4JNEA

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Hsp70 CHAPERONE DnaK
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jneA05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jneA04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jneA03
3L0QA 3T46A 2HF3A 2CGLA 3A5MC 3WT0A 2QWRA 2WUSA 1MA9B 5F1XA 3D2FA 1SQKA 2OP6A 2E1ZA 2NRHA 4K42A 1BG3A 3I33A 3RSEB 3AAPA 1NBWA 3VEZA 4DCHA 4LC9B 5AZIA 1DKGD 1BDGA 3ENOA 2P9UA 3MN5A 3CJ7A 4BRDA 1JCGA 1GLDG 3H46O 4CZJA 4BRFA 5FPDA 2A40A 3VEXA 3KHYA 1T44A 4K41A 4BRGA 3GDQA 5EX5A 4IJNA 4EZTA 2GTDA 3CJBA 4H5RA 4JD2B 2PBDA 1WUAA 2E2OA 2ASMA 4BRAA 2YJEA 2P9UB 3DXMB 4BR9A 4NO7A 1NGCA 1S3XA 3O1BA 1CKRA 5BREA 5AQQA 2VCPA 1ATSA 3VPZA 3QFUA 1BO5O 4BC5A 4F00A 3L4IA 2IVOA 1NGAA 2QWMA 2QWPA 3VERA 4EZOA 3CJ1A 4PKIA 4BGBA 4EZQA 4CZMA 4H0XB 2V7ZA 1YVNA 5AQJA 5AQYA 4B1YB 4ISFA 4CD3A 3FLCO 5EY4A 1RGIA 3CQYA 5AZJA 1NGDA 3DQGA 2FLOA 1GLEG 4ISGA 5AQVA 4HWIA 3VEOA 4BC2A 1Z6RA 1QQOA 3CI5A 3MCPA 5AZJB 4BG9A 4CZGA 2GELA 2GUPA 3VF2A 3FZMA 3WXIA 1JCFA 4BRIA 3FFKB 2E88A 2YHXA 2E20A 3O80A 3FGUA 4EZZA 3EKSA 1BA1A 4H0OA 3UE5A 3GOIA 4R5GA 3ZETA 5FPEA 4EZRA 3BP8A 4EFHA 2E2NA 2QWQA 2CGKA 1R59O 4IWVA 5B8HA 5F0XA 2FSNA 4FOIA 2ZGZA 4QS9A 2H3GX 4R5IA 4FO0A 3WUHA 3IUCA 4M7XA 3W0LA 4BQZA 5AQSA 3VETA 3N8EA 2D1KA 3QFPA 3DXMA 4ISEA 1SAZA 3O6WA 3WXKA 3LM9A 3M3ZA 4BR2A 1MDUB 4JHDA 5EOYA 1HKCA 4CZIA 3DPPA 4MO5A 3LDOA 5AQMA 3IFRA 2P9KA 2YHYA 4CZFA 4EZSA 2FXUA 5AZIB 3WQUA 3C7NA 1QQMA 3FZFA 4BR5A 3QB0A 5KPZA 3OHXM 4J8FA 3T49A 1NWKA 3GBTA 3LDNA 3WEEB 1C0GA 1NGGA 3GG4A 3WXJA 3SK3A 1NGFA 3M1FA 4Y0WA 4EZUA 3SMSA 3T47A 3VEYA 4JWCA 3O8MA 3ZX0A 4WQ5C 1U00A 1DKYA 3ZX3A 2QW9A 4FWQA 4CJ7A 2A41A 4EHTA 3B8AX 3CQXA 3LDPA 4RTFD 2BPRA 4L3QA 4MLEA 4A61A 4BGAA 3DPOA 4H0VB 2P9NB 3KZBA 4XH1A 4FWSA 4FWOA 4H6HA 3EO3A 4R5JA 4FPAA 3H1VX 1NGIA 1QZ5A 1GLCG 3T48A 3MK6A 1SZ2A 3F9MA 4XH5A 3U4LA 5FPNA 3UKUB 3VGMA 2D0OA 1XQSC 3DOBA 5AQPA 2HF4A 3HM8A 2AA4A 4CZEA 1T6DA 3FE1A 5LJVA 4GNIA 3H6EA 4CZLA 1YAGA 4BRMA 1X9JA 2BUPA 1Q5LA 4FWRA 1ATRA 3U8XA 1QHAA 4BRLA 4CBWA 1HPMA 2NLXA 2D0PA 4KBOA 4F01A 3O1WA 1MWMA 2UYTA 1KAXA 3O5BA 4QS8A 3U9ZA 5BRFA 2W40A 2IVNA 3H0XA 3VEWA 1QQNA 2AP1A 5AR0A 2KHOA 4E81A 5ADXH 2PAVA 1IG8A 3GE1A 1Q18A 2P9IB 1Z05A 2P9LB 4DQ8A 1GLBG 1P8ZA 2VWBA 4BC4A 4PL8A 4EZXA 4B1WB 4JNFA 4JAXA 2WINM 1IJJA 1NM1A 4EZWA 4BRKA 4CD1A 3LDLA 4BROA 2P9KB 3H1QA 4B1VA 4BRCA 5BPMA 3AAQA 5E84A 4JHDB 4PKGA 1T6CA 4AM6A 2V51B 5AQFA 4PL7A 3EL2A 4GY2B 4EIAA 4YDUA 4H6IA 3ZEUA 4R5LA 3L3OM 3CJ9A 3DXKB 2A42A 3ATUA 1ZC6A 4CZKA 4O8KA 2Q31A 1HJOA 3HTVA 3CJAA 3ZETB 1XC3A 1ATNA 1XUPO 3UB5A 4PKHA 1E4FT 4HYBA 3BF3A 3LM2A 4I6MA 3ENHA 5F2RA 3VESA 2I7PA 1BPRA 4E1JA 3ATVA 3BEXA 3T4AG 2Q97A 5BRDA 4BVPA 3DPQA 3BF1A 2NZTA 1BU6O 1NLVA 3O4WA 1U2VA 3KVGA 5BN8A 2IVPA 4CZHA 4JNEA 1E4GT 4EHUA 2BTFA 3QBXA 3ZX2A 2QWNA 4B1ZA 2DPNA 3SLCA 4BR4A 5JMVA 4H5VA 1HX1A 5KQDA 5ELZA 4MLHA 4WV7A 4IJAA 4B9QA 4B1UB 2YJFA 4FWMA 1V4TA 3R6MA 3HSCA 2QWOA 1KXPA 1U2VB 3VGLA 2ASOA 4HTLA 4DHYA 2P9PB 1NGHA 4WYBA 2CH5A 3MN9A 3ULEA 3MN6A 2Q2RA 2YI1A 5AQNA 1BWFO 3ID8A 3TU5A 5E26A 3WQTA 3QBWA 2P9SA 2Q0UA 3A5LC 3O08A 3QDKA 3QICA 4H03B 3DJCA 3A5OC 3MMVA 1KAYA 4NB4A 4YDUC 5AQTA 5BPNA 3D2FB 3DXKA 4K43A 3ZEUB 4BREA 5AQRA 4JD2A 3VF6A 2P9SB 1GLAG 1NGEA 2ASPA 2Q0RA 3QMLA 5AQZA 1YUWA 4CBXA 5LY3A 3ULEB 5AFUA 4XEIA 3MN7A 4FWPA 5JLHA 2P9PA 3HZ6A 4EZVA 4A2AA 2A6AA 5KQ8A 1TYQA 3RSEA 5I9EB 2F9WA 5AQOA 1J6ZA 4FL9A 3VENA 1K8KB 3W3DA 4FOEA 4H0TB 1LCUA 4FWLA 2E8AA 3EZWA 4C23A 2VYPA 2I7NA 2P9IA 1DKZA 4H5WA 4RCHA 5BN9A 4BRQA 4H0YB 3D2EA 1HLUA 3CETA 4F9OA 1X3NA 2A3ZA 5CE3A 1GLFO 3VGKA 3FZLA 1LOTB 4BG8A 2ZGYA 3BUZB 3DWLA 4WQ4A 1OKJA 1S22A 4H0PA 5AFUH 2HMPA 3GL1A 2E1YA 4MO4A 3CERA 3L6QA 1DGKN 4I6MB 4IZ9A 2GEMA 4FSVA 5LJWA 5AQIA 5KPRA 2D4WA 3P4IA 4H5TA 5AQXA 2ZWHA 3JXUA 3SMPA 3S41A 2CH6A 3HBTA 4M63C 4EZNA 1JCEA 2Q1NA 2QM1A 4PO2A 1TUYA 4K25A 4FPBA 3QNJA 3AY9A 2FF6A 3UKRB 4B1XB 2A5XA 1WOQA 4BRPA 2QXLA 2EWSA 4EAHD 2P9NA 5AQWA 4A2BA 2E2PA 1HUXA 4O5FA 1C0FA 5AQUA 3H3NO 5ADXA 2OANA 4BR0A 4H5NA 2V52B 2HOEA 2FSJA 2GWJA 2ITMA 1NMDA 4BRHA 3LL3A 1U6ZA 3WXLA 5JLFA 2Q36A 1MWKA 2F9TA 1DEJA 1NGJA 1TUUA 3CHWA 3FR0A 3G25A 3A5NC 1G99A 3J8AA 5EVZA 3R9PA 5BR9A 1BOTO 4RWTA 4EZPA 5AQKA 4A62A 2IIRA 3A8YA 1KAZA 5TKYA 3WEEA 1DG4A 3CIPA 4QS7A 1ZXOA 3C7NB 4CI6A 2W41A 3OHRA 2P9LA 1HKBA 4WQ4C 4BC3A 4IO8A 1BUPA 3FZKA 4JWIA 3C0BA 3I8BA 5JICA 3DAWA 4WV5A 3JS6A 3TPQA 3MDQA 3AARA 1Y64A 4WQ5A 2FF3B 3EKUA 5AQLA 5AQHA 4FWKA 1QZ6A 5FPMA 3IDHA 7HSCA 4BRNA 4R5KA 2E2QA 1NGBA 4XH4A 1CZAN 4HY9A 1DKXA 4CBUA 1X3MA 3EN9A 4FWNA 1HKGA 3UKRA 4BR7A 4JWDA 4DB3A 3D2EB 3IMXA 1BA0A 3H45C 3U9DA 2QFFA 4BQLA 3D7EO 2QWLA 1ZBSA 1GLJO 1V4SA 5KPTA 1K8KA 4JN4A 1RFQA 4BVOA 3UKUA 3SJHA 3FZHA 5BRHA 3CJCA 1YXQA 3H3OB 2ZF5O 1GLLO 1D4XA 1TYQB 1RDWX 3HI0A 2YCHA 2V7YA 3R8EA 3LDQA 4AM7A 3M6GA 2FSKA 2GWKA 3VOVA 2CGJA 3VEVA 2YHWA 4IXCA 1EQYA 4EZYA 4M7YA 4Z94A 5EXWA 2J4RA 1H1VA 5AQGA 4JWEA 3A0IX 1ESVA 3VF4A 5BPLA
chains in the Genus database with same CATH superfamily
3DX3A 3L0QA 3NF8A 3ID6A 2CGLA 3B52X 1OH8A 1DLOA 4B3MK 3VQQA 4Z4CA 5FIGA 5FRMA 3OYIA 3A2FA 3I33A 3VEZA 1BIZA 3CAZA 5HL7L 4IM2A 3CJ7A 4BRDA 1SKSA 3H46O 3CCQN 1KVAA 2YNHA 3DMJA 3KHYA 4FM1A 4IFYA 4E0DA 4FZZA 5DMRA 3ACOA 1LQ7A 3C95A 1VQMN 4EZTA 3V9WA 4CHYA 4FLTA 4KHWA 3DLEA 1VQKN 3DXMB 3MCAB 3N4QA 1ZBIA 1XMOK 4CHZA 3S5TA 4HR1A 1CKRA 5AQQA 4OPJA 3L2QA 1WSJA 3VPZA 3ASMA 4BC5A 2HBJA 3P39A 4BDYA 5HRNA 4IEEA 3OY9A 1LWFA 1S1UA 2QWPA 3KK1A 4EZOA 1RT2A 5FLXO 1JLFA 3RWUA 2F8SA 4H0XB 5AQYA 1RNHA 4DYLA 3FLCO 3TR8A 3THXA 1JJ2M 3HT3A 1NGDA 2O8FB 1KVCA 3ER9B 3MCPA 3ZT4A 4CFDA 2GELA 5C2FA 2JWKA 1XHXA 2E88A 2YHXA 4JKBA 4FW1A 3EKSA 1BA1A 4CJQA 3GOIA 4R5GA 1J9AA 4C8NA 5FPEA 4EFHA 2Y1JA 4ILGA 2CGKA 4FJLA 1HPZA 4FOIA 1HQEA 2WFBA 5LMUK 2H3GX 3CM5A 4FO0A 1M90O 2HVHA 3D6RA 1QSLA 1TQTA 2D1KA 3CCVN 2FC0A 4ISEA 3DXMA 1SAZA 3O6WA 3LAKA 3V1RA 1UA0A 3WXKA 4OO1J 3BLBA 4AKVA 4BR2A 4DR2K 3S3OA 5IWAK 1NJYA 3CQ8A 3ITHA 4J2BA 1HKCA 3DPPA 4MO5A 3LDOA 4ILJA 3VA0A 4DQQA 4JI4K 3KLFA 4CZFA 2DFHA 2VWJA 1SL0A 3WQUA 3L2VA 1W9HA 3T49A 3T7ZA 3GBTA 3WEEB 1C0GA 4DQPA 1NKCA 2VG6A 3QINA 3ZSZA 2PFUA 3PUFA 4JLHA 3TAQA 2BH1A 3TWHA 4Y0WA 3SQ2A 3T47A 3VEYA 2ZQBA 3LP3A 3LWMA 3B6PA 3NE6A 3C94A 3MEEA 3B8AX 4LF9K 4JS5A 4MLEA 4D8JA 3S3MA 4W5QA 2P9NB 4B3TK 5H1SQ 4YOXA 3LP0A 1Q8IA 3V6DA 4FWOA 3EO3A 5JS2A 5GADP 1U45A 3BUDA 4XH5A 4N41A 3RRGA 2VQFK 4JEPA 3VGMA 2D0OA 2ALWA 1RT4A 3DOBA 1KRPA 4RW6A 5GIPA 3SQ0A 3HM8A 3CMAN 3FE1A 1KD1O 1SL2A 3T1YK 1O7DC 3U8XA 3U3YA 1VQ4N 2NLXA 4JKHA 4WFNL 1TQUA 4DF8A 2AP1A 3O9RA 2PYJA 1ASVA 2F18A 4E81A 3HPGA 5IT9O 1IG8A 3ZSVA 2P9IB 2F4VK 5M1QA 1GLBG 1P8ZA 4AHSA 4AZ7A 2RE2A 1VQ6N 3NF9A 1VSIA 4X65K 4B1WB 4JNFA 3LZJA 3KKRA 2WINM 5HRRA 1IJJA 4DU4A 3G10A 4BRKA 3RR8A 1VQNN 4CD1A 4IEIA 3AVMA 4E7JA 2P9KB 2YIBA 2XHBA 2NUBA 1HRHA 4BRCA 1LV5A 4CJKA 4BWMA 4PKGA 4Q0BA 1T6CA 1VSDA 5AQFA 2HNYA 4GY2B 1Q9YA 4EIAA 1KFDA 4BE1A 3THVA 4GV9A 1TVRA 3E9PA 4J2DA 3CJ9A 3TTDA 4CZKA 4O8KA 1SKWA 5FROA 1WSFA 2Q31A 4HUFA 1T7PA 1HJOA 1D5AA 3IS9A 4CK3A 4DSFA 3KD5E 1REVA 2OPSA 3L2WA 3RTVA 3VESA 3P83D 3ENHA 5AJ3K 3TAEA 1NK9A 1BPRA 2YV0X 1ZYLA 4CHQA 1VSHA 2HB5A 2HHXA 2HNDA 2JWLA 5BRDA 4BVPA 2IVPA 4CZHA 4IFVA 4B1ZA 1HNWK 5C12A 4H5VA 3K58A 5FRNA 2X3XA 4W5OA 1VSKA 4IJAA 4B9QA 1IBKK 3OA9A 4B1UB 2YJFA 2GUIA 4FWMA 1DTTA 1RILA 2BANA 4KRFA 4EP5A 3R6MA 3HSCA 4YOWA 3NH2A 2WTUA 3TAPA 4HTLA 3KD1E 2P9PB 4DFJA 4JLCA 3E66A 1C0UA 3TI0A 1IKWA 4NXNK 1R34A 4E7HA 4DSEA 2P9SA 2Q0UA 3J80O 4H03B 4ILHA 3DJCA 2YI9A 3BVWA 3MMVA 3NDKA 2B5JA 4CERA 3HAHA 4F2RA 3UIQA 3DXKA 4AZBA 5KRSA 4JD2A 2IC3A 2F1BA 3OTOK 1TQSA 2Y1IA 1GLAG 5AQZA 1Y2OA 1S1VA 3RPMA 4DV4K 3P31A 4O0IA 4FWPA 5JLHA 3I0RA 3RV0A 1IG9A 4FJNA 1TYQA 2F9WA 5AQOA 3OYCA 3THWA 1VSJA 3AVKA 1J6ZA 5M1FA 4FL9A 3VENA 3DLBA 4B9UA 3CC7N 4XJXA 3LLLA 2ND0A 3VQBA 1WSHA 2GV9A 4JKEA 2P9IA 4JI0K 3VKHA 1CXUA 3CETA 3E9LA 1Z26A 2P5OA 1NOYA 1I49A 2PMRA 4LFAK 1LOTB 3KKSA 3OBWA 1VQPN 3F2KA 1EETA 3NFAA 1L3VA 2HHVA 1W7AA 4C8LA 2GX9A 4WQ4A 4CJ3A 4Z4IA 1OKJA 5AFUH 3D51A 3VTIA 3GL1A 2E1YA 1HNXK 3O3GA 3QERA 4MO4A 3LMFA 3CERA 5FLEX 3L4QA 3KLHA 2IOCA 4O5BA 2D4WA 1RTJA 2RT6A 2ZWHA 1J5OA 1YITN 4HTUA 3S41A 2CH6A 3HBTA 4M63C 3CPWM 1IBMK 3LAMA 3SOGA 4DV5K 3Q7CA 3QNNA 4B1XB 2UXCK 1WOQA 4O0JA 4CEDA 2EWSA 2P9NA 5AQWA 4QOZB 1VK0A 4FK4A 4O5FA 1C0FA 4FJ9A 1J5EK 4PHTX 2UUAK 2HOEA 1BISA 2GWJA 1WDZA 3LL3A 2OZSA 3KWIA 2D0AA 4G1QA 4CEOA 4N47A 2YLLA 1MWKA 3CHWA 2F9TA 3R9PA 4DV7K 1ILYA 5EVZA 1NKEA 4EZPA 1EXQA 2IS3A 3PY8A 4JS4A 3A8YA 2F7OA 4RW8A 1ZBHA 4LFCK 3CIPA 4QS7A 3C7NB 4CI6A 3FD9A 1VSMA 3BUQA 1VQ5N 3ZSWA 4E3CA 1C1CA 2VGNA 3I0SA 4IO8A 3AVFA 3FZKA 1MU2A 1RBRA 3T3FA 1NJWA 3HVRA 3SPZA 3HAIA 3AARA 4IWPA 4OGCA 1NGBA 4B8CA 1E1DA 4FWNA 4PA1A 1Z25A 1HKGA 3OYAA 1N32K 1JLBA 3H45C 4BQLA 1BI4B 1GLJO 1FW6A 3PLAA 1KFSA 3WNEA 4F3OA 3I01A 4JN4A 4BVOA 3CCMN 