3VET A;  3TSU A;  4EIA A;  1NGE A;  4H0T B;  4BQL A;  4H5N A;  3VPZ A;  5F1X A;  3CCE N;  1OKJ A;  2KHO A;  3DXM A;  3O9U A;  1K73 O;  4BEC A;  4BE7 B;  4O8K A;  2CH6 A;  3CJB A;  2D1K A;  4FWK A;  4JKC A;  4BRD A;  4K43 A;  3I39 X;  5E84 A;  3DXK A;  1W97 L;  5AQP A;  3FZK A;  4JKH A;  2CGJ A;  3M5R A;  1YF5 L;  4MDB A;  1KAY A;  3FR0 A;  3KAV A;  3L4Q A;  4FPB A;  4EFH A;  4PO2 A;  1CKR A;  2YCH A;  3O08 A;  1NBW A;  3FZF A;  3G4S N;  4JNF A;  2OAN A;  1JCE A;  3F5T A;  4JKF A;  3T47 A;  2Q1N A;  1C0F A;  5FPM A;  5M1F A;  2P9I B;  4EZN A;  4A5A A;  3MN5 A;  3BEX A;  4FVU A;  3E66 A;  4B1W B;  5GIN A;  3SMS A;  3FE1 A;  4JWI A;  3KWI A;  5GAG P;  3CXC M;  4I43 A;  2F9T A;  1KD1 O;  3CQX A;  1DG4 A;  1GLL O;  2P9S A;  2D0O A;  4EZW A;  1JCF A;  2A41 A;  4ILJ A;  2QWR A;  3CET A;  3LM9 A;  5AQW A;  3ZEF A;  3DWL A;  3G25 A;  3MMV A;  3ENO A;  4BVO A;  3DLL L;  2CGL A;  4CBX A;  2P9L A;  1SUF A;  3O9Q A;  2YHW A;  3KZB A;  5BPM A;  5DM6 L;  2W40 A;  4JNE A;  4A61 A;  4PHT X;  3Q7C A;  1G99 A;  3ER8 C;  1VQP N;  1SZ2 A;  2H3G X;  2P9I A;  4FWR A;  5KPR A;  4DKW A;  4EZS A;  1H1V A;  2GUP A;  2DPN A;  3J8A A;  3I04 A;  1WOQ A;  1BDG A;  4FWL A;  4FPA A;  5AZJ B;  4JWD A;  2BTF A;  2F9W A;  1NGD A;  5AQV A;  1OVY A;  4YDU C;  4JWC A;  3W0L A;  3E9P A;  5JLH A;  5KQ8 A;  4AF1 A;  3HI0 A;  3WEE B;  2P9P B;  4U7B A;  4ILH B;  4EHU A;  2YIA A;  5AQM A;  1QVF M;  4BRG A;  4RCH A;  3ZET B;  4JKE A;  4CZH A;  2HF3 A;  2E2O A;  4ILG B;  2GWK A;  4IO8 A;  1P8Z A;  3B53 X;  3FD9 A;  5AQZ A;  3RVC A;  4AM6 A;  4XH4 A;  2WIN M;  1JQK A;  3EN9 A;  1BOT O;  3CME N;  4CZF A;  1VQ5 N;  3AAQ A;  5AQY A;  2I7N A;  4JD2 B;  5FPE A;  4FWS A;  5JLF A;  1NJI O;  4QS7 A;  4E1J A;  3T7Z A;  5BR9 A;  1BPR A;  3CCJ N;  4E81 A;  4ISG A;  4XJX A;  3CQY A;  5C2D A;  3AAP A;  1LOT B;  3D2F B;  3VES A;  5AZI B;  3R6M A;  2P9N A;  5JIC A;  4BRF A;  4IW0 A;  5F2R A;  3B52 X;  5I9E B;  3KAW A;  4CBU A;  3K9J A;  3RSE B;  4EZY A;  2FXU A;  3TPQ A;  4ILH A;  4R5J A;  4BC2 A;  5ADX A;  4IWV A;  3GI7 A;  4YOW A;  2A40 A;  3BP8 A;  1Z05 A;  1T44 A;  3CJ1 A;  3EL2 A;  5EY4 A;  3ZET A;  2Q36 A;  1XQS C;  2HF4 A;  4GV9 A;  1U6Z A;  4HY9 A;  4YOU A;  5GIP A;  4FSV A;  3CC4 N;  2JNS A;  3GOI A;  1VQL N;  4BY9 C;  4D8J A;  4CZG A;  1K9M O;  5M1Q A;  3H1Q A;  4MO4 A;  1Q82 O;  2ND1 A;  