3UKUA 1K73O 3SJHA 4BEBA 1GN9A 5GAGP 3H3OB 1YXQA 2ZF5O 1GLLO 1NJXA 4Z4GA 1RDWX 1TKZA 2GA9D 1TKXA 1KTQA 2V7YA 3R8EA 4ELVA 4WCEL 3VOVA 2FSKA 2GWKA 1UAXA 3K0SA 3SNNA 3AO4A 3NVKA 1N6QA 1IKVA 4FLZA 3AA4A 1VSEA 1W9MA 2X5CA 1QHTA 1IH7A 5CR4A 1BCOA 3OYBA 5LMNK 1OA1A 3ZT0A 4LF7K 3NMUA 2HHSA 4CJ4A 3ZSQA 3T46A 2HF3A 2D0BA 3A5MC 2OW6A 3WT0A 1MA9B 3TSPA 3CYGA 4CEAA 4K42A 4CF9A 5BR8K 5KGWA 3AA2A 4H4OA 3RSEB 4DCHA 5AZIA 3AVJA 2QKWA 2FBVA 2P9UA 3ENOA 3MN5A 2YX6A 4AZ6A 4CJUA 1OAOA 2FBYA 4PUOA 4AZHA 1T44A 4BRGA 1TAQA 1W97L 4B3OA 1NNEA 4H5RA 4TSXA 4JD2B 3RVCA 2P9UB 3CC4N 4DFMA 4V19S 5JVGL 4NO7A 1NGCA 1S3XA 5BREA 2IAJA 4WFBL 3M8RA 1WBDA 4FJJA 1KC8O 3QFUA 1BO5O 3DRRA 1CXQA 4KH6A 3VERA 5DK5A 2P1JA 3DOKA 4BGBA 2YL6A 3AO5A 3OS2A 4ISFA 4CD3A 4KI4A 3OJSA 3CQYA 4KB0A 2FLOA 5AQVA 3VEOA 4HWIA 3ZSYA 1A5XA 3CI5A 5AZJB 4FM2A 3O9TA 1FK9A 2BDPA 3FZMA 4ID1A 3WXIA 1JCFA 3FFKB 1KLNA 1QX1A 2E20A 4CGFA 3FGUA 1I3AA 5MLCQ 2DFEA 3ZETA 2XY8A 2E2NA 1GOBA 2QWQA 3O9QA 4IWVA 5F0XA 3WNHA 4FZXC 1B92A 1LW2A 4UDYX 2Z1JA 4IDHA 3IUCA 1YT3A 4BQZA 5AQSA 4Y1DA 4X66K 4YY3K 3CCLN 3VETA 3N8EA 5J2MA 3QIOA 3VQ7A 3QFPA 4FLUA 2HHQA 3SV3A 2O8BB 3M3ZA 4IOCL 1RCHA 5C10A 1I39A 4YORA 2FBXA 4YFUA 3CV5A 1VQLN 1TKTA 4N5SA 3BZKA 5EOYA 2W6LA 3O9UA 4AZIA 4YNQA 1NK8A 1RTDA 3IFRA 1TK8A 4DQIA 4EZSA 2NRXA 4DSLA 3C7NA 3ZYYX 4MQDA 2OTLN 1NGGA 3O3NB 2PYLA 3OJUA 1N34K 4JI8K 3D52A 4LH5A 2DTUA 4LF5K 3OYEA 3VN5A 3M1FA 4M3TA 2HHIA 3AO2A 4IG3A 4JWCA 3O8MA 4BE0A 3QLHA 4WQ5C 1T03A 3ZX3A 1U47A 4YOVA 3KK2A 4I1QA 4RTFD 3VQ9A 4OGEA 4L3QA 4A61A 4E3SA 3MEDA 4E1MA 1WSGA 4FJ7A 3CZNA 3SYZA 3C6AA 1C0MA 4H6HA 3OWGA 1I4LA 1JL2A 3MK6A 1SZ2A 3F9MA 5FPNA 2ETJA 4CJWA 2KFZA 1O7DB 1XQSC 3LANA 1WN7A 1J53A 2EX3A 3H6EA 4IO9L 1YAGA 3CC2N 4DWIA 4CBWA 4DR1K 2HBLA 2D0PA 3O3FA 4F01A 3O1WA 4WFAL 3O5BA 1QE1A 4QS8A 5BRFA 2W40A 1HMVA 3H0XA 2G8VA 4GW6A 4DTMA 1S6QA 2PAVA 3QETA 3VQPA 1C6VA 4EZ9A 3KLGA 1YIJN 1YJWN 4E19A 4KH4A 2Z1GA 4DQ8A 3MXJA 3SBTB 1YTAA 4BC4A 3CVRA 4JAXA 4H8KA 2JNSA 3ZSRA 3TARA 1PS3A 3MXMA 3SPYA 3L2UA 4WPEA 2Q3SA 1XI1A 4K8ZA 3H1QA 2RAJA 5BPMA 4DSIA 4B9MA 3SZ2A 1RTHA 4FLXA 2V51B 3DDFA 4CGIA 2YLAA 3ISNC 1XMQK 3K5OA 1EWQA 4YDUA 3V9UA 4H6IA 3S9HA 1BQNA 1L3SA 3DXKB 3ATUA 1ZC6A 3ZLJA 4MQ3A 3L8BA 3DRPA 2VG7A 4BY9C 1IO2A 4DSKA 4ELTA 3B51X 3HTVA 3MEGA 4FM0A 1UOCA 3CJAA 4BE7B 3ZETB 4B3RK 4DTUA 4PKHA 1QSSA 1E4FT 3C6HA 5F2RA 4I6MA 4CJPA 1LAVA 1WAFA 1X04A 2I7PA 4E1JA 1JXBA 1EWRA 2QTDA 4RW7A 3BEXA 4FJKA 3AO1A 3T4AG 4Z4FA 4NCBA 1KQSM 3MECA 4JV5K 1BQMA 3AVBA 3O4WA 4WF9L 1KVBA 4AHCA 1YWMA 2UU9K 4KHSA 3ULDA 4CFCA 1B9FA 3C6UA 3ZX2A 4OLBA 4F2SA 3CCEN 4ILGB 3H08A 4CJ5A 2YIVX 2HBMA 1ZBLA 1DTQA 3LP1A 3CFRA 2QWOA 1U2VB 4DHYA 1WNSA 3S3NA 3BDPA 1SUQA 4WYBA 1VSFA 1BIUA 2CH5A 3MN9A 4EP4A 4JRQA 3ULEA 1RT6A 3MN6A 3B53X 2VQEK 1ITGA 4AHVA 2BGGA 4OJRA 3L3PA 3BGRA 5JENA 3SUPA 1QSYA 3TU5A 3WQTA 5E26A 3QBWA 3QDKA 4MDBA 3QICA 3A5OC 4KFBA 3HL8A 3I2WA 1KAYA 4NB4A 4DV0K 1JKHA 1ZWWA 3VQDA 3D2FB 2QI2A 4IDKA 4K43A 1DT9A 4L8RB 1Y97A 4RW4A 1SV5A 1E2UA 5T7BA 1GOAA 5HOOA 1NGEA 3QMLA 1YUWA 2VGMA 5J1EA 4CBXA 4FVUA 3MN7A 4DTJA 1S1TA 3EYZA 2HW3A 1C1AA 3I39X 4AVMA 3HZ6A 2ZJRL 4FCYA 2E6MA 4B08A 3F7WA 2A6AA 5KQ8A 3RSEA 1RT7A 1NK0A 4DV3K 3SV4A 5CY4A 4FLYA 4OKKA 3JAMO 3QEVA 1S72N 4FOEA 4H0TB 2O0I1 3PSIA 5C42A 3EZWA 4C23A 2X6NA 2I7NA 4RCHA 1DKZA 4UQGA 1ASWA 5BN9A 3CXCM 1K8AO 4H0YB 3M8PA 4F4KA 4F9OA 2ZE2A 2A3ZA 5CE3A 4F3TA 1GLFO 1F21A 4O44A 4J2EA 2HHUA 4W5RA 2O8EB 4A5BA 4Z4HA 1K6YA 3K5NA 5J2NA 4O8UA 1YVUA 1S22A 2VG5A 2YNFA 3HRGA 1TL3A 4KIKB 2HMPA 2Z1HA 3E01A 3IKMA 4KHQA 4IZ9A 1L3TA 4FSVA 3VQCA 4CF1A 3P4IA 4H5TA 2F7PA 1WSEA 2HNZA 3AGRA 4CGHA 4EZNA 1JCEA 2Q1NA 4CJTA 2IDOA 2QM1A 4PO2A 2Z0VA 1U4BA 4OPKA 1WSIA 4U67L 2RKIA 4E1NA 4RG8A 1UWBA 4FJMA 4BRPA 4EAHD 3OYKA 4FLVA 2FYVA 4KI6A 5GAEP 3HOTA 5ADXA 3H3NO 2OANA 4ZTFA 4H5NA 2W00A 2V52B 3T1HK 2O8CB 2ITMA 4BRHA 2XY5A 1URUA 1XHZA 1NG9A 3ALYA 4OVLA 5CZ2A 3WXLA 3QO9A 3G25A 2KLAA 3FR0A 1RBTA 4RWTA 2YL8A 4CJSA 1SS6A 2X3WA 3WEEA 3TAGA 5CYMA 3D0PA 4LY7A 2RAKA 1TV6A 2E4LA 3O3MB 4WQ4C 3O3HA 4WV5A 3TPQA 3MDQA 1Y64A 2FF3B 5AQHA 4FWKA 4KIKA 1NKBA 2DY4A 7HSCA 4R5KA 4LF6K 4XH4A 3T69A 1HWWA 1DKXA 1X3MA 2O8EA 3K5LA 4AZGA 3L3UA 2OZMA 3VQ6A 4BR7A 4JWDA 3OW2M 3AA5X 3DX1A 4B9LA 2YL5A 1BA0A 2QXFA 4BWJA 3U9DA 2QFFA 4FLWA 3ER8C 4GVEA 4O55A 4JKGA 4DUZK 1A5VA 5KPTA 3WXMB 4C1NK 4J2AA 4BNEA 4CEZA 4KH5A 3J81O 3M5RA 1K9MO 3FZHA 5KI6A 2DFFA 2X6SA 3THYA 1D9FA 3EY1A 2YCHA 4WE1A 3OYFA 4E7LA 2CGJA 3G6EN 5M1KA 1NK7A 1T05A 1WBBA 2YHWA 3HVTA 3ZEDA 1EQYA 4EZYA 3I55N 5EXWA 3MXIA 2FBTA 1E3MA 1H1VA 1RBVA 5AQGA 3CYMA 2JNKA 4QCLA 4H8SA 1ESVA 3NH0A 3EJTA 4FZPA 3SYVA 4NQIA 2QWRA 2WUSA 2YKTA 4KO0A 5F1XA 3D2FA 1SQKA 2OP6A 3SUOA 1LAWA 3OBYA 3DLGA 1BG3A 3DLKA 3THWB 2NRTA 1NBWA 4JYAK 4CJFA 4LC9B 3RMAA 1DKGD 1BDGA 3AA3A 3ZT3A 1JCGA 1GLDG 2BE2A 4BRFA 3VEXA 5HRPA 4K41A 1EP4A 3EE9A 4M3XA 5EX5A 2GTDA 3CJBA 3HP6A 4N76A 4C1NI 1WUAA 2E2OA 2ASMA 2NRZA 4BRAA 2YJEA 2UUBK 1HYSA 5I42A 4AHUA 1RDAA 1GNTA 1OVYA 4W5NA 4JKDA 4AZ5A 3CZSA 3KIOA 4FJGA 4PKIA 4CZMA 3I8DA 1S1WA 1YVNA 4GKJK 4CIGA 1I4TA 4B1YB 2A1SA 4B9TA 1TAUA 5EY4A 1RGIA 1NJIO 4JI5K 3CKDA 5AZJA 1RT5A 3QE6A 4IM3A 3TAMA 1GLEG 4ISGA 4BC2A 1CLQA 1Z6RA 1QQOA 3PO5A 4BG9A 3M3WA 3DLRA 1QWUA 2GF4A 3VF2A 1NK4A 4E72A 4BRIA 4DU1A 3UE5A 4H0OA 3D4ZA 2OCEA 1HYVA 2OO2A 1IBLK 5JS1A 2PZSA 5B8HA 1JL1A 4QS9A 1YHQN 4R5IA 4KKOA 4M7XA 3EJPA 5C24A 3KJVA 4FVMA 3P5JA 2VWKA 4DV2K 3BVTA 1S9EA 3F5TA 1R0AA 2EWFA 1BGXT 1MDUB 4CFBA 1EKEA 3TTFA 4CGGA 1FJGK 4CZIA 1YI2N 5GAHP 5AQMA 2YHYA 1JLGA 2FXUA 5AZIB 1N33K 3OHXM 2EFKA 5CYQA 3LDNA 1KCFA 2YKNA 3DDGA 3CFPA 1L5UA 4IKFA 3VQEA 4CHOA 1NGFA 4FW2A 4EZUA 3SMSA 3BY5A 4W5TA 4CHNA 4M0MA 1VQON 3QEPA 1U00A 3E9OA 4FWQA 2I5JA 3K9JA 4I2QA 3CQXA 2XRIA 2BPRA 3U3GA 3KLIA 2RF2A 4AF1A 4CFAA 4BGAA 3RMBA 3DPOA 4IOXA 3DX0A 3VQ8A 4MDAA 3KZBA 4XH1A 3V1OA 4FPAA 4R5JA 4FZYA 2W42A 3H1VX 3UITA 1NGIA 1S9GA 1GLCG 3U4LA 2OA8A 3UKUB 2QKKA 2EX3B 4KTZA 1BI4A 2HF4A 4CZEA 2AA4A 5LJVA 4GNIA 4CZLA 2KW4A 3O4QA 4DR3K 1ATRA 4BRLA 4KBOA 4YOTA 2UYTA 1KAXA 3SBGA 3U9ZA 1Q81O 2B6AA 3LPTA 3VEWA 2Z0NA 4B9VA 4GV3A 3SAHA 1QWNA 5AR0A 2ZJQL 3SCXA 4DTNA 3TABA 1W2BM 2HHWA 4DTRA 1A5WA 3CFOA 2YL9A 1VAZA 3DX2A 3TAFA 4OKEA 3V9SA 3BUPA 3K5MA 4Q5VA 4DMNA 1D8YA 2O4GA 2C08A 2OPPA 4LFBK 3LVTA 3BVUA 1R5EA 1X9WA 3DX4A 1KLMA 4DLGA 3JSMA 3PX0A 4M42A 3NF6A 3CMEN 4PL7A 2G8WA 2YNGA 3LALA 3P1GA 2O8BA 4B9NA 5LL6Z 3BVXA 4FJ5A 3ZEUA 4R5LA 3L3OM 3VEAA 5A2QO 3K59A 4NCAA 4GMJB 2A42A 1X9SA 1G15A 1N36K 2OZNB 4CEFA 4M3YA 3OYDA 4OPHA 1XNRK 1ATNA 1XUPO 3P38A 3UB5A 2ZXQA 3QEWA 4HYBA 1I4DA 3V81A 3PO4A 1HNZK 4CEEA 3PX4A 2Q97A 5CHIA 3B6OA 4JKFA 1VRTA 4DSJA 3DPQA 1EX4A 3DLHA 5J2QA 3HPHA 3KVGA 5BN8A 4YOUA 4IM0A 1S1XA 4JNEA 4NPHA 2BTFA 3SAGA 3C65A 3AO3A 2DPNA 1NOZA 3SLCA 5JMVA 1M1KO 1QS4A 1HX1A 2JGUA 2HMIA 5M1OA 3QEXA 1WB9A 1HYZA 1V4TA 3WNFA 2QEXN 3U6FA 5KGXA 2Z0OA 1HNVA 1KXPA 4IBNA 3VGLA 5HLFA 4UDXX 3PIOL 3AVCA 3AVIA 5KRTA 2O8FA 4X64K 4KTQA 2YI1A 2XO7A 1Q7YO 2EHGA 4C8KA 3NGYA 3K57A 4AQYK 2G8UA 1SU7A 3OK8A 2ELBA 3EJRA 2P51A 3SQ4A 4YDUC 4Z4EA 4HR1B 2X74A 5I3UA 3ZEUB 4AZCA 2KKZA 3O9SA 4DF4A 4GV6A 4DCNC 3NHGA 4HCBA 2ASPA 4DS4A 2OBMA 2ZJPL 5LY3A 3ULEB 5AFUA 4FXDA 3ZSXA 2KZMA 3MWTA 4A2AA 4CIEA 2ZD1A 2F8TA 1NK5A 3HSTB 2C1IA 5KBPA 3MWPA 1HR0K 2PY6A 1EO1A 1RDUA 3W3DA 5SZTA 3QA8A 4FWLA 4DKWA 4HUGA 4BRQA 3SUNA 1SKRA 4ID5A 4NXMK 3D2EA 3HK2A 3HJFA 1OH7A 1X3NA 4E7IA 3VEBA 2OPQA 3VGKA 3FZLA 1OA0A 3BUZB 3NF7A 2X3VA 3DWLA 2GAFD 3DLLL 4H0PA 3OYMA 4FJHA 3OYNA 4HUEA 3L6QA 4I6MB 1CZ9A 4CEBA 5AQXA 3WNGA 4IOAL 5D3GA 3JXUA 1ZBUA 3EJQA 2ATQA 3ZT1A 4FJ8A 1NMNA 1TUYA 4K25A 2WOMA 4PY5A 3QNJA 3VA3A 3AY9A 4DR4K 3UKRB 2A5XA 1MJGA 1VQ8N 3ABHA 1TKDA 4A2BA 2E2PA 1HUXA 4B8AB 5C2DA 3AVHA 1GOCA 3TSUA 3AVLA 4ZHRA 2HBKA 3AVGA 4IG0A 3LZIA 1JLAA 5JLFA 1NGJA 3NGZA 4B3SK 3J8AA 2RN2A 4FJIA 3A5NC 5BR9A 1WAJA 1BOTO 2NRWA 4A5AA 2Z8YA 3OYLA 4DU3A 1JLQA 4OX9K 5TKYA 1UA1A 3SI6A 1DG4A 2O4IA 3L3VA 1Q86O 4RW9A 3O4NA 1ZXOA 2W41A 3OHRA 3N4PA 3SBTA 2D1LA 4C8OA 2UUCK 1HKBA 2AJQA 2IGIA 3KLEA 4JWIA 2E6LA 3I8BA 4NYNA 3RRHA 2OPRA 3NCIA 3JS6A 2ITGA 4WPCA 1QZ6A 3IDHA 4A57A 3HP9A 1ZBFA 2D0CA 3AVAA 4JI1K 3F73A 1CZAN 4HY9A 4CBUA 3OYHA 2OW7A 4CK2A 3TANA 1O13A 4LF8K 2EFLA 3ZSOA 4DB3A 2C1GA 3NVMA 3IMXA 4IWQA 2YKMA 3DOLA 1V4SA 3Q7BA 3KK7A 4IFEA 1RFQA 4N56A 3BUBA 3DI6A 5BRHA 1D4XA 1TYQB 2V0OA 1FXXA 1N5YA 4LF4K 3KAWA 2FICA 1SU6A 4G6QA 3FFIA 3QESA 1XC9A 5C25A 3HPOA 1YTUA 3VEVA 2ZM6K 1R33A 2J4RA 4KREA 4JWEA 2F1AA 3A0IX 3VF4A 2OTJN 5BPLA 1BHLA 4DLEA 4LH4A 2NRHA 2E1ZA 5C5BA 5GIOA 5KTQA 4I9LA 2HHTA 3M8SA 2R7YA 4CW7B 3AAPA 4DTPA 3PLTA 2KZZA 4ILHB 4CZJA 4XIUA 3O3OB 5FPDA 2A40A 1X9MA 3Q84A 3SAFA 4BDPA 3GDQA 4IJNA 3I56N 4LD0A 2YHBA 3CCJN 2PBDA 4B9SA 1E9VA 4BR9A 1S6PA 4Y1CA 1P90A 4CE9A 3NGIA 3O1BA 2VCPA 3J7AP 1ATSA 4F00A 3L4IA 2IVOA 1NGAA 2QWMA 2LM0A 1B9DA 4JKAA 4CJVA 1OH6A 4JRPA 4HVJA 1LWCA 3CJ1A 4EZQA 4G9ZA 4NLCA 2V7ZA 4NYFA 4CK1A 3SJJA 1BCMA 5AQJA 2N3KA 2KFNA 4F8RA 1RT1A 5K14A 4E7KA 3DQGA 1VRUA 3EJSA 3V1QA 3GI7A 1RTIA 3THXB 2MI7A 4CZGA 2B4JA 3D45A 2O8DA 2GUPA 3O80A 4M45A 4EZZA 4FZOA 5HROA 5CZ1A 4EZRA 1JLCA 3BP8A 4JKGB 1R59O 2ND1A 2FSNA 4CGJA 2GBZA 1HXKA 2ZGZA 3WUHA 3W0LA 1T8EA 4KAZA 3IG1A 2WC9A 3KTQA 1QVGM 2G8HA 3LM9A 2NRVA 2WONA 3R1XA 4KHUA 3RV1A 3G71N 4JHDA 4FJXA 4QAGA 3LPUA 1NU0A 2P9KA 1T3VA 3OVNA 4UY8O 1QQMA 4BR5A 3FZFA 1X03A 1U49A 3QB0A 5KPZA 4J8FA 1NWKA 3BZCA 3PX6A 3EZ5A 3GG4A 3WXJA 4CJLA 2G8KA 3SK3A 1W0HA 1X1PA 3ZX0A 4DQSA 4R5PA 1DKYA 2QW9A 4CJ7A 4EHTA 2A41A 3L2RA 5EU7A 2A1RA 1JLEA 2O8CA 3LDPA 1HJRA 3V9XA 3CPEA 1TK5A 4H0VB 2OYQA 3HO1A 4FWSA 3OS0A 1TK0A 1QZ5A 3CG7A 3T48A 4DTXA 4FZSA 1GNLA 2XY6A 2YIAA 3R3LA 3V4IA 4ZTJA 4NCGA 2QK9A 4BECA 3RMDA 4DR6K 5AQPA 1U04A 4M3UA 1T6DA 4BRMA 1X9JA 2BUPA 1Q5LA 4FWRA 4DV1K 1QHAA 2Q13A 3MX5A 1HPMA 3QWEA 2F96A 2G8IA 2KTQA 2G8FA 1MWMA 3LP2A 5C0YA 1ASUA 3EE8A 3DM2A 2IVNA 4OPAA 2D4CA 1QQNA 3T19A 4DUYK 2KHOA 5ADXH 2Z1IA 4DTOA 3GE1A 4GKKK 1Q18A 3CF5L 4M3RA 4DQRA 4KPYA 4CF2A 5E41A 1JQKA 1Z05A 2P9LB 3VQ5A 4YHHK 2VWBA 3TTCA 3J7ZO 1JXEA 4DFPA 3NAEA 4PL8A 1VQ9N 4JI3K 4KHYA 4EZXA 3DRSA 4CF8A 2E5LK 3G4SN 3RR7A 1NM1A 4EZWA 3LDLA 5FDLA 4CJRA 3E1YA 2NCZA 4LSNA 4BROA 2P5GA 4OLAA 2HVIA 4B1VA 3AAQA 5E84A 4JHDB 4AM6A 1NK6A 4PQUA 2LSNA 3PSFA 3OYGA 3EL2A 4AZCB 4DR5K 4KB1A 4M3ZA 2JLEA 1KSPA 3NBPA 5HP1A 4U7BA 4LSLA 3AV9A 1XC3A 3C6TA 1D9DA 1OVQA 3K2PA 3BF3A 3LM2A 3VQ4A 3ZCMA 1RBSA 2O8DB 1C1BA 1UPXA 3ATVA 4JK8A 3A98A 3TSQA 4O4GA 3BF1A 2NZTA 1BU6O 1TGOA 1NLVA 4BDZA 1XWLA 3HOSA 1U2VA 3CCUN 1E4GT 4EHUA 3QEIA 3VMFB 3QBXA 2LXYA 1HQUA 2QWNA 4CHPA 4BR4A 3RMCA 2YI8A 5DM7L 3EJUA 5KQDA 4DTSA 5ELZA 4IWOA 4MLHA 4WV7A 2F7QA 3QIPA 3ERCC 4I2PA 1RDDA 3T1AA 4KV8A 3G9GA 4CGDA 4JI7K 2F7RA 4I43A 4KTWA 1IKXA 2ASOA 1CZBA 3PV8A 2QA4N 3CM6A 3F9KA 1NGHA 2UXDK 4I7FA 3ZT2A 3MAQA 4PWDA 1TQVA 3SBSA 2Q2RA 5AQNA 1BWFO 3ID8A 1O1WA 3O08A 3A5LC 3JYTA 3CCRN 4OKJA 4JKCA 3MX2A 4JI2K 4FK2A 4BE2A 5AQTA 2Q12A 5BPNA 5C5BB 5DM6L 1XNQK 3HAJA 3DYTA 1N8RO 4BREA 5AQRA 4MFBA 5HBMA 1QVFM 1OH5A 3VF6A 4CF0A 3QNOA 3SUQA 1FKOA 2P9SB 3M8QA 4DR7K 4DFKA 2YNIA 3HXMA 2Q0RA 5JVHL 3K9KA 1U48A 4IW0A 3AVNA 4YOYA 4I9QA 4XEIA 4AH9A 4DV6K 3KWGA 4NLBA 2P9PA 4EZVA 2WYHA 2NRRA 5I9EB 4AILC 4Z0UA 3V9ZA 4E89A 4ICLA 1K8KB 1RBUA 1LCUA 1QQCA 1IV0A 3KAVA 1VSLA 2E8AA 2VYPA 4H5WA 3PIPL 1HLUA 4GVMA 2WBNA 1HTYA 4ATMA 4CEQA 4BG8A 5J2PA 2ZGYA 2KQ2A 4C8MA 1SU8A 1YJ9N 1I94K 4X62K 3Q0KA 3AGKA 1C0TA 2X78A 1NJZA 4FK0A 3THYB 5M1NA 3HM9A 4CJEA 1DGKN 1LWEA 2GEMA 5LJWA 4EZ6A 5AQIA 5KPRA 3D50A 1YJNN 4HHTA 3SMPA 4JI6K 3VQAA 2WYIA 3IRXA 4CIFA 4NSWA 4DG1A 4ILIA 1Q9XA 3EEQA 4FPBA 4BACA 2FF6A 4H4MA 1YF5L 1TQWA 2QXLA 3J7YP 4CECA 2QKBA 3DYAA 1LW0A 1L3UA 5AQUA 1VQ7N 1BL3A 5M1PA 4BR0A 3SQ1A 2FSJA 1NMDA 2F7TA 3LWLA 3OS1A 1U6ZA 3VTHA 2Q36A 3LDSA 1DEJA 1RT3A 1TUUA 4FYDA 1SUFA 1G99A 1RDCA 4FM3A 3I04A 3BUIA 3D4YA 5AQKA 4A62A 2HSTA 2IIRA 1KAZA 4AHRA 1SL1A 3KK3A 2HHHK 2UXBK 3CCSN 2RHKA 4JL9A 2NNWA 1Q82O 2P9LA 4BC3A 1BUPA 1HNIA 3C0BA 5JICA 4JK7A 3DAWA 4M3WA 3CD6N 1J54A 5FPMA 2RAIA 4WQ5A 3EKUA 5AQLA 1ZYQA 4BRNA 5C15A 5GINA 2OBLA 2E2QA 3IAYA 1TL1A 4R79A 1S5JA 3EN9A 3UKRA 4K0KK 4KHNA 3QNIA 3KDRA 2W6KA 1FKPA 4HCCA 4M41A 3ENBA 3ZEFA 3D2EB 3D7EO 4CESA 2QWLA 1ZBSA 4JK9A 2RPIA 4KHPK 1K8KA 1WLJA 5HRSA 5SWMA 3OYJA 3CJCA 4K8XA 3HI0A 3BVVA 3HYFA 3LDQA 4AM7A 3M6GA 4AHTA 1IKYA 3G0ZA 4CCHA 2XY7A 4ELUA 1QTMA 4IXCA 4M7YA 4DS5A 2PY5A 2D5RA 4Z94A 3NH1A 2YHAA 4CVNE 1RDBA 4A59A 5TKWA 1VHXA
chains in the Genus database with same CATH topology
3L0QA 3T46A 3ID6A 2HF3A 2CGLA 3B52X 3A5MC 3WT0A 2QWRA 2WUSA 1MA9B 5F1XA 3D2FA 1SQKA 3TSPA 2OP6A 2E1ZA 2NRHA 5FIGA 3OBYA 5GIOA 4K42A 1BG3A 3I33A 3RSEB 3AAPA 2NRTA 1NBWA 3VEZA 4DCHA 4LC9B 5AZIA 1DKGD 1BDGA 3ENOA 2P9UA 3MN5A 2YX6A 5HL7L 4IM2A 3CJ7A 4BRDA 4ILHB 1JCGA 1GLDG 3H46O 4BRFA 4CZJA 3CCQN 1OAOA 3O3OB 5FPDA 2A40A 3VEXA 3SAFA 3KHYA 1T44A 4K41A 3EE9A 4BRGA 3GDQA 1W97L 5EX5A 4IJNA 1VQMN 3I56N 4EZTA 2GTDA 3CJBA 3CCJN 4H5RA 4JD2B 2PBDA 1WUAA 2E2OA 2ASMA 2NRZA 4BRAA 4C1NI 2YJEA 3RVCA 2P9UB 1VQKN 1E9VA 3CC4N 3DXMB 4BR9A 3MCAB 3N4QA 5JVGL 4NO7A 1P90A 1NGCA 1S3XA 3O1BA 1GNTA 1OVYA 4HR1A 1CKRA 5BREA 5AQQA 4JKDA 2VCPA 4WFBL 1ATSA 3VPZA 1KC8O 3QFUA 1BO5O 2HBJA 4F00A 3P39A 3L4IA 2IVOA 4BC5A 1NGAA 4IEEA 2QWMA 4KH6A 2QWPA 2LM0A 4JKAA 3VERA 4EZOA 3CJ1A 4PKIA 4BGBA 4EZQA 4CZMA 4NLCA 4G9ZA 4H0XB 2V7ZA 1YVNA 5AQJA 2N3KA 5AQYA 4B1YB 4ISFA 4CD3A 3FLCO 5EY4A 1RGIA 1NJIO 3CQYA 5AZJA 1JJ2M 1NGDA 3DQGA 4IM3A 2FLOA 1GLEG 4ISGA 5AQVA 4HWIA 3VEOA 4BC2A 3GI7A 1Z6RA 1QQOA 3CI5A 3ER9B 3MCPA 5AZJB 3O9TA 4BG9A 4CZGA 2GELA 2GUPA 3VF2A 3FZMA 3WXIA 1JCFA 5C2FA 4BRIA 2JWKA 3FFKB 2E88A 2YHXA 2E20A 3O80A 4JKBA 3FGUA 4EZZA 3EKSA 1BA1A 4H0OA 3UE5A 5MLCQ 3GOIA 4R5GA 3ZETA 5FPEA 4EZRA 3BP8A 4ILGA 4JKGB 4EFHA 2E2NA 2QWQA 2CGKA 1R59O 3O9QA 2ND1A 4IWVA 2FSNA 5B8HA 5F0XA 4FOIA 2ZGZA 4QS9A 1YHQN 2WFBA 4UDYX 2H3GX 4R5IA 4FO0A 4IDHA 3IUCA 4M7XA 3WUHA 3W0LA 4BQZA 5AQSA 3D6RA 3CCLN 3VETA 3N8EA 2D1KA 3CCVN 2WC9A 3QFPA 3DXMA 4ISEA 1SAZA 3O6WA 1QVGM 3WXKA 4OO1J 3LM9A 2NRVA 3M3ZA 4BR2A 5C10A 4IOCL 3F5TA 4YORA 3R1XA 2EWFA 1MDUB 1VQLN 3RV1A 3G71N 3TTFA 4JHDA 5EOYA 1HKCA 3O9UA 4CZIA 1YI2N 5GAHP 3DPPA 4MO5A 3LDOA 5AQMA 4ILJA 3IFRA 2P9KA 2YHYA 1T3VA 4CZFA 4EZSA 2FXUA 2NRXA 5AZIB 3C7NA 1QQMA 3FZFA 3WQUA 3ZYYX 4MQDA 3QB0A 3OHXM 4J8FA 3T49A 1NWKA 3T7ZA 3GBTA 5KPZA 3LDNA 3WEEB 1C0GA 1NGGA 3O3NB 2OTLN 3GG4A 3WXJA 2PFUA 3SK3A 2BH1A 1NGFA 3M1FA 4Y0WA 4EZUA 3SMSA 3T47A 3VEYA 1VQON 4JWCA 4M0MA 3O8MA 3ZX0A 4WQ5C 1U00A 1DKYA 3E9OA 2QW9A 4FWQA 3ZX3A 2A41A 3K9JA 4CJ7A 4EHTA 4YOVA 3B8AX 3CQXA 3LDPA 3CPEA 2BPRA 4RTFD 4L3QA 4MLEA 4A61A 4AF1A 4D8JA 4BGAA 3DPOA 4IOXA 4H0VB 2P9NB 5H1SQ 4YOXA 4MDAA 3KZBA 4XH1A 4FWSA 3C6AA 4FWOA 4H6HA 3EO3A 3OWGA 4R5JA 4FPAA 5GADP 3H1VX 3UITA 1NGIA 1QZ5A 1GLCG 3T48A 3MK6A 1SZ2A 3F9MA 4XH5A 3U4LA 5FPNA 1GNLA 3UKUB 4JEPA 2YIAA 2EX3B 2D0OA 3R3LA 3VGMA 1XQSC 3DOBA 4BECA 5GIPA 5AQPA 2HF4A 3HM8A 2AA4A 4CZEA 1T6DA 3FE1A 3CMAN 1KD1O 5LJVA 4GNIA 3H6EA 4CZLA 4IO9L 1YAGA 4BRMA 3CC2N 1X9JA 2BUPA 1Q5LA 4FWRA 1ATRA 3U8XA 1QHAA 3MX5A 4BRLA 1HPMA 2HBLA 4CBWA 1VQ4N 2NLXA 2D0PA 4KBOA 4YOTA 4F01A 3O1WA 1MWMA 4JKHA 5C0YA 2UYTA 1KAXA 3SBGA 4WFNL 4WFAL 3O5BA 4QS8A 3U9ZA 5BRFA 3EE8A 1Q81O 2W40A 2IVNA 3H0XA 4OPAA 3VEWA 4GV3A 3SAHA 1QQNA 2AP1A 5AR0A 3O9RA 2ZJQL 2KHOA 4E81A 4BR5A 5ADXH 2PAVA 1IG8A 1W2BM 3GE1A 1Q18A 3CF5L 2P9IB 1YIJN 1YJWN 4KH4A 1JQKA 1Z05A 2P9LB 4DQ8A 5M1QA 1VAZA 1GLBG 1P8ZA 2VWBA 3TTCA 3SBTB 3J7ZO 2RE2A 4BC4A 1VQ6N 4PL8A 1VQ9N 4EZXA 4B1WB 4JNFA 4JAXA 2JNSA 2WINM 1IJJA 3G4SN 1NM1A 4EZWA 4BRKA 4CD1A 1VQNN 3LDLA 4IEIA 3E1YA 2NCZA 4BROA 2P9KB 2YIBA 3H1QA 4B1VA 4BRCA 5BPMA 3AAQA 5E84A 4JHDB 4PKGA 1T6CA 4AM6A 2V51B 3CMEN 5AQFA 4PL7A 3EL2A 4GY2B 4EIAA 4YDUA 4H6IA 4GV9A 3E9PA 3ZEUA 4R5LA 3L3OM 3VEAA 3CJ9A 3TTDA 3DXKB 2A42A 3ATUA 1ZC6A 4CZKA 4O8KA 4BY9C 3G25A 3B51X 2Q31A 4OPHA 4U7BA 1HJOA 3HTVA 3CJAA 4BE7B 3ZETB 1XC3A 1ATNA 1XUPO 3P38A 3UB5A 4PKHA 1E4FT 4HYBA 3BF3A 3C6HA 3LM2A 3ENHA 4I6MA 5F2RA 3VESA 2I7PA 1BPRA 4E1JA 1K8AO 1ZYLA 2QTDA 1UPXA 3ATVA 3BEXA 3T4AG 2Q97A 3A98A 2JWLA 4JK8A 4JKFA 3TSQA 4BVPA 5BRDA 3DPQA 5CHIA 1KQSM 3BF1A 2NZTA 1BU6O 1NLVA 3O4WA 4WF9L 3HOSA 1U2VA 3KVGA 5BN8A 3CCUN 2IVPA 4YOUA 4IM0A 4CZHA 4JNEA 1E4GT 4EHUA 4NPHA 2BTFA 3QBXA 3VMFB 3SAGA 3C65A 3ZX2A 2QWNA 4B1ZA 2DPNA 3SLCA 4BR4A 5JMVA 2YI8A 4H5VA 5C12A 1HX1A 5DM7L 1M1KO 3CCEN 5KQDA 5ELZA 5FPMA 4IWOA 5M1OA 4MLHA 4WV7A 4ILGB 4IJAA 4B9QA 3OA9A 3ERCC 4B1UB 2YJFA 2YIVX 2HBMA 4FWMA 1V4TA 2QEXN 3R6MA 3HSCA 4YOWA 4I43A 2QWOA 1KXPA 1U2VB 3VGLA 2ASOA 4HTLA 4DHYA 2QA4N 4UDXX 2P9PB 4JLCA 3PIOL 1NGHA 3E66A 4WYBA 2CH5A 3MN9A 3SBSA 3ULEA 3MN6A 3B53X 2Q2RA 2YI1A 5AQNA 1BWFO 3ID8A 3TU5A 5E26A 3WQTA 3QBWA 1Q7YO 2P9SA 2Q0UA 3A5LC 3O08A 3QDKA 4MDBA 3CCRN 3QICA 4H03B 1SU7A 4JKCA 3MX2A 4ILHA 3DJCA 2YI9A 3A5OC 1M90O 3MMVA 1KAYA 4NB4A 4YDUC 5AQTA 5BPNA 5DM6L 3D2FB 4HR1B 3DXKA 2QI2A 4K43A 1DT9A 3ZEUB 1N8RO 4BREA 5AQRA 1QVFM 4JD2A 3VF6A 2KKZA 2P9SB 3O9SA 4GV6A 1E2UA 5HOOA 1GLAG 1NGEA 2ASPA 2Q0RA 3QMLA 5AQZA 5JVHL 1YUWA 2VGMA 3K9KA 4IW0A 2OBMA 4YOYA 4CBXA 5LY3A 2ZJPL 3ULEB 5AFUA 4FVUA 4XEIA 3P31A 3MN7A 4FWPA 5JLHA 3KWGA 3I39X 3MWTA 2P9PA 3HZ6A 4EZVA 2NRRA 4NLBA 4A2AA 3RV0A 2ZJRL 3F7WA 2A6AA 5KQ8A 1TYQA 3RSEA 5I9EB 2F9WA 5AQOA 2C1IA 1J6ZA 3MWPA 4FL9A 5M1FA 3VENA 2PY6A 1ILYA 1EO1A 1RDUA 3CC7N 4XJXA 1K8KB 3W3DA 2ND0A 4FOEA 4H0TB 1LCUA 1S72N 3QA8A 3KAVA 4FWLA 4DKWA 2E8AA 3EZWA 4C23A 2VYPA 4JKEA 2I7NA 2P9IA 1DKZA 4H5WA 3VKHA 4RCHA 5BN9A 4BRQA 3PIPL 4H0YB 3CXCM 3D2EA 1HLUA 3CETA 4F9OA 1X3NA 2A3ZA 2WBNA 3E9LA 3VEBA 1GLFO 3VGKA 5CE3A 3FZLA 1LOTB 3OBWA 1VQPN 3F2KA 4BG8A 1OA0A 2ZGYA 3BUZB 4A5BA 1SU8A 1YJ9N 3DWLA 2GX9A 4WQ4A 4UY8O 3AGKA 4O8UA 1OKJA 2GAFD 3DLLL 3HRGA 1S22A 4H0PA 5AFUH 4KIKB 2HMPA 3GL1A 3IKMA 3VTIA 2E1YA 5M1NA 