3OHX M;  2A5X A;  3LL3 A;  3P31 A;  5TKW A;  3LDQ A;  3LDO A;  3A5O C;  4CI6 A;  5BN8 A;  1YJ9 N;  1Q7Y O;  5AQS A;  1VQ9 N;  2P9U A;  3A0I X;  3EKU A;  5AQT A;  3A5L C;  4E3C A;  4C1N K;  4YOT A;  1YVN A;  5KPT A;  4R5L A;  3K9K A;  3D2F A;  5LJV A;  3SJH A;  4A57 A;  3UKU B;  5TKY A;  5AQJ A;  4JK8 A;  3L0Q A;  3WQT A;  3CJA A;  3C6H A;  2YHY A;  3MN6 A;  4H0V B;  4IJN A;  4IOX A;  4M7Y A;  2QA4 N;  2YJE A;  4H5T A;  1ATS A;  3DJC A;  3MX5 A;  3VF2 A;  2QWQ A;  1DGK N;  3O9R A;  4UDY X;  2ZF5 O;  2NRV A;  3SBG A;  1Q5L A;  3TTF A;  4WQ4 A;  3HSC A;  4H5R A;  2QW9 A;  2HST A;  3CCR N;  1K8K B;  2YHX A;  4WFB L;  2HBL A;  1KAX A;  2V52 B;  3BUZ B;  3MX2 A;  4M63 C;  4CZK A;  1X3M A;  5AQN A;  1NMD A;  4H0Y B;  2Q0R A;  3PLA A;  1OA0 A;  5GAE P;  3VEY A;  3SLC A;  5KQD A;  4R5I A;  4IEI A;  2NCZ A;  3UE5 A;  4GY2 B;  2GWJ A;  2HBM A;  4IWO A;  2QWP A;  3W3D A;  2YX6 A;  3ID8 A;  4PL8 A;  3QIC A;  1BU6 O;  4B1U B;  5AR0 A;  2E20 A;  3O9S A;  1X3N A;  2YJF A;  3WXK A;  3VEX A;  3ID6 A;  4BR0 A;  2LM0 A;  3D2E B;  3KWG A;  1YXQ A;  3H45 C;  2BH1 A;  4QS9 A;  1NGC A;  1R59 O;  2ASP A;  2FSJ A;  1K8K A;  1ZXO A;  5EOY A;  4BR7 A;  3CC2 N;  3GL1 A;  4DB3 A;  4B1V A;  2OTJ N;  2JWK A;  3CHW A;  2NRH A;  3WT0 A;  4A2A A;  4JWE A;  5C2F A;  3CCL N;  3A5N C;  3C6A A;  3S41 A;  3AAR A;  3SAG A;  4JN4 A;  4CZM A;  4EZP A;  3CCU N;  2E88 A;  1NGI A;  4DCH A;  3VEO A;  4G6Q A;  4BGA A;  3OA9 A;  4A62 A;  1IJJ A;  2EWS A;  1MWK A;  3EKS A;  2C1G A;  4DHY A;  1EO1 A;  4LC9 B;  4B9Q A;  3BF3 A;  1GLF O;  3R1X A;  4RTF D;  4EZT A;  4BG8 A;  2RHK A;  4NLB A;  4K25 A;  1ZYL A;  1HUX A;  4JK9 A;  5ELZ A;  2I7P A;  3ATU A;  3VEZ A;  3CCQ N;  2GEL A;  3HOS A;  2QWO A;  4O5F A;  3D2E A;  3MWP A;  3CIP A;  4FWN A;  4J8F A;  2D4W A;  4BRA A;  5CHI A;  3EO3 A;  4MLE A;  4KH4 A;  1NWK A;  2QXL A;  5AQI A;  2PAV A;  2N3K A;  3H1V X;  2VGM A;  3QB0 A;  4JKA A;  3MCP A;  4WYB A;  4C1N I;  2W00 A;  4M0M A;  3RV1 A;  1QQO A;  4IXC A;  2E8A A;  1VQ6 N;  1SS6 A;  4GNI A;  3VOV A;  5BRF A;  3CMA N;  5KPZ A;  2ZJP L;  4EZQ A;  1TUU A;  3LDL A;  2YIV X;  5LY3 A;  5BRD A;  4JKG B;  1NGG A;  4ILI A;  2VWB A;  3A5M C;  2P9K B;  2RE2 A;  4BC3 A;  1RFQ A;  3HTV A;  2FF6 A;  1OA1 A;  4F00 A;  1DT9 A;  5JVH L;  1VQ4 N;  4KBO A;  3NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...