4MO4A 3LMFA 3CERA 5FLEX 3L4QA 3L6QA 1DGKN 4I6MB 4IZ9A 2GEMA 4FSVA 5LJWA 5AQIA 5KPRA 2D4WA 1YJNN 3P4IA 2RT6A 4H5TA 5AQXA 4IOAL 2ZWHA 3AGRA 3JXUA 1YITN 3SMPA 3S41A 2CH6A 3HBTA 4M63C 4EZNA 1JCEA 2Q1NA 2QM1A 4PO2A 1TUYA 3CPWM 4ILIA 4K25A 4FPBA 3QNJA 4U67L 3AY9A 2FF6A 1YF5L 3Q7CA 3UKRB 4B1XB 2A5XA 1WOQA 1MJGA 4BRPA 1VQ8N 2QXLA 2EWSA 4EAHD 2P9NA 5AQWA 5GAEP 4A2BA 2E2PA 1HUXA 4O5FA 1C0FA 5AQUA 3H3NO 5C2DA 5ADXA 3HOTA 2OANA 5M1PA 4BR0A 1VQ7N 4H5NA 4PHTX 2W00A 2V52B 2HOEA 2FSJA 2GWJA 2ITMA 1NMDA 3TSUA 4BRHA 2F7TA 3LL3A 2HBKA 3KWIA 1U6ZA 3WXLA 3VTHA 5JLFA 2Q36A 1MWKA 2F9TA 1DEJA 1NGJA 1TUUA 2KLAA 1SUFA 3CHWA 3A5NC 1G99A 3FR0A 4FM3A 3I04A 3J8AA 5EVZA 5BR9A 1BOTO 2NRWA 4RWTA 4EZPA 5AQKA 4A5AA 2Z8YA 4A62A 2HSTA 1SS6A 2IIRA 3A8YA 1KAZA 5TKYA 3WEEA 1DG4A 3CIPA 4QS7A 1Q86O 1ZXOA 3C7NB 4CI6A 3FD9A 2W41A 3N4PA 2RHKA 3OHRA 4JL9A 3SBTA 2NNWA 4E3CA 3CCSN 1Q82O 1VQ5N 3O3MB 2P9LA 1HKBA 2VGNA 4WQ4C 4IO8A 1BUPA 4BC3A 3FZKA 4JWIA 3C0BA 3I8BA 5JICA 4JK7A 3DAWA 3CD6N 4WV5A 3JS6A 3TPQA 3MDQA 3AARA 1Y64A 4WQ5A 2FF3B 4IWPA 3EKUA 5AQHA 4FWKA 4KIKA 1QZ6A 3IDHA 7HSCA 5AQLA 4A57A 2OBLA 4BRNA 5C15A 5GINA 4R5KA 2E2QA 1NGBA 4XH4A 3T69A 1CZAN 4HY9A 1DKXA 4CBUA 4R79A 1X3MA 3EN9A 1E1DA 4FWNA 1HKGA 3UKRA 4BR7A 4JWDA 1O13A 3KDRA 3OW2M 4DB3A 3ENBA 2C1GA 3ZEFA 3D2EB 3NVMA 3IMXA 1BA0A 4IWQA 3H45C 3U9DA 2QFFA 4BQLA 3ER8C 3D7EO 2QWLA 4GVEA 1ZBSA 4JK9A 1GLJO 4JKGA 3PLAA 1V4SA 3Q7BA 3WXMB 3KK7A 4C1NK 5KPTA 1K8KA 4IFEA 3I01A 4JN4A 1RFQA 4KH5A 4BVOA 3M5RA 3CCMN 3UKUA 1K9MO 1K73O 3SJHA 4BEBA 3R9PA 1GN9A 3FZHA 3CJCA 1YXQA 3H3OB 2ZF5O 1GLLO 5GAGP 5BRHA 1D4XA 1TYQB 1RDWX 3HI0A 5BPLA 2GA9D 2YCHA 3KAWA 2V7YA 3R8EA 1SU6A 3LDQA 4G6QA 3M6GA 2FSKA 2GWKA 3VOVA 4AM7A 4WCEL 2CGJA 3G6EN 5M1KA 3VEVA 3NVKA 2YHWA 3ZEDA 4IXCA 1W9MA 4EZYA 1EQYA 4M7YA 4Z94A 5EXWA 3I55N 2J4RA 1H1VA 2X5CA 5AQGA 5CR4A 4JWEA 3A0IX 4A59A 1OA1A 1ESVA 3VF4A 3NMUA 2OTJN 5TKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0Q A;  3T46 A;  2HF3 A;  2CGL A;  3A5M C;  3WT0 A;  2QWR A;  2WUS A;  1MA9 B;  5F1X A;  3D2F A;  1SQK A;  2OP6 A;  2E1Z A;  2NRH A;  4K42 A;  1BG3 A;  3I33 A;  3RSE B;  3AAP A;  1NBW A;  3VEZ A;  4DCH A;  4LC9 B;  5AZI A;  1DKG D;  1BDG A;  3ENO A;  2P9U A;  3MN5 A;  3CJ7 A;  4BRD A;  1JCG A;  1GLD G;  3H46 O;  4CZJ A;  4BRF A;  5FPD A;  2A40 A;  3VEX A;  3KHY A;  1T44 A;  4K41 A;  4BRG A;  3GDQ A;  5EX5 A;  4IJN A;  4EZT A;  2GTD A;  3CJB A;  4H5R A;  4JD2 B;  2PBD A;  1WUA A;  2E2O A;  2ASM A;  4BRA A;  2YJE A;  2P9U B;  3DXM B;  4BR9 A;  4NO7 A;  1NGC A;  1S3X A;  3O1B A;  1CKR A;  5BRE A;  5AQQ A;  2VCP A;  1ATS A;  3VPZ A;  3QFU A;  1BO5 O;  4BC5 A;  4F00 A;  3L4I A;  2IVO A;  1NGA A;  2QWM A;  2QWP A;  3VER A;  4EZO A;  3CJ1 A;  4PKI A;  4BGB A;  4EZQ A;  4CZM A;  4H0X B;  2V7Z A;  1YVN A;  5AQJ A;  5AQY A;  4B1Y B;  4ISF A;  4CD3 A;  3FLC O;  5EY4 A;  1RGI A;  3CQY A;  5AZJ A;  1NGD A;  3DQG A;  2FLO A;  1GLE G;  4ISG A;  5AQV A;  4HWI A;  3VEO A;  4BC2 A;  1Z6R A;  1QQO A;  3CI5 A;  3MCP A;  5AZJ B;  4BG9 A;  4CZG A;  2GEL A;  2GUP A;  3VF2 A;  3FZM A;  3WXI A;  1JCF A;  4BRI A;  3FFK B;  2E88 A;  2YHX A;  2E20 A;  3O80 A;  3FGU A;  4EZZ A;  3EKS A;  1BA1 A;  4H0O A;  3UE5 A;  3GOI A;  4R5G A;  3ZET A;  5FPE A;  4EZR A;  3BP8 A;  4EFH A;  2E2N A;  2QWQ A;  2CGK A;  1R59 O;  4IWV A;  5B8H A;  5F0X A;  2FSN A;  4FOI A;  2ZGZ A;  4QS9 A;  2H3G X;  4R5I A;  4FO0 A;  3WUH A;  3IUC A;  4M7X A;  3W0L A;  4BQZ A;  5AQS A;  3VET A;  3N8E A;  2D1K A;  3QFP A;  3DXM A;  4ISE A;  1SAZ A;  3O6W A;  3WXK A;  3LM9 A;  3M3Z A;  4BR2 A;  1MDU B;  4JHD A;  5EOY A;  1HKC A;  4CZI A;  3DPP A;  4MO5 A;  3LDO A;  5AQM A;  3IFR A;  2P9K A;  2YHY A;  4CZF A;  4EZS A;  2FXU A;  5AZI B;  3WQU A;  3C7N A;  1QQM A;  3FZF A;  4BR5 A;  3QB0 A;  5KPZ A;  3OHX M;  4J8F A;  3T49 A;  1NWK A;  3GBT A;  3LDN A;  3WEE B;  1C0G A;  1NGG A;  3GG4 A;  3WXJ A;  3SK3 A;  1NGF A;  3M1F A;  4Y0W A;  4EZU A;  3SMS A;  3T47 A;  3VEY A;  4JWC A;  3O8M A;  3ZX0 A;  4WQ5 C;  1U00 A;  1DKY A;  3ZX3 A;  2QW9 A;  4FWQ A;  4CJ7 A;  2A41 A;  4EHT A;  3B8A X;  3CQX A;  3LDP A;  4RTF D;  2BPR A;  4L3Q A;  4MLE A;  4A61 A;  4BGA A;  3DPO A;  4H0V B;  2P9N B;  3KZB A;  4XH1 A;  4FWS A;  4FWO A;  4H6H A;  3EO3 A;  4R5J A;  4FPA A;  3H1V X;  1NGI A;  1QZ5 A;  1GLC G;  3T48 A;  3MK6 A;  1SZ2 A;  3F9M A;  4XH5 A;  3U4L A;  5FPN A;  3UKU B;  3VGM A;  2D0O A;  1XQS C;  3DOB A;  5AQP A;  2HF4 A;  3HM8 A;  2AA4 A;  4CZE A;  1T6D A;  3FE1 A;  5LJV A;  4GNI A;  3H6E A;  4CZL A;  1YAG A;  4BRM A;  1X9J A;  2BUP A;  1Q5L A;  4FWR A;  1ATR A;  3U8X A;  1QHA A;  4BRL A;  4CBW A;  1HPM A;  2NLX A;  2D0P A;  4KBO A;  4F01 A;  3O1W A;  1MWM A;  2UYT A;  1KAX A;  3O5B A;  4QS8 A;  3U9Z A;  5BRF A;  2W40 A;  2IVN A;  3H0X A;  3VEW A;  1QQN A;  2AP1 A;  5AR0 A;  2KHO A;  4E81 A;  5ADX H;  2PAV A;  1IG8 A;  3GE1 A;  1Q18 A;  2P9I B;  1Z05 A;  2P9L B;  4DQ8 A;  1GLB G;  1P8Z A;  2VWB A;  4BC4 A;  4PL8 A;  4EZX A;  4B1W B;  4JNF A;  4JAX A;  2WIN M;  1IJJ A;  1NM1 A;  4EZW A;  4BRK A;  4CD1 A;  3LDL A;  4BRO A;  2P9K B;  3H1Q A;  4B1V A;  4BRC A;  5BPM A;  3AAQ A;  5E84 A;  4JHD B;  4PKG A;  1T6C A;  4AM6 A;  2V51 B;  5AQF A;  4PL7 A;  3EL2 A;  4GY2 B;  4EIA A;  4YDU A;  4H6I A;  3ZEU A;  4R5L A;  3L3O M;  3CJ9 A;  3DXK B;  2A42 A;  3ATU A;  1ZC6 A;  4CZK A;  4O8K A;  2Q31 A;  1HJO A;  3HTV A;  3CJA A;  3ZET B;  1XC3 A;  1ATN A;  1XUP O;  3UB5 A;  4PKH A;  1E4F T;  4HYB A;  3BF3 A;  3LM2 A;  4I6M A;  3ENH A;  5F2R A;  3VES A;  2I7P A;  1BPR A;  4E1J A;  3ATV A;  3BEX A;  3T4A G;  2Q97 A;  5BRD A;  4BVP A;  3DPQ A;  3BF1 A;  2NZT A;  1BU6 O;  1NLV A;  3O4W A;  1U2V A;  3KVG A;  5BN8 A;  2IVP A;  4CZH A;  4JNE A;  1E4G T;  4EHU A;  2BTF A;  3QBX A;  3ZX2 A;  2QWN A;  4B1Z A;  2DPN A;  3SLC A;  4BR4 A;  5JMV A;  4H5V A;  1HX1 A;  5KQD A;  5ELZ A;  4MLH A;  4WV7 A;  4IJA A;  4B9Q A;  4B1U B;  2YJF A;  4FWM A;  1V4T A;  3R6M A;  3HSC A;  2QWO A;  1KXP A;  1U2V B;  3VGL A;  2ASO A;  4HTL A;  4DHY A;  2P9P B;  1NGH A;  4WYB A;  2CH5 A;  3MN9 A;  3ULE A;  3MN6 A;  2Q2R A;  2YI1 A;  5AQN A;  1BWF O;  3ID8 A;  3TU5 A;  5E26 A;  3WQT A;  3QBW A;  2P9S A;  2Q0U A;  3A5L C;  3O08 A;  3QDK A;  3QIC A;  4H03 B;  3DJC A;  3A5O C;  3MMV A;  1KAY A;  4NB4 A;  4YDU C;  5AQT A;  5BPN A;  3D2F B;  3DXK A;  4K43 A;  3ZEU B;  4BRE A;  5AQR A;  4JD2 A;  3VF6 A;  2P9S B;  1GLA G;  1NGE A;  2ASP A;  2Q0R A;  3QML A;  5AQZ A;  1YUW A;  4CBX A;  5LY3 A;  3ULE B;  5AFU A;  4XEI A;  3MN7 A;  4FWP A;  5JLH A;  2P9P A;  3HZ6 A;  4EZV A;  4A2A A;  2A6A A;  5KQ8 A;  1TYQ A;  3RSE A;  5I9E B;  2F9W A;  5AQO A;  1J6Z A;  4FL9 A;  3VEN A;  1K8K B;  3W3D A;  4FOE A;  4H0T B;  1LCU A;  4FWL A;  2E8A A;  3EZW A;  4C23 A;  2VYP A;  2I7N A;  2P9I A;  1DKZ A;  4H5W A;  4RCH A;  5BN9 A;  4BRQ A;  4H0Y B;  3D2E A;  1HLU A;  3CET A;  4F9O A;  1X3N A;  2A3Z A;  5CE3 A;  1GLF O;  3VGK A;  3FZL A;  1LOT B;  4BG8 A;  2ZGY A;  3BUZ B;  3DWL A;  4WQ4 A;  1OKJ A;  1S22 A;  4H0P A;  5AFU H;  2HMP A;  3GL1 A;  2E1Y A;  4MO4 A;  3CER A;  3L6Q A;  1DGK N;  4I6M B;  4IZ9 A;  2GEM A;  4FSV A;  5LJW A;  5AQI A;  5KPR A;  2D4W A;  3P4I A;  4H5T A;  5AQX A;  2ZWH A;  3JXU A;  3SMP A;  3S41 A;  2CH6 A;  3HBT A;  4M63 C;  4EZN A;  1JCE A;  2Q1N A;  2QM1 A;  4PO2 A;  1TUY A;  4K25 A;  4FPB A;  3QNJ A;  3AY9 A;  2FF6 A;  3UKR B;  4B1X B;  2A5X A;  1WOQ A;  4BRP A;  2QXL A;  2EWS A;  4EAH D;  2P9N A;  5AQW A;  4A2B A;  2E2P A;  1HUX A;  4O5F A;  1C0F A;  5AQU A;  3H3N O;  5ADX A;  2OAN A;  4BR0 A;  4H5N A;  2V52 B;  2HOE A;  2FSJ A;  2GWJ A;  2ITM A;  1NMD A;  4BRH A;  3LL3 A;  1U6Z A;  3WXL A;  5JLF A;  2Q36 A;  1MWK A;  2F9T A;  1DEJ A;  1NGJ A;  1TUU A;  3CHW A;  3FR0 A;  3G25 A;  3A5N C;  1G99 A;  3J8A A;  5EVZ A;  3R9P A;  5BR9 A;  1BOT O;  4RWT A;  4EZP A;  5AQK A;  4A62 A;  2IIR A;  3A8Y A;  1KAZ A;  5TKY A;  3WEE A;  1DG4 A;  3CIP A;  4QS7 A;  1ZXO A;  3C7N B;  4CI6 A;  2W41 A;  3OHR A;  2P9L A;  1HKB A;  4WQ4 C;  4BC3 A;  4IO8 A;  1BUP A;  3FZK A;  4JWI A;  3C0B A;  3I8B A;  5JIC A;  3DAW A;  4WV5 A;  3JS6 A;  3TPQ A;  3MDQ A;  3AAR A;  1Y64 A;  4WQ5 A;  2FF3 B;  3EKU A;  5AQL A;  5AQH A;  4FWK A;  1QZ6 A;  5FPM A;  3IDH A;  7HSC A;  4BRN A;  4R5K A;  2E2Q A;  1NGB A;  4XH4 A;  1CZA N;  4HY9 A;  1DKX A;  4CBU A;  1X3M A;  3EN9 A;  4FWN A;  1HKG A;  3UKR A;  4BR7 A;  4JWD A;  4DB3 A;  3D2E B;  3IMX A;  1BA0 A;  3H45 C;  3U9D A;  2QFF A;  4BQL A;  3D7E O;  2QWL A;  1ZBS A;  1GLJ O;  1V4S A;  5KPT A;  1K8K A;  4JN4 A;  1RFQ A;  4BVO A;  3UKU A;  3SJH A;  3FZH A;  5BRH A;  3CJC A;  1YXQ A;  3H3O B;  2ZF5 O;  1GLL O;  1D4X A;  1TYQ B;  1RDW X;  3HI0 A;  2YCH A;  2V7Y A;  3R8E A;  3LDQ A;  4AM7 A;  3M6G A;  2FSK A;  2GWK A;  3VOV A;  2CGJ A;  3VEV A;  2YHW A;  4IXC A;  1EQY A;  4EZY A;  4M7Y A;  4Z94 A;  5EXW A;  2J4R A;  1H1V A;  5AQG A;  4JWE A;  3A0I X;  1ESV A;  3VF4 A;  5BPL A; 
#chains in the Genus database with same CATH topology
 3DX3 A;  3L0Q A;  3NF8 A;  3ID6 A;  2CGL A;  3B52 X;  1OH8 A;  1DLO A;  4B3M K;  3VQQ A;  4Z4C A;  5FIG A;  5FRM A;  3OYI A;  3A2F A;  3I33 A;  3VEZ A;  1BIZ A;  3CAZ A;  5HL7 L;  4IM2 A;  3CJ7 A;  4BRD A;  1SKS A;  3H46 O;  3CCQ N;  1KVA A;  2YNH A;  3DMJ A;  3KHY A;  4FM1 A;  4IFY A;  4E0D A;  4FZZ A;  5DMR A;  3ACO A;  1LQ7 A;  3C95 A;  1VQM N;  4EZT A;  3V9W A;  4CHY A;  4FLT A;  4KHW A;  3DLE A;  1VQK N;  3DXM B;  3MCA B;  3N4Q A;  1ZBI A;  1XMO K;  4CHZ A;  3S5T A;  4HR1 A;  1CKR A;  5AQQ A;  4OPJ A;  3L2Q A;  1WSJ A;  3VPZ A;  3ASM A;  4BC5 A;  2HBJ A;  3P39 A;  4BDY A;  5HRN A;  4IEE A;  3OY9 A;  1LWF A;  1S1U A;  2QWP A;  3KK1 A;  4EZO A;  1RT2 A;  5FLX O;  1JLF A;  3RWU A;  2F8S A;  4H0X B;  5AQY A;  1RNH A;  4DYL A;  3FLC O;  3TR8 A;  3THX A;  1JJ2 M;  3HT3 A;  1NGD A;  2O8F B;  1KVC A;  3ER9 B;  3MCP A;  3ZT4 A;  4CFD A;  2GEL A;  5C2F A;  2JWK A;  1XHX A;  2E88 A;  2YHX A;  4JKB A;  4FW1 A;  3EKS A;  1BA1 A;  4CJQ A;  3GOI A;  4R5G A;  1J9A A;  4C8N A;  5FPE A;  4EFH A;  2Y1J A;  4ILG A;  2CGK A;  4FJL A;  1HPZ A;  4FOI A;  1HQE A;  2WFB A;  5LMU K;  2H3G X;  3CM5 A;  4FO0 A;  1M90 O;  2HVH A;  3D6R A;  1QSL A;  1TQT A;  2D1K A;  3CCV N;  2FC0 A;  4ISE A;  3DXM A;  1SAZ A;  3O6W A;  3LAK A;  3V1R A;  1UA0 A;  3WXK A;  4OO1 J;  3BLB A;  4AKV A;  4BR2 A;  4DR2 K;  3S3O A;  5IWA K;  1NJY A;  3CQ8 A;  3ITH A;  4J2B A;  1HKC A;  3DPP A;  4MO5 A;  3LDO A;  4ILJ A;  3VA0 A;  4DQQ A;  4JI4 K;  3KLF A;  4CZF A;  2DFH A;  2VWJ A;  1SL0 A;  3WQU A;  3L2V A;  1W9H A;  3T49 A;  3T7Z A;  3GBT A;  3WEE B;  1C0G A;  4DQP A;  1NKC A;  2VG6 A;  3QIN A;  3ZSZ A;  2PFU A;  3PUF A;  4JLH A;  3TAQ A;  2BH1 A;  3TWH A;  4Y0W A;  3SQ2 A;  3T47 A;  3VEY A;  2ZQB A;  3LP3 A;  3LWM A;  3B6P A;  3NE6 A;  3C94 A;  3MEE A;  3B8A X;  4LF9 K;  4JS5 A;  4MLE A;  4D8J A;  3S3M A;  4W5Q A;  2P9N B;  4B3T K;  5H1S Q;  4YOX A;  3LP0 A;  1Q8I A;  3V6D A;  4FWO A;  3EO3 A;  5JS2 A;  5GAD P;  1U45 A;  3BUD A;  4XH5 A;  4N41 A;  3RRG A;  2VQF K;  4JEP A;  3VGM A;  2D0O A;  2ALW A;  1RT4 A;  3DOB A;  1KRP A;  4RW6 A;  5GIP A;  3SQ0 A;  3HM8 A;  3CMA N;  3FE1 A;  1KD1 O;  1SL2 A;  3T1Y K;  1O7D C;  3U8X A;  3U3Y A;  1VQ4 N;  2NLX A;  4JKH A;  4WFN L;  1TQU A;  4DF8 A;  2AP1 A;  3O9R A;  2PYJ A;  1ASV A;  2F18 A;  4E81 A;  3HPG A;  5IT9 O;  1IG8 A;  3ZSV A;  2P9I B;  2F4V K;  5M1Q A;  1GLB G;  1P8Z A;  4AHS A;  4AZ7 A;  2RE2 A;  1VQ6 N;  3NF9 A;  1VSI A;  4X65 K;  4B1W B;  4JNF A;  3LZJ A;  3KKR A;  2WIN M;  5HRR A;  1IJJ A;  4DU4 A;  3G10 A;  4BRK A;  3RR8 A;  1VQN N;  4CD1 A;  4IEI A;  3AVM A;  4E7J A;  2P9K B;  2YIB A;  2XHB A;  2NUB A;  1HRH A;  4BRC A;  1LV5 A;  4CJK A;  4BWM A;  4PKG A;  4Q0B A;  1T6C A;  1VSD A;  5AQF A;  2HNY A;  4GY2 B;  1Q9Y A;  4EIA A;  1KFD A;  4BE1 A;  3THV A;  4GV9 A;  1TVR A;  3E9P A;  4J2D A;  3CJ9 A;  3TTD A;  4CZK A;  4O8K A;  1SKW A;  5FRO A;  1WSF A;  2Q31 A;  4HUF A;  1T7P A;  1HJO A;  1D5A A;  3IS9 A;  4CK3 A;  4DSF A;  3KD5 E;  1REV A;  2OPS A;  3L2W A;  3RTV A;  3VES A;  3P83 D;  3ENH A;  5AJ3 K;  3TAE A;  1NK9 A;  1BPR A;  2YV0 X;  1ZYL A;  4CHQ A;  1VSH A;  2HB5 A;  2HHX A;  2HND A;  2JWL A;  5BRD A;  4BVP A;  2IVP A;  4CZH A;  4IFV A;  4B1Z A;  1HNW K;  5C12 A;  4H5V A;  3K58 A;  5FRN A;  2X3X A;  4W5O A;  1VSK A;  4IJA A;  4B9Q A;  1IBK K;  3OA9 A;  4B1U B;  2YJF A;  2GUI A;  4FWM A;  1DTT A;  1RIL A;  2BAN A;  4KRF A;  4EP5 A;  3R6M A;  3HSC A;  4YOW A;  3NH2 A;  2WTU A;  3TAP A;  4HTL A;  3KD1 E;  2P9P B;  4DFJ A;  4JLC A;  3E66 A;  1C0U A;  3TI0 A;  1IKW A;  4NXN K;  1R34 A;  4E7H A;  4DSE A;  2P9S A;  2Q0U A;  3J80 O;  4H03 B;  4ILH A;  3DJC A;  2YI9 A;  3BVW A;  3MMV A;  3NDK A;  2B5J A;  4CER A;  3HAH A;  4F2R A;  3UIQ A;  3DXK A;  4AZB A;  5KRS A;  4JD2 A;  2IC3 A;  2F1B A;  3OTO K;  1TQS A;  2Y1I A;  1GLA G;  5AQZ A;  1Y2O A;  1S1V A;  3RPM A;  4DV4 K;  3P31 A;  4O0I A;  4FWP A;  5JLH A;  3I0R A;  3RV0 A;  1IG9 A;  4FJN A;  1TYQ A;  2F9W A;  5AQO A;  3OYC A;  3THW A;  1VSJ A;  3AVK A;  1J6Z A;  5M1F A;  4FL9 A;  3VEN A;  3DLB A;  4B9U A;  3CC7 N;  4XJX A;  3LLL A;  2ND0 A;  3VQB A;  1WSH A;  2GV9 A;  4JKE A;  2P9I A;  4JI0 K;  3VKH A;  1CXU A;  3CET A;  3E9L A;  1Z26 A;  2P5O A;  1NOY A;  1I49 A;  2PMR A;  4LFA K;  1LOT B;  3KKS A;  3OBW A;  1VQP N;  3F2K A;  1EET A;  3NFA A;  1L3V A;  2HHV A;  1W7A A;  4C8L A;  2GX9 A;  4WQ4 A;  4CJ3 A;  4Z4I A;  1OKJ A;  5AFU H;  3D51 A;  3VTI A;  3GL1 A;  2E1Y A;  1HNX K;  3O3G A;  3QER A;  4MO4 A;  3LMF A;  3CER A;  5FLE X;  3L4Q A;  3KLH A;  2IOC A;  4O5B A;  2D4W A;  1RTJ A;  2RT6 A;  2ZWH A;  1J5O A;  1YIT N;  4HTU A;  3S41 A;  2CH6 A;  3HBT A;  4M63 C;  3CPW M;  1IBM K;  3LAM A;  3SOG A;  4DV5 K;  3Q7C A;  3QNN A;  4B1X B;  2UXC K;  1WOQ A;  4O0J A;  4CED A;  2EWS A;  2P9N A;  5AQW A;  4QOZ B;  1VK0 A;  4FK4 A;  4O5F A;  1C0F A;  4FJ9 A;  1J5E K;  4PHT X;  2UUA K;  2HOE A;  1BIS A;  2GWJ A;  1WDZ A;  3LL3 A;  2OZS A;  3KWI A;  2D0A A;  4G1Q A;  4CEO A;  4N47 A;  2YLL A;  1MWK A;  3CHW A;  2F9T A;  3R9P A;  4DV7 K;  1ILY A;  5EVZ A;  1NKE A;  4EZP A;  1EXQ A;  2IS3 A;  3PY8 A;  4JS4 A;  3A8Y A;  2F7O A;  4RW8 A;  1ZBH A;  4LFC K;  3CIP A;  4QS7 A;  3C7N B;  4CI6 A;  3FD9 A;  1VSM A;  3BUQ A;  1VQ5 N;  3ZSW A;  4E3C A;  1C1C A;  2VGN A;  3I0S A;  4IO8 A;  3AVF A;  3FZK A;  1MU2 A;  1RBR A;  3T3F A;  1NJW A;  3HVR A;  3SPZ A;  3HAI A;  3AAR A;  4IWP A;  4OGC A;  1NGB A;  4B8C A;  1E1D A;  4FWN A;  4PA1 A;  1Z25 A;  1HKG A;  3OYA A;  1N32 K;  1JLB A;  3H45 C;  4BQL A;  1BI4 B;  1GLJ O;  1FW6 A;  3PLA A;  1KFS A;  3WNE A;  4F3O A;  3I01 A;  4JN4 A;  4BVO A;  3CCM N;  3UKU A;  1K73 O;  3SJH A;  4BEB A;  1GN9 A;  5GAG P;  3H3O B;  1YXQ A;  2ZF5 O;  1GLL O;  1NJX A;  4Z4G A;  1RDW X;  1TKZ A;  2GA9 D;  1TKX A;  1KTQ A;  2V7Y A;  3R8E A;  4ELV A;  4WCE L;  3VOV A;  2FSK A;  2GWK A;  1UAX A;  3K0S A;  3SNN A;  3AO4 A;  3NVK A;  1N6Q A;  1IKV A;  4FLZ A;  3AA4 A;  1VSE A;  1W9M A;  2X5C A;  1QHT A;  1IH7 A;  5CR4 A;  1BCO A;  3OYB A;  5LMN K;  1OA1 A;  3ZT0 A;  4LF7 K;  3NMU A;  2HHS A;  4CJ4 A;  3ZSQ A;  3T46 A;  2HF3 A;  2D0B A;  3A5M C;  2OW6 A;  3WT0 A;  1MA9 B;  3TSP A;  3CYG A;  4CEA A;  4K42 A;  4CF9 A;  5BR8 K;  5KGW A;  3AA2 A;  4H4O A;  3RSE B;  4DCH A;  5AZI A;  3AVJ A;  2QKW A;  2FBV A;  2P9U A;  3ENO A;  3MN5 A;  2YX6 A;  4AZ6 A;  4CJU A;  1OAO A;  2FBY A;  4PUO A;  4AZH A;  1T44 A;  4BRG A;  1TAQ A;  1W97 L;  4B3O A;  1NNE A;  4H5R A;  4TSX A;  4JD2 B;  3RVC A;  2P9U B;  3CC4 N;  4DFM A;  4V19 S;  5JVG L;  4NO7 A;  1NGC A;  1S3X A;  5BRE A;  2IAJ A;  4WFB L;  3M8R A;  1WBD A;  4FJJ A;  1KC8 O;  3QFU A;  1BO5 O;  3DRR A;  1CXQ A;  4KH6 A;  3VER A;  5DK5 A;  2P1J A;  3DOK A;  4BGB A;  2YL6 A;  3AO5 A;  3OS2 A;  4ISF A;  4CD3 A;  4KI4 A;  3OJS A;  3CQY A;  4KB0 A;  2FLO A;  5AQV A;  3VEO A;  4HWI A;  3ZSY A;  1A5X A;  3CI5 A;  5AZJ B;  4FM2 A;  3O9T A;  1FK9 A;  2BDP A;  3FZM A;  4ID1 A;  3WXI A;  1JCF A;  3FFK B;  1KLN A;  1QX1 A;  2E20 A;  4CGF A;  3FGU A;  1I3A A;  5MLC Q;  2DFE A;  3ZET A;  2XY8 A;  2E2N A;  1GOB A;  2QWQ A;  3O9Q A;  4IWV A;  5F0X A;  3WNH A;  4FZX C;  1B92 A;  1LW2 A;  4UDY X;  2Z1J A;  4IDH A;  3IUC A;  1YT3 A;  4BQZ A;  5AQS A;  4Y1D A;  4X66 K;  4YY3 K;  3CCL N;  3VET A;  3N8E A;  5J2M A;  3QIO A;  3VQ7 A;  3QFP A;  4FLU A;  2HHQ A;  3SV3 A;  2O8B B;  3M3Z A;  4IOC L;  1RCH A;  5C10 A;  1I39 A;  4YOR A;  2FBX A;  4YFU A;  3CV5 A;  1VQL N;  1TKT A;  4N5S A;  3BZK A;  5EOY A;  2W6L A;  3O9U A;  4AZI A;  4YNQ A;  1NK8 A;  1RTD A;  3IFR A;  1TK8 A;  4DQI A;  4EZS A;  2NRX A;  4DSL A;  3C7N A;  3ZYY X;  4MQD A;  2OTL N;  1NGG A;  3O3N B;  2PYL A;  3OJU A;  1N34 K;  4JI8 K;  3D52 A;  4LH5 A;  2DTU A;  4LF5 K;  3OYE A;  3VN5 A;  3M1F A;  4M3T A;  2HHI A;  3AO2 A;  4IG3 A;  4JWC A;  3O8M A;  4BE0 A;  3QLH A;  4WQ5 C;  1T03 A;  3ZX3 A;  1U47 A;  4YOV A;  3KK2 A;  4I1Q A;  4RTF D;  3VQ9 A;  4OGE A;  4L3Q A;  4A61 A;  4E3S A;  3MED A;  4E1M A;  1WSG A;  4FJ7 A;  3CZN A;  3SYZ A;  3C6A A;  1C0M A;  4H6H A;  3OWG A;  1I4L A;  1JL2 A;  3MK6 A;  1SZ2 A;  3F9M A;  5FPN A;  2ETJ A;  4CJW A;  2KFZ A;  1O7D B;  1XQS C;  3LAN A;  1WN7 A;  1J53 A;  2EX3 A;  3H6E A;  4IO9 L;  1YAG A;  3CC2 N;  4DWI A;  4CBW A;  4DR1 K;  2HBL A;  2D0P A;  3O3F A;  4F01 A;  3O1W A;  4WFA L;  3O5B A;  1QE1 A;  4QS8 A;  5BRF A;  2W40 A;  1HMV A;  3H0X A;  2G8V A;  4GW6 A;  4DTM A;  1S6Q A;  2PAV A;  3QET A;  3VQP A;  1C6V A;  4EZ9 A;  3KLG A;  1YIJ N;  1YJW N;  4E19 A;  4KH4 A;  2Z1G A;  4DQ8 A;  3MXJ A;  3SBT B;  1YTA A;  4BC4 A;  3CVR A;  4JAX A;  4H8K A;  2JNS A;  3ZSR A;  3TAR A;  1PS3 A;  3MXM A;  3SPY A;  3L2U A;  4WPE A;  2Q3S A;  1XI1 A;  4K8Z A;  3H1Q A;  2RAJ A;  5BPM A;  4DSI A;  4B9M A;  3SZ2 A;  1RTH A;  4FLX A;  2V51 B;  3DDF A;  4CGI A;  2YLA A;  3ISN C;  1XMQ K;  3K5O A;  1EWQ A;  4YDU A;  3V9U A;  4H6I A;  3S9H A;  1BQN A;  1L3S A;  3DXK B;  3ATU A;  1ZC6 A;  3ZLJ A;  4MQ3 A;  3L8B A;  3DRP A;  2VG7 A;  4BY9 C;  1IO2 A;  4DSK A;  4ELT A;  3B51 X;  3HTV A;  3MEG A;  4FM0 A;  1UOC A;  3CJA A;  4BE7 B;  3ZET B;  4B3R K;  4DTU A;  4PKH A;  1QSS A;  1E4F T;  3C6H A;  5F2R A;  4I6M A;  4CJP A;  1LAV A;  1WAF A;  1X04 A;  2I7P A;  4E1J A;  1JXB A;  1EWR A;  2QTD A;  4RW7 A;  3BEX A;  4FJK A;  3AO1 A;  3T4A G;  4Z4F A;  4NCB A;  1KQS M;  3MEC A;  4JV5 K;  1BQM A;  3AVB A;  3O4W A;  4WF9 L;  1KVB A;  4AHC A;  1YWM A;  2UU9 K;  4KHS A;  3ULD A;  4CFC A;  1B9F A;  3C6U A;  3ZX2 A;  4OLB A;  4F2S A;  3CCE N;  4ILG B;  3H08 A;  4CJ5 A;  2YIV X;  2HBM A;  1ZBL A;  1DTQ A;  3LP1 A;  3CFR A;  2QWO A;  1U2V B;  4DHY A;  1WNS A;  3S3N A;  3BDP A;  1SUQ A;  4WYB A;  1VSF A;  1BIU A;  2CH5 A;  3MN9 A;  4EP4 A;  4JRQ A;  3ULE A;  1RT6 A;  3MN6 A;  3B53 X;  2VQE K;  1ITG A;  4AHV A;  2BGG A;  4OJR A;  3L3P A;  3BGR A;  5JEN A;  3SUP A;  1QSY A;  3TU5 A;  3WQT A;  5E26 A;  3QBW A;  3QDK A;  4MDB A;  3QIC A;  3A5O C;  4KFB A;  3HL8 A;  3I2W A;  1KAY A;  4NB4 A;  4DV0 K;  1JKH A;  1ZWW A;  3VQD A;  3D2F B;  2QI2 A;  4IDK A;  4K43 A;  1DT9 A;  4L8R B;  1Y97 A;  4RW4 A;  1SV5 A;  1E2U A;  5T7B A;  1GOA A;  5HOO A;  1NGE A;  3QML A;  1YUW A;  2VGM A;  5J1E A;  4CBX A;  4FVU A;  3MN7 A;  4DTJ A;  1S1T A;  3EYZ A;  2HW3 A;  1C1A A;  3I39 X;  4AVM A;  3HZ6 A;  2ZJR L;  4FCY A;  2E6M A;  4B08 A;  3F7W A;  2A6A A;  5KQ8 A;  3RSE A;  1RT7 A;  1NK0 A;  4DV3 K;  3SV4 A;  5CY4 A;  4FLY A;  4OKK A;  3JAM O;  3QEV A;  1S72 N;  4FOE A;  4H0T B;  2O0I 1;  3PSI A;  5C42 A;  3EZW A;  4C23 A;  2X6N A;  2I7N A;  4RCH A;  1DKZ A;  4UQG A;  1ASW A;  5BN9 A;  3CXC M;  1K8A O;  4H0Y B;  3M8P A;  4F4K A;  4F9O A;  2ZE2 A;  2A3Z A;  5CE3 A;  4F3T A;  1GLF O;  1F21 A;  4O44 A;  4J2E A;  2HHU A;  4W5R A;  2O8E B;  4A5B A;  4Z4H A;  1K6Y A;  3K5N A;  5J2N A;  4O8U A;  1YVU A;  1S22 A;  2VG5 A;  2YNF A;  3HRG A;  1TL3 A;  4KIK B;  2HMP A;  2Z1H A;  3E01 A;  3IKM A;  4KHQ A;  4IZ9 A;  1L3T A;  4FSV A;  3VQC A;  4CF1 A;  3P4I A;  4H5T A;  2F7P A;  1WSE A;  2HNZ A;  3AGR A;  4CGH A;  4EZN A;  1JCE A;  2Q1N A;  4CJT A;  2IDO A;  2QM1 A;  4PO2 A;  2Z0V A;  1U4B A;  4OPK A;  1WSI A;  4U67 L;  2RKI A;  4E1N A;  4RG8 A;  1UWB A;  4FJM A;  4BRP A;  4EAH D;  3OYK A;  4FLV A;  2FYV A;  4KI6 A;  5GAE P;  3HOT A;  5ADX A;  3H3N O;  2OAN A;  4ZTF A;  4H5N A;  2W00 A;  2V52 B;  3T1H K;  2O8C B;  2ITM A;  4BRH A;  2XY5 A;  1URU A;  1XHZ A;  1NG9 A;  3ALY A;  4OVL A;  5CZ2 A;  3WXL A;  3QO9 A;  3G25 A;  2KLA A;  3FR0 A;  1RBT A;  4RWT A;  2YL8 A;  4CJS A;  1SS6 A;  2X3W A;  3WEE A;  3TAG A;  5CYM A;  3D0P A;  4LY7 A;  2RAK A;  1TV6 A;  2E4L A;  3O3M B;  4WQ4 C;  3O3H A;  4WV5 A;  3TPQ A;  3MDQ A;  1Y64 A;  2FF3 B;  5AQH A;  4FWK A;  4KIK A;  1NKB A;  2DY4 A;  7HSC A;  4R5K A;  4LF6 K;  4XH4 A;  3T69 A;  1HWW A;  1DKX A;  1X3M A;  2O8E A;  3K5L A;  4AZG A;  3L3U A;  2OZM A;  3VQ6 A;  4BR7 A;  4JWD A;  3OW2 M;  3AA5 X;  3DX1 A;  4B9L A;  2YL5 A;  1BA0 A;  2QXF A;  4BWJ A;  3U9D A;  2QFF A;  4FLW A;  3ER8 C;  4GVE A;  4O55 A;  4JKG A;  4DUZ K;  1A5V A;  5KPT A;  3WXM B;  4C1N K;  4J2A A;  4BNE A;  4CEZ A;  4KH5 A;  3J81 O;  3M5R A;  1K9M O;  3FZH A;  5KI6 A;  2DFF A;  2X6S A;  3THY A;  1D9F A;  3EY1 A;  2YCH A;  4WE1 A;  3OYF A;  4E7L A;  2CGJ A;  3G6E N;  5M1K A;  1NK7 A;  1T05 A;  1WBB A;  2YHW A;  3HVT A;  3ZED A;  1EQY A;  4EZY A;  3I55 N;  5EXW A;  3MXI A;  2FBT A;  1E3M A;  1H1V A;  1RBV A;  5AQG A;  3CYM A;  2JNK A;  4QCL A;  4H8S A;  1ESV A;  3NH0 A;  3EJT A;  4FZP A;  3SYV A;  4NQI A;  2QWR A;  2WUS A;  2YKT A;  4KO0 A;  5F1X A;  3D2F A;  1SQK A;  2OP6 A;  3SUO A;  1LAW A;  3OBY A;  3DLG A;  1BG3 A;  3DLK A;  3THW B;  2NRT A;  1NBW A;  4JYA K;  4CJF A;  4LC9 B;  3RMA A;  1DKG D;  1BDG A;  3AA3 A;  3ZT3 A;  1JCG A;  1GLD G;  2BE2 A;  4BRF A;  3VEX A;  5HRP A;  4K41 A;  1EP4 A;  3EE9 A;  4M3X A;  5EX5 A;  2GTD A;  3CJB A;  3HP6 A;  4N76 A;  4C1N I;  1WUA A;  2E2O A;  2ASM A;  2NRZ A;  4BRA A;  2YJE A;  2UUB K;  1HYS A;  5I42 A;  4AHU A;  1RDA A;  1GNT A;  1OVY A;  4W5N A;  4JKD A;  4AZ5 A;  3CZS A;  3KIO A;  4FJG A;  4PKI A;  4CZM A;  3I8D A;  1S1W A;  1YVN A;  4GKJ K;  4CIG A;  1I4T A;  4B1Y B;  2A1S A;  4B9T A;  1TAU A;  5EY4 A;  1RGI A;  1NJI O;  4JI5 K;  3CKD A;  5AZJ A;  1RT5 A;  3QE6 A;  4IM3 A;  3TAM A;  1GLE G;  4ISG A;  4BC2 A;  1CLQ A;  1Z6R A;  1QQO A;  3PO5 A;  4BG9 A;  3M3W A;  3DLR A;  1QWU A;  2GF4 A;  3VF2 A;  1NK4 A;  4E72 A;  4BRI A;  4DU1 A;  3UE5 A;  4H0O A;  3D4Z A;  2OCE A;  1HYV A;  2OO2 A;  1IBL K;  5JS1 A;  2PZS A;  5B8H A;  1JL1 A;  4QS9 A;  1YHQ N;  4R5I A;  4KKO A;  4M7X A;  3EJP A;  5C24 A;  3KJV A;  4FVM A;  3P5J A;  2VWK A;  4DV2 K;  3BVT A;  1S9E A;  3F5T A;  1R0A A;  2EWF A;  1BGX T;  1MDU B;  4CFB A;  1EKE A;  3TTF A;  4CGG A;  1FJG K;  4CZI A;  1YI2 N;  5GAH P;  5AQM A;  2YHY A;  1JLG A;  2FXU A;  5AZI B;  1N33 K;  3OHX M;  2EFK A;  5CYQ A;  3LDN A;  1KCF A;  2YKN A;  3DDG A;  3CFP A;  1L5U A;  4IKF A;  3VQE A;  4CHO A;  1NGF A;  4FW2 A;  4EZU A;  3SMS A;  3BY5 A;  4W5T A;  4CHN A;  4M0M A;  1VQO N;  3QEP A;  1U00 A;  3E9O A;  4FWQ A;  2I5J A;  3K9J A;  4I2Q A;  3CQX A;  2XRI A;  2BPR A;  3U3G A;  3KLI A;  2RF2 A;  4AF1 A;  4CFA A;  4BGA A;  3RMB A;  3DPO A;  4IOX A;  3DX0 A;  3VQ8 A;  4MDA A;  3KZB A;  4XH1 A;  3V1O A;  4FPA A;  4R5J A;  4FZY A;  2W42 A;  3H1V X;  3UIT A;  1NGI A;  1S9G A;  1GLC G;  3U4L A;  2OA8 A;  3UKU B;  2QKK A;  2EX3 B;  4KTZ A;  1BI4 A;  2HF4 A;  4CZE A;  2AA4 A;  5LJV A;  4GNI A;  4CZL A;  2KW4 A;  3O4Q A;  4DR3 K;  1ATR A;  4BRL A;  4KBO A;  4YOT A;  2UYT A;  1KAX A;  3SBG A;  3U9Z A;  1Q81 O;  2B6A A;  3LPT A;  3VEW A;  2Z0N A;  4B9V A;  4GV3 A;  3SAH A;  1QWN A;  5AR0 A;  2ZJQ L;  3SCX A;  4DTN A;  3TAB A;  1W2B M;  2HHW A;  4DTR A;  1A5W A;  3CFO A;  2YL9 A;  1VAZ A;  3DX2 A;  3TAF A;  4OKE A;  3V9S A;  3BUP A;  3K5M A;  4Q5V A;  4DMN A;  1D8Y A;  2O4G A;  2C08 A;  2OPP A;  4LFB K;  3LVT A;  3BVU A;  1R5E A;  1X9W A;  3DX4 A;  1KLM A;  4DLG A;  3JSM A;  3PX0 A;  4M42 A;  3NF6 A;  3CME N;  4PL7 A;  2G8W A;  2YNG A;  3LAL A;  3P1G A;  2O8B A;  4B9N A;  5LL6 Z;  3BVX A;  4FJ5 A;  3ZEU A;  4R5L A;  3L3O M;  3VEA A;  5A2Q O;  3K59 A;  4NCA A;  4GMJ B;  2A42 A;  1X9S A;  1G15 A;  1N36 K;  2OZN B;  4CEF A;  4M3Y A;  3OYD A;  4OPH A;  1XNR K;  1ATN A;  1XUP O;  3P38 A;  3UB5 A;  2ZXQ A;  3QEW A;  4HYB A;  1I4D A;  3V81 A;  3PO4 A;  1HNZ K;  4CEE A;  3PX4 A;  2Q97 A;  5CHI A;  3B6O A;  4JKF A;  1VRT A;  4DSJ A;  3DPQ A;  1EX4 A;  3DLH A;  5J2Q A;  3HPH A;  3KVG A;  5BN8 A;  4YOU A;  4IM0 A;  1S1X A;  4JNE A;  4NPH A;  2BTF A;  3SAG A;  3C65 A;  3AO3 A;  2DPN A;  1NOZ A;  3SLC A;  5JMV A;  1M1K O;  1QS4 A;  1HX1 A;  2JGU A;  2HMI A;  5M1O A;  3QEX A;  1WB9 A;  1HYZ A;  1V4T A;  3WNF A;  2QEX N;  3U6F A;  5KGX A;  2Z0O A;  1HNV A;  1KXP A;  4IBN A;  3VGL A;  5HLF A;  4UDX X;  3PIO L;  3AVC A;  3AVI A;  5KRT A;  2O8F A;  4X64 K;  4KTQ A;  2YI1 A;  2XO7 A;  1Q7Y O;  2EHG A;  4C8K A;  3NGY A;  3K57 A;  4AQY K;  2G8U A;  1SU7 A;  3OK8 A;  2ELB A;  3EJR A;  2P51 A;  3SQ4 A;  4YDU C;  4Z4E A;  4HR1 B;  2X74 A;  5I3U A;  3ZEU B;  4AZC A;  2KKZ A;  3O9S A;  4DF4 A;  4GV6 A;  4DCN C;  3NHG A;  4HCB A;  2ASP A;  4DS4 A;  2OBM A;  2ZJP L;  5LY3 A;  3ULE B;  5AFU A;  4FXD A;  3ZSX A;  2KZM A;  3MWT A;  4A2A A;  4CIE A;  2ZD1 A;  2F8T A;  1NK5 A;  3HST B;  2C1I A;  5KBP A;  3MWP A;  1HR0 K;  2PY6 A;  1EO1 A;  1RDU A;  3W3D A;  5SZT A;  3QA8 A;  4FWL A;  4DKW A;  4HUG A;  4BRQ A;  3SUN A;  1SKR A;  4ID5 A;  4NXM K;  3D2E A;  3HK2 A;  3HJF A;  1OH7 A;  1X3N A;  4E7I A;  3VEB A;  2OPQ A;  3VGK A;  3FZL A;  1OA0 A;  3BUZ B;  3NF7 A;  2X3V A;  3DWL A;  2GAF D;  3DLL L;  4H0P A;  3OYM A;  4FJH A;  3OYN A;  4HUE A;  3L6Q A;  4I6M B;  1CZ9 A;  4CEB A;  5AQX A;  3WNG A;  4IOA L;  5D3G A;  3JXU A;  1ZBU A;  3EJQ A;  2ATQ A;  3ZT1 A;  4FJ8 A;  1NMN A;  1TUY A;  4K25 A;  2WOM A;  4PY5 A;  3QNJ A;  3VA3 A;  3AY9 A;  4DR4 K;  3UKR B;  2A5X A;  1MJG A;  1VQ8 N;  3ABH A;  1TKD A;  4A2B A;  2E2P A;  1HUX A;  4B8A B;  5C2D A;  3AVH A;  1GOC A;  3TSU A;  3AVL A;  4ZHR A;  2HBK A;  3AVG A;  4IG0 A;  3LZI A;  1JLA A;  5JLF A;  1NGJ A;  3NGZ A;  4B3S K;  3J8A A;  2RN2 A;  4FJI A;  3A5N C;  5BR9 A;  1WAJ A;  1BOT O;  2NRW A;  4A5A A;  2Z8Y A;  3OYL A;  4DU3 A;  1JLQ A;  4OX9 K;  5TKY A;  1UA1 A;  3SI6 A;  1DG4 A;  2O4I A;  3L3V A;  1Q86 O;  4RW9 A;  3O4N A;  1ZXO A;  2W41 A;  3OHR A;  3N4P A;  3SBT A;  2D1L A;  4C8O A;  2UUC K;  1HKB A;  2AJQ A;  2IGI A;  3KLE A;  4JWI A;  2E6L A;  3I8B A;  4NYN A;  3RRH A;  2OPR A;  3NCI A;  3JS6 A;  2ITG A;  4WPC A;  1QZ6 A;  3IDH A;  4A57 A;  3HP9 A;  1ZBF A;  2D0C A;  3AVA A;  4JI1 K;  3F73 A;  1CZA N;  4HY9 A;  4CBU A;  3OYH A;  2OW7 A;  4CK2 A;  3TAN A;  1O13 A;  4LF8 K;  2EFL A;  3ZSO A;  4DB3 A;  2C1G A;  3NVM A;  3IMX A;  4IWQ A;  2YKM A;  3DOL A;  1V4S A;  3Q7B A;  3KK7 A;  4IFE A;  1RFQ A;  4N56 A;  3BUB A;  3DI6 A;  5BRH A;  1D4X A;  1TYQ B;  2V0O A;  1FXX A;  1N5Y A;  4LF4 K;  3KAW A;  2FIC A;  1SU6 A;  4G6Q A;  3FFI A;  3QES A;  1XC9 A;  5C25 A;  3HPO A;  1YTU A;  3VEV A;  2ZM6 K;  1R33 A;  2J4R A;  4KRE A;  4JWE A;  2F1A A;  3A0I X;  3VF4 A;  2OTJ N;  5BPL A;  1BHL A;  4DLE A;  4LH4 A;  2NRH A;  2E1Z A;  5C5B A;  5GIO A;  5KTQ A;  4I9L A;  2HHT A;  3M8S A;  2R7Y A;  4CW7 B;  3AAP A;  4DTP A;  3PLT A;  2KZZ A;  4ILH B;  4CZJ A;  4XIU A;  3O3O B;  5FPD A;  2A40 A;  1X9M A;  3Q84 A;  3SAF A;  4BDP A;  3GDQ A;  4IJN A;  3I56 N;  4LD0 A;  2YHB A;  3CCJ N;  2PBD A;  4B9S A;  1E9V A;  4BR9 A;  1S6P A;  4Y1C A;  1P90 A;  4CE9 A;  3NGI A;  3O1B A;  2VCP A;  3J7A P;  1ATS A;  4F00 A;  3L4I A;  2IVO A;  1NGA A;  2QWM A;  2LM0 A;  1B9D A;  4JKA A;  4CJV A;  1OH6 A;  4JRP A;  4HVJ A;  1LWC A;  3CJ1 A;  4EZQ A;  4G9Z A;  4NLC A;  2V7Z A;  4NYF A;  4CK1 A;  3SJJ A;  1BCM A;  5AQJ A;  2N3K A;  2KFN A;  4F8R A;  1RT1 A;  5K14 A;  4E7K A;  3DQG A;  1VRU A;  3EJS A;  3V1Q A;  3GI7 A;  1RTI A;  3THX B;  2MI7 A;  4CZG A;  2B4J A;  3D45 A;  2O8D A;  2GUP A;  3O80 A;  4M45 A;  4EZZ A;  4FZO A;  5HRO A;  5CZ1 A;  4EZR A;  1JLC A;  3BP8 A;  4JKG B;  1R59 O;  2ND1 A;  2FSN A;  4CGJ A;  2GBZ A;  1HXK A;  2ZGZ A;  3WUH A;  3W0L A;  1T8E A;  4KAZ A;  3IG1 A;  2WC9 A;  3KTQ A;  1QVG M;  2G8H A;  3LM9 A;  2NRV A;  2WON A;  3R1X A;  4KHU A;  3RV1 A;  3G71 N;  4JHD A;  4FJX A;  4QAG A;  3LPU A;  1NU0 A;  2P9K A;  1T3V A;  3OVN A;  4UY8 O;  1QQM A;  4BR5 A;  3FZF A;  1X03 A;  1U49 A;  3QB0 A;  5KPZ A;  4J8F A;  1NWK A;  3BZC A;  3PX6 A;  3EZ5 A;  3GG4 A;  3WXJ A;  4CJL A;  2G8K A;  3SK3 A;  1W0H A;  1X1P A;  3ZX0 A;  4DQS A;  4R5P A;  1DKY A;  2QW9 A;  4CJ7 A;  4EHT A;  2A41 A;  3L2R A;  5EU7 A;  2A1R A;  1JLE A;  2O8C A;  3LDP A;  1HJR A;  3V9X A;  3CPE A;  1TK5 A;  4H0V B;  2OYQ A;  3HO1 A;  4FWS A;  3OS0 A;  1TK0 A;  1QZ5 A;  3CG7 A;  3T48 A;  4DTX A;  4FZS A;  1GNL A;  2XY6 A;  2YIA A;  3R3L A;  3V4I A;  4ZTJ A;  4NCG A;  2QK9 A;  4BEC A;  3RMD A;  4DR6 K;  5AQP A;  1U04 A;  4M3U A;  1T6D A;  4BRM A;  1X9J A;  2BUP A;  1Q5L A;  4FWR A;  4DV1 K;  1QHA A;  2Q13 A;  3MX5 A;  1HPM A;  3QWE A;  2F96 A;  2G8I A;  2KTQ A;  2G8F A;  1MWM A;  3LP2 A;  5C0Y A;  1ASU A;  3EE8 A;  3DM2 A;  2IVN A;  4OPA A;  2D4C A;  1QQN A;  3T19 A;  4DUY K;  2KHO A;  5ADX H;  2Z1I A;  4DTO A;  3GE1 A;  4GKK K;  1Q18 A;  3CF5 L;  4M3R A;  4DQR A;  4KPY A;  4CF2 A;  5E41 A;  1JQK A;  1Z05 A;  2P9L B;  3VQ5 A;  4YHH K;  2VWB A;  3TTC A;  3J7Z O;  1JXE A;  4DFP A;  3NAE A;  4PL8 A;  1VQ9 N;  4JI3 K;  4KHY A;  4EZX A;  3DRS A;  4CF8 A;  2E5L K;  3G4S N;  3RR7 A;  1NM1 A;  4EZW A;  3LDL A;  5FDL A;  4CJR A;  3E1Y A;  2NCZ A;  4LSN A;  4BRO A;  2P5G A;  4OLA A;  2HVI A;  4B1V A;  3AAQ A;  5E84 A;  4JHD B;  4AM6 A;  1NK6 A;  4PQU A;  2LSN A;  3PSF A;  3OYG A;  3EL2 A;  4AZC B;  4DR5 K;  4KB1 A;  4M3Z A;  2JLE A;  1KSP A;  3NBP A;  5HP1 A;  4U7B A;  4LSL A;  3AV9 A;  1XC3 A;  3C6T A;  1D9D A;  1OVQ A;  3K2P A;  3BF3 A;  3LM2 A;  3VQ4 A;  3ZCM A;  1RBS A;  2O8D B;  1C1B A;  1UPX A;  3ATV A;  4JK8 A;  3A98 A;  3TSQ A;  4O4G A;  3BF1 A;  2NZT A;  1BU6 O;  1TGO A;  1NLV A;  4BDZ A;  1XWL A;  3HOS A;  1U2V A;  3CCU N;  1E4G T;  4EHU A;  3QEI A;  3VMF B;  3QBX A;  2LXY A;  1HQU A;  2QWN A;  4CHP A;  4BR4 A;  3RMC A;  2YI8 A;  5DM7 L;  3EJU A;  5KQD A;  4DTS A;  5ELZ A;  4IWO A;  4MLH A;  4WV7 A;  2F7Q A;  3QIP A;  3ERC C;  4I2P A;  1RDD A;  3T1A A;  4KV8 A;  3G9G A;  4CGD A;  4JI7 K;  2F7R A;  4I43 A;  4KTW A;  1IKX A;  2ASO A;  1CZB A;  3PV8 A;  2QA4 N;  3CM6 A;  3F9K A;  1NGH A;  2UXD K;  4I7F A;  3ZT2 A;  3MAQ A;  4PWD A;  1TQV A;  3SBS A;  2Q2R A;  5AQN A;  1BWF O;  3ID8 A;  1O1W A;  3O08 A;  3A5L C;  3JYT A;  3CCR N;  4OKJ A;  4JKC A;  3MX2 A;  4JI2 K;  4FK2 A;  4BE2 A;  5AQT A;  2Q12 A;  5BPN A;  5C5B B;  5DM6 L;  1XNQ K;  3HAJ A;  3DYT A;  1N8R O;  4BRE A;  5AQR A;  4MFB A;  5HBM A;  1QVF M;  1OH5 A;  3VF6 A;  4CF0 A;  3QNO A;  3SUQ A;  1FKO A;  2P9S B;  3M8Q A;  4DR7 K;  4DFK A;  2YNI A;  3HXM A;  2Q0R A;  5JVH L;  3K9K A;  1U48 A;  4IW0 A;  3AVN A;  4YOY A;  4I9Q A;  4XEI A;  4AH9 A;  4DV6 K;  3KWG A;  4NLB A;  2P9P A;  4EZV A;  2WYH A;  2NRR A;  5I9E B;  4AIL C;  4Z0U A;  3V9Z A;  4E89 A;  4ICL A;  1K8K B;  1RBU A;  1LCU A;  1QQC A;  1IV0 A;  3KAV A;  1VSL A;  2E8A A;  2VYP A;  4H5W A;  3PIP L;  1HLU A;  4GVM A;  2WBN A;  1HTY A;  4ATM A;  4CEQ A;  4BG8 A;  5J2P A;  2ZGY A;  2KQ2 A;  4C8M A;  1SU8 A;  1YJ9 N;  1I94 K;  4X62 K;  3Q0K A;  3AGK A;  1C0T A;  2X78 A;  1NJZ A;  4FK0 A;  3THY B;  5M1N A;  3HM9 A;  4CJE A;  1DGK N;  1LWE A;  2GEM A;  5LJW A;  4EZ6 A;  5AQI A;  5KPR A;  3D50 A;  1YJN N;  4HHT A;  3SMP A;  4JI6 K;  3VQA A;  2WYI A;  3IRX A;  4CIF A;  4NSW A;  4DG1 A;  4ILI A;  1Q9X A;  3EEQ A;  4FPB A;  4BAC A;  2FF6 A;  4H4M A;  1YF5 L;  1TQW A;  2QXL A;  3J7Y P;  4CEC A;  2QKB A;  3DYA A;  1LW0 A;  1L3U A;  5AQU A;  1VQ7 N;  1BL3 A;  5M1P A;  4BR0 A;  3SQ1 A;  2FSJ A;  1NMD A;  2F7T A;  3LWL A;  3OS1 A;  1U6Z A;  3VTH A;  2Q36 A;  3LDS A;  1DEJ A;  1RT3 A;  1TUU A;  4FYD A;  1SUF A;  1G99 A;  1RDC A;  4FM3 A;  3I04 A;  3BUI A;  3D4Y A;  5AQK A;  4A62 A;  2HST A;  2IIR A;  1KAZ A;  4AHR A;  1SL1 A;  3KK3 A;  2HHH K;  2UXB K;  3CCS N;  2RHK A;  4JL9 A;  2NNW A;  1Q82 O;  2P9L A;  4BC3 A;  1BUP A;  1HNI A;  3C0B A;  5JIC A;  4JK7 A;  3DAW A;  4M3W A;  3CD6 N;  1J54 A;  5FPM A;  2RAI A;  4WQ5 A;  3EKU A;  5AQL A;  1ZYQ A;  4BRN A;  5C15 A;  5GIN A;  2OBL A;  2E2Q A;  3IAY A;  1TL1 A;  4R79 A;  1S5J A;  3EN9 A;  3UKR A;  4K0K K;  4KHN A;  3QNI A;  3KDR A;  2W6K A;  1FKP A;  4HCC A;  4M41 A;  3ENB A;  3ZEF A;  3D2E B;  3D7E O;  4CES A;  2QWL A;  1ZBS A;  4JK9 A;  2RPI A;  4KHP K;  1K8K A;  1WLJ A;  5HRS A;  5SWM A;  3OYJ A;  3CJC A;  4K8X A;  3HI0 A;  3BVV A;  3HYF A;  3LDQ A;  4AM7 A;  3M6G A;  4AHT A;  1IKY A;  3G0Z A;  4CCH A;  2XY7 A;  4ELU A;  1QTM A;  4IXC A;  4M7Y A;  4DS5 A;  2PY5 A;  2D5R A;  4Z94 A;  3NH1 A;  2YHA A;  4CVN E;  1RDB A;  4A59 A;  5TKW A;  1VHX A; 
#chains in the Genus database with same CATH homology
 3L0Q A;  3T46 A;  3ID6 A;  2HF3 A;  2CGL A;  3B52 X;  3A5M C;  3WT0 A;  2QWR A;  2WUS A;  1MA9 B;  5F1X A;  3D2F A;  1SQK A;  3TSP A;  2OP6 A;  2E1Z A;  2NRH A;  5FIG A;  3OBY A;  5GIO A;  4K42 A;  1BG3 A;  3I33 A;  3RSE B;  3AAP A;  2NRT A;  1NBW A;  3VEZ A;  4DCH A;  4LC9 B;  5AZI A;  1DKG D;  1BDG A;  3ENO A;  2P9U A;  3MN5 A;  2YX6 A;  5HL7 L;  4IM2 A;  3CJ7 A;  4BRD A;  4ILH B;  1JCG A;  1GLD G;  3H46 O;  4BRF A;  4CZJ A;  3CCQ N;  1OAO A;  3O3O B;  5FPD A;  2A40 A;  3VEX A;  3SAF A;  3KHY A;  1T44 A;  4K41 A;  3EE9 A;  4BRG A;  3GDQ A;  1W97 L;  5EX5 A;  4IJN A;  1VQM N;  3I56 N;  4EZT A;  2GTD A;  3CJB A;  3CCJ N;  4H5R A;  4JD2 B;  2PBD A;  1WUA A;  2E2O A;  2ASM A;  2NRZ A;  4BRA A;  4C1N I;  2YJE A;  3RVC A;  2P9U B;  1VQK N;  1E9V A;  3CC4 N;  3DXM B;  4BR9 A;  3MCA B;  3N4Q A;  5JVG L;  4NO7 A;  1P90 A;  1NGC A;  1S3X A;  3O1B A;  1GNT A;  1OVY A;  4HR1 A;  1CKR A;  5BRE A;  5AQQ A;  4JKD A;  2VCP A;  4WFB L;  1ATS A;  3VPZ A;  1KC8 O;  3QFU A;  1BO5 O;  2HBJ A;  4F00 A;  3P39 A;  3L4I A;  2IVO A;  4BC5 A;  1NGA A;  4IEE A;  2QWM A;  4KH6 A;  2QWP A;  2LM0 A;  4JKA A;  3VER A;  4EZO A;  3CJ1 A;  4PKI A;  4BGB A;  4EZQ A;  4CZM A;  4NLC A;  4G9Z A;  4H0X B;  2V7Z A;  1YVN A;  5AQJ A;  2N3K A;  5AQY A;  4B1Y B;  4ISF A;  4CD3 A;  3FLC O;  5EY4 A;  1RGI A;  1NJI O;  3CQY A;  5AZJ A;  1JJ2 M;  1NGD A;  3DQG A;  4IM3 A;  2FLO A;  1GLE G;  4ISG A;  5AQV A;  4HWI A;  3VEO A;  4BC2 A;  3GI7 A;  1Z6R A;  1QQO A;  3CI5 A;  3ER9 B;  3MCP A;  5AZJ B;  3O9T A;  4BG9 A;  4CZG A;  2GEL A;  2GUP A;  3VF2 A;  3FZM A;  3WXI A;  1JCF A;  5C2F A;  4BRI A;  2JWK A;  3FFK B;  2E88 A;  2YHX A;  2E20 A;  3O80 A;  4JKB A;  3FGU A;  4EZZ A;  3EKS A;  1BA1 A;  4H0O A;  3UE5 A;  5MLC Q;  3GOI A;  4R5G A;  3ZET A;  5FPE A;  4EZR A;  3BP8 A;  4ILG A;  4JKG B;  4EFH A;  2E2N A;  2QWQ A;  2CGK A;  1R59 O;  3O9Q A;  2ND1 A;  4IWV A;  2FSN A;  5B8H A;  5F0X A;  4FOI A;  2ZGZ A;  4QS9 A;  1YHQ N;  2WFB A;  4UDY X;  2H3G X;  4R5I A;  4FO0 A;  4IDH A;  3IUC A;  4M7X A;  3WUH A;  3W0L A;  4BQZ A;  5AQS A;  3D6R A;  3CCL N;  3VET A;  3N8E A;  2D1K A;  3CCV N;  2WC9 A;  3QFP A;  3DXM A;  4ISE A;  1SAZ A;  3O6W A;  1QVG M;  3WXK A;  4OO1 J;  3LM9 A;  2NRV A;  3M3Z A;  4BR2 A;  5C10 A;  4IOC L;  3F5T A;  4YOR A;  3R1X A;  2EWF A;  1MDU B;  1VQL N;  3RV1 A;  3G71 N;  3TTF A;  4JHD A;  5EOY A;  1HKC A;  3O9U A;  4CZI A;  1YI2 N;  5GAH P;  3DPP A;  4MO5 A;  3LDO A;  5AQM A;  4ILJ A;  3IFR A;  2P9K A;  2YHY A;  1T3V A;  4CZF A;  4EZS A;  2FXU A;  2NRX A;  5AZI B;  3C7N A;  1QQM A;  3FZF A;  3WQU A;  3ZYY X;  4MQD A;  3QB0 A;  3OHX M;  4J8F A;  3T49 A;  1NWK A;  3T7Z A;  3GBT A;  5KPZ A;  3LDN A;  3WEE B;  1C0G A;  1NGG A;  3O3N B;  2OTL N;  3GG4 A;  3WXJ A;  2PFU A;  3SK3 A;  2BH1 A;  1NGF A;  3M1F A;  4Y0W A;  4EZU A;  3SMS A;  3T47 A;  3VEY A;  1VQO N;  4JWC A;  4M0M A;  3O8M A;  3ZX0 A;  4WQ5 C;  1U00 A;  1DKY A;  3E9O A;  2QW9 A;  4FWQ A;  3ZX3 A;  2A41 A;  3K9J A;  4CJ7 A;  4EHT A;  4YOV A;  3B8A X;  3CQX A;  3LDP A;  3CPE A;  2BPR A;  4RTF D;  4L3Q A;  4MLE A;  4A61 A;  4AF1 A;  4D8J A;  4BGA A;  3DPO A;  4IOX A;  4H0V B;  2P9N B;  5H1S Q;  4YOX A;  4MDA A;  3KZB A;  4XH1 A;  4FWS A;  3C6A A;  4FWO A;  4H6H A;  3EO3 A;  3OWG A;  4R5J A;  4FPA A;  5GAD P;  3H1V X;  3UIT A;  1NGI A;  1QZ5 A;  1GLC G;  3T48 A;  3MK6 A;  1SZ2 A;  3F9M A;  4XH5 A;  3U4L A;  5FPN A;  1GNL A;  3UKU B;  4JEP A;  2YIA A;  2EX3 B;  2D0O A;  3R3L A;  3VGM A;  1XQS C;  3DOB A;  4BEC A;  5GIP A;  5AQP A;  2HF4 A;  3HM8 A;  2AA4 A;  4CZE A;  1T6D A;  3FE1 A;  3CMA N;  1KD1 O;  5LJV A;  4GNI A;  3H6E A;  4CZL A;  4IO9 L;  1YAG A;  4BRM A;  3CC2 N;  1X9J A;  2BUP A;  1Q5L A;  4FWR A;  1ATR A;  3U8X A;  1QHA A;  3MX5 A;  4BRL A;  1HPM A;  2HBL A;  4CBW A;  1VQ4 N;  2NLX A;  2D0P A;  4KBO A;  4YOT A;  4F01 A;  3O1W A;  1MWM A;  4JKH A;  5C0Y A;  2UYT A;  1KAX A;  3SBG A;  4WFN L;  4WFA L;  3O5B A;  4QS8 A;  3U9Z A;  5BRF A;  3EE8 A;  1Q81 O;  2W40 A;  2IVN A;  3H0X A;  4OPA A;  3VEW A;  4GV3 A;  3SAH A;  1QQN A;  2AP1 A;  5AR0 A;  3O9R A;  2ZJQ L;  2KHO A;  4E81 A;  4BR5 A;  5ADX H;  2PAV A;  1IG8 A;  1W2B M;  3GE1 A;  1Q18 A;  3CF5 L;  2P9I B;  1YIJ N;  1YJW N;  4KH4 A;  1JQK A;  1Z05 A;  2P9L B;  4DQ8 A;  5M1Q A;  1VAZ A;  1GLB G;  1P8Z A;  2VWB A;  3TTC A;  3SBT B;  3J7Z O;  2RE2 A;  4BC4 A;  1VQ6 N;  4PL8 A;  1VQ9 N;  4EZX A;  4B1W B;  4JNF A;  4JAX A;  2JNS A;  2WIN M;  1IJJ A;  3G4S N;  1NM1 A;  4EZW A;  4BRK A;  4CD1 A;  1VQN N;  3LDL A;  4IEI A;  3E1Y A;  2NCZ A;  4BRO A;  2P9K B;  2YIB A;  3H1Q A;  4B1V A;  4BRC A;  5BPM A;  3AAQ A;  5E84 A;  4JHD B;  4PKG A;  1T6C A;  4AM6 A;  2V51 B;  3CME N;  5AQF A;  4PL7 A;  3EL2 A;  4GY2 B;  4EIA A;  4YDU A;  4H6I A;  4GV9 A;  3E9P A;  3ZEU A;  4R5L A;  3L3O M;  3VEA A;  3CJ9 A;  3TTD A;  3DXK B;  2A42 A;  3ATU A;  1ZC6 A;  4CZK A;  4O8K A;  4BY9 C;  3G25 A;  3B51 X;  2Q31 A;  4OPH A;  4U7B A;  1HJO A;  3HTV A;  3CJA A;  4BE7 B;  3ZET B;  1XC3 A;  1ATN A;  1XUP O;  3P38 A;  3UB5 A;  4PKH A;  1E4F T;  4HYB A;  3BF3 A;  3C6H A;  3LM2 A;  3ENH A;  4I6M A;  5F2R A;  3VES A;  2I7P A;  1BPR A;  4E1J A;  1K8A O;  1ZYL A;  2QTD A;  1UPX A;  3ATV A;  3BEX A;  3T4A G;  2Q97 A;  3A98 A;  2JWL A;  4JK8 A;  4JKF A;  3TSQ A;  4BVP A;  5BRD A;  3DPQ A;  5CHI A;  1KQS M;  3BF1 A;  2NZT A;  1BU6 O;  1NLV A;  3O4W A;  4WF9 L;  3HOS A;  1U2V A;  3KVG A;  5BN8 A;  3CCU N;  2IVP A;  4YOU A;  4IM0 A;  4CZH A;  4JNE A;  1E4G T;  4EHU A;  4NPH A;  2BTF A;  3QBX A;  3VMF B;  3SAG A;  3C65 A;  3ZX2 A;  2QWN A;  4B1Z A;  2DPN A;  3SLC A;  4BR4 A;  5JMV A;  2YI8 A;  4H5V A;  5C12 A;  1HX1 A;  5DM7 L;  1M1K O;  3CCE N;  5KQD A;  5ELZ A;  5FPM A;  4IWO A;  5M1O A;  4MLH A;  4WV7 A;  4ILG B;  4IJA A;  4B9Q A;  3OA9 A;  3ERC C;  4B1U B;  2YJF A;  2YIV X;  2HBM A;  4FWM A;  1V4T A;  2QEX N;  3R6M A;  3HSC A;  4YOW A;  4I43 A;  2QWO A;  1KXP A;  1U2V B;  3VGL A;  2ASO A;  4HTL A;  4DHY A;  2QA4 N;  4UDX X;  2P9P B;  4JLC A;  3PIO L;  1NGH A;  3E66 A;  4WYB A;  2CH5 A;  3MN9 A;  3SBS A;  3ULE A;  3MN6 A;  3B53 X;  2Q2R A;  2YI1 A;  5AQN A;  1BWF O;  3ID8 A;  3TU5 A;  5E26 A;  3WQT A;  3QBW A;  1Q7Y O;  2P9S A;  2Q0U A;  3A5L C;  3O08 A;  3QDK A;  4MDB A;  3CCR N;  3QIC A;  4H03 B;  1SU7 A;  4JKC A;  3MX2 A;  4ILH A;  3DJC A;  2YI9 A;  3A5O C;  1M90 O;  3MMV A;  1KAY A;  4NB4 A;  4YDU C;  5AQT A;  5BPN A;  5DM6 L;  3D2F B;  4HR1 B;  3DXK A;  2QI2 A;  4K43 A;  1DT9 A;  3ZEU B;  1N8R O;  4BRE A;  5AQR A;  1QVF M;  4JD2 A;  3VF6 A;  2KKZ A;  2P9S B;  3O9S A;  4GV6 A;  1E2U A;  5HOO A;  1GLA G;  1NGE A;  2ASP A;  2Q0R A;  3QML A;  5AQZ A;  5JVH L;  1YUW A;  2VGM A;  3K9K A;  4IW0 A;  2OBM A;  4YOY A;  4CBX A;  5LY3 A;  2ZJP L;  3ULE B;  5AFU A;  4FVU A;  4XEI A;  3P31 A;  3MN7 A;  4FWP A;  5JLH A;  3KWG A;  3I39 X;  3MWT A;  2P9P A;  3HZ6 A;  4EZV A;  2NRR A;  4NLB A;  4A2A A;  3RV0 A;  2ZJR L;  3F7W A;  2A6A A;  5KQ8 A;  1TYQ A;  3RSE A;  5I9E B;  2F9W A;  5AQO A;  2C1I A;  1J6Z A;  3MWP A;  4FL9 A;  5M1F A;  3VEN A;  2PY6 A;  1ILY A;  1EO1 A;  1RDU A;  3CC7 N;  4XJX A;  1K8K B;  3W3D A;  2ND0 A;  4FOE A;  4H0T B;  1LCU A;  1S72 N;  3QA8 A;  3KAV A;  4FWL A;  4DKW A;  2E8A A;  3EZW A;  4C23 A;  2VYP A;  4JKE A;  2I7N A;  2P9I A;  1DKZ A;  4H5W A;  3VKH A;  4RCH A;  5BN9 A;  4BRQ A;  3PIP L;  4H0Y B;  3CXC M;  3D2E A;  1HLU A;  3CET A;  4F9O A;  1X3N A;  2A3Z A;  2WBN A;  3E9L A;  3VEB A;  1GLF O;  3VGK A;  5CE3 A;  3FZL A;  1LOT B;  3OBW A;  1VQP N;  3F2K A;  4BG8 A;  1OA0 A;  2ZGY A;  3BUZ B;  4A5B A;  1SU8 A;  1YJ9 N;  3DWL A;  2GX9 A;  4WQ4 A;  4UY8 O;  3AGK A;  4O8U A;  1OKJ A;  2GAF D;  3DLL L;  3HRG A;  1S22 A;  4H0P A;  5AFU H;  4KIK B;  2HMP A;  3GL1 A;  3IKM A;  3VTI A;  2E1Y A;  5M1N A;  4MO4 A;  3LMF A;  3CER A;  5FLE X;  3L4Q A;  3L6Q A;  1DGK N;  4I6M B;  4IZ9 A;  2GEM A;  4FSV A;  5LJW A;  5AQI A;  5KPR A;  2D4W A;  1YJN N;  3P4I A;  2RT6 A;  4H5T A;  5AQX A;  4IOA L;  2ZWH A;  3AGR A;  3JXU A;  1YIT N;  3SMP A;  3S41 A;  2CH6 A;  3HBT A;  4M63 C;  4EZN A;  1JCE A;  2Q1N A;  2QM1 A;  4PO2 A;  1TUY A;  3CPW M;  4ILI A;  4K25 A;  4FPB A;  3QNJ A;  4U67 L;  3AY9 A;  2FF6 A;  1YF5 L;  3Q7C A;  3UKR B;  4B1X B;  2A5X A;  1WOQ A;  1MJG A;  4BRP A;  1VQ8 N;  2QXL A;  2EWS A;  4EAH D;  2P9N A;  5AQW A;  5GAE P;  4A2B A;  2E2P A;  1HUX A;  4O5F A;  1C0F A;  5AQU A;  3H3N O;  5C2D A;  5ADX A;  3HOT A;  2OAN A;  5M1P A;  4BR0 A;  1VQ7 N;  4H5N A;  4PHT X;  2W00 A;  2V52 B;  2HOE A;  2FSJ A;  2GWJ A;  2ITM A;  1NMD A;  3TSU A;  4BRH A;  2F7T A;  3LL3 A;  2HBK A;  3KWI A;  1U6Z A;  3WXL A;  3VTH A;  5JLF A;  2Q36 A;  1MWK A;  2F9T A;  1DEJ A;  1NGJ A;  1TUU A;  2KLA A;  1SUF A;  3CHW A;  3A5N C;  1G99 A;  3FR0 A;  4FM3 A;  3I04 A;  3J8A A;  5EVZ A;  5BR9 A;  1BOT O;  2NRW A;  4RWT A;  4EZP A;  5AQK A;  4A5A A;  2Z8Y A;  4A62 A;  2HST A;  1SS6 A;  2IIR A;  3A8Y A;  1KAZ A;  5TKY A;  3WEE A;  1DG4 A;  3CIP A;  4QS7 A;  1Q86 O;  1ZXO A;  3C7N B;  4CI6 A;  3FD9 A;  2W41 A;  3N4P A;  2RHK A;  3OHR A;  4JL9 A;  3SBT A;  2NNW A;  4E3C A;  3CCS N;  1Q82 O;  1VQ5 N;  3O3M B;  2P9L A;  1HKB A;  2VGN A;  4WQ4 C;  4IO8 A;  1BUP A;  4BC3 A;  3FZK A;  4JWI A;  3C0B A;  3I8B A;  5JIC A;  4JK7 A;  3DAW A;  3CD6 N;  4WV5 A;  3JS6 A;  3TPQ A;  3MDQ A;  3AAR A;  1Y64 A;  4WQ5 A;  2FF3 B;  4IWP A;  3EKU A;  5AQH A;  4FWK A;  4KIK A;  1QZ6 A;  3IDH A;  7HSC A;  5AQL A;  4A57 A;  2OBL A;  4BRN A;  5C15 A;  5GIN A;  4R5K A;  2E2Q A;  1NGB A;  4XH4 A;  3T69 A;  1CZA N;  4HY9 A;  1DKX A;  4CBU A;  4R79 A;  1X3M A;  3EN9 A;  1E1D A;  4FWN A;  1HKG A;  3UKR A;  4BR7 A;  4JWD A;  1O13 A;  3KDR A;  3OW2 M;  4DB3 A;  3ENB A;  2C1G A;  3ZEF A;  3D2E B;  3NVM A;  3IMX A;  1BA0 A;  4IWQ A;  3H45 C;  3U9D A;  2QFF A;  4BQL A;  3ER8 C;  3D7E O;  2QWL A;  4GVE A;  1ZBS A;  4JK9 A;  1GLJ O;  4JKG A;  3PLA A;  1V4S A;  3Q7B A;  3WXM B;  3KK7 A;  4C1N K;  5KPT A;  1K8K A;  4IFE A;  3I01 A;  4JN4 A;  1RFQ A;  4KH5 A;  4BVO A;  3M5R A;  3CCM N;  3UKU A;  1K9M O;  1K73 O;  3SJH A;  4BEB A;  3R9P A;  1GN9 A;  3FZH A;  3CJC A;  1YXQ A;  3H3O B;  2ZF5 O;  1GLL O;  5GAG P;  5BRH A;  1D4X A;  1TYQ B;  1RDW X;  3HI0 A;  5BPL A;  2GA9 D;  2YCH A;  3KAW A;  2V7Y A;  3R8E A;  1SU6 A;  3LDQ A;  4G6Q A;  3M6G A;  2FSK A;  2GWK A;  3VOV A;  4AM7 A;  4WCE L;  2CGJ A;  3G6E N;  5M1K A;  3VEV A;  3NVK A;  2YHW A;  3ZED A;  4IXC A;  1W9M A;  4EZY A;  1EQY A;  4M7Y A;  4Z94 A;  5EXW A;  3I55 N;  2J4R A;  1H1V A;  2X5C A;  5AQG A;  5CR4 A;  4JWE A;  3A0I X;  4A59 A;  1OA1 A;  1ESV A;  3VF4 A;  3NMU A;  2OTJ N;  5TKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...