4JNEA

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
b'SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hsp70 CHAPERONE DnaK
publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jneA05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jneA04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jneA03
4B1XB 4CBUA 2ITMA 5AQFA 2FXUA 3W3DA 3T47A 2NRHA 1OKJA 5AQVA 2QWPA 3EKUA 3ENHA 3BUZB 3MN6A 1RDWX 3QFPA 4BC3A 2NZTA 2ZGYA 2I7PA 1TUUA 2GTDA 3A0IX 4PKHA 2YHWA 2KHOA 2YJFA 4R5KA 1NWKA 5AQJA 2E20A 1CZAN 2F9TA 3EO3A 3T49A 3RSEB 1GLJO 1XQSC 1S3XA 3C7NB 2HOEA 5AQRA 4CZIA 4JWIA 2P9KA 2V51B 3LDOA 3VEXA 2H3GX 2A40A 2YHXA 2YI1A 3CQYA 2BUPA 2UYTA 2Q2RA 2QW9A 1KAXA 4BRNA 1SQKA 2A5XA 3DJCA 1BPRA 1DGKN 3I8BA 3A8YA 3KZBA 5EOYA 3T4AG 5AFUH 5BN9A 1LOTB 1NGGA 1JCEA 4FWNA 5F0XA 2D4WA 3ZX0A 3H3NO 5AQKA 5JMVA 4DHYA 3ENOA 2NLXA 3JXUA 4WQ4C 4R5GA 3VESA 1U00A 4EZRA 5JICA 5BRHA 2GEMA 3CERA 1EQYA 5AQIA 1NGIA 3ZX3A 2BTFA 3QFUA 1DEJA 1V4SA 4BVPA 1MWMA 2ZGZA 4H0TB 3M3ZA 1WOQA 4B1WB 1WUAA 3LM9A 5AQLA 3ULEB 1JCFA 4MLEA 3VF6A 4BRDA 2E8AA 1HPMA 4EZXA 2A3ZA 4HWIA 4IXCA 2QWRA 3HBTA 5AR0A 2P9IA 4JNFA 4HTLA 2OANA 3QICA 2F9WA 2FLOA 2E1YA 3MK6A 3VGLA 5EXWA 4M7XA 2Q31A 3B8AX 1CKRA 3UKRB 4JWDA 4BR0A 3DWLA 3FLCO 4K41A 5KPTA 4BRLA 3ZETB 4PL7A 4HY9A 4WV5A 1E4FT 4JD2A 1Q18A 2ZF5O 3EKSA 3VF2A 2PAVA 2QWQA 1BO5O 1NGCA 3AAPA 3DXMA 3JS6A 2QM1A 2Q36A 1NGFA 2DPNA 3I33A 2IVOA 4A2AA 3LDPA 3AAQA 1C0FA 4WQ5C 5AQZA 3WXKA 4H5VA 3WEEA 4E1JA 4QS9A 1QHAA 4FOIA 2QWOA 4EZPA 4EZWA 4BR5A 5JLHA 5EVZA 3WT0A 2HF4A 3UKUA 1TYQB 4CZEA 1KAZA 4DB3A 4BC5A 5AFUA 4FWRA 2P9PB 4F01A 5BRDA 4ISGA 4CI6A 4FSVA 4B1VA 3AARA 3ATUA 1RGIA 1GLDG 2ASPA 4EZZA 3WQUA 4BRKA 1XUPO 4A61A 1KXPA 3FFKB 4JWCA 3WXIA 2P9PA 3GE1A 3O80A 4BG8A 4F00A 4FWLA 3D2EA 4BRCA 4CZJA 1DKYA 3EN9A 4H5NA 4K43A 3R9PA 1U6ZA 4IWVA 1E4GT 1YAGA 5AQPA 2A6AA 4PL8A 1HUXA 4F9OA 3VEVA 5AQWA 3GOIA 3C0BA 4H6HA 1KAYA 3LL3A 5KPRA 4RWTA 2D0OA 4FWOA 2YCHA 4O8KA 3VEZA 4DCHA 4FO0A 5AQMA 3VETA 2D1KA 4WQ4A 2P9KB 4M63C 4B9QA 1C0GA 4IJNA 1YXQA 4B1ZA 3DPQA 4H6IA 4MO4A 3H3OB 1MA9B 1SZ2A 4WYBA 4KBOA 1BA0A 5AQNA 1NGHA 1ATSA 4I6MA 3CIPA 3M6GA 4JN4A 2PBDA 1LCUA 3H0XA 5AQQA 4K42A 3OHRA 3BF1A 4RTFD 3LM2A 3O8MA 2D0PA 3KHYA 3MN5A 3QDKA 3FZMA 1NGDA 2E2QA 2YHYA 1QQMA 2Q0RA 2V7ZA 5AQUA 3HI0A 3UE5A 4BC4A 1H1VA 2QWMA 5F2RA 3HM8A 5E84A 3EZWA 4EHTA 4FPAA 4GY2B 3CJ7A 3A5OC 4A2BA 5ADXH 4FL9A 2ASMA 3HZ6A 3O5BA 3CJ1A 5KPZA 3SJHA 3MDQA 4CBWA 5LJVA 2ASOA 3VERA 3UB5A 3O4WA 3VPZA 3DQGA 3D7EO 4CZLA 4BR9A 2CH5A 4WQ5A 4BRAA 2P9IB 3W0LA 1T6DA 3ZEUA 2WINM 4CZMA 2E2OA 4EZUA 3QNJA 3T48A 2E1ZA 2AA4A 2I7NA 3VGKA 3VEWA 5BR9A 3VF4A 3IUCA 4BRIA 4IJAA 4EZYA 1ATRA 3U9ZA 4FOEA 4BG9A 5CE3A 1YUWA 4JD2B 3DXMB 3FZHA 3HSCA 1T44A 5LJWA 4XH1A 3FGUA 4BROA 2E2PA 4WV7A 1IJJA 1RFQA 2EWSA 5AQYA 4BVOA 1YVNA 5BPLA 1Q5LA 1BDGA 3H1QA 3WEEB 2P9NB 3DPOA 5AQSA 4RCHA 3WXLA 3SMSA 4EHUA 3QBWA 1GLBG 3BP8A 1ZXOA 3GL1A 4FPBA 3VENA 3SLCA 3UKUB 4PKIA 5E26A 3S41A 3TU5A 4BGAA 2P9NA 3D2FA 3A5NC 3L6QA 2P9LB 5KQ8A 2FSKA 4HYBA 4H0XB 3HTVA 4IZ9A 5EY4A 1HKBA 4YDUC 2QWNA 1X3MA 5BN8A 1T6CA 2W41A 3ZX2A 2P9LA 3ATVA 7HSCA 4XH5A 2IIRA 3D2EB 3FZFA 2GUPA 3H6EA 1HLUA 2QFFA 1ZBSA 2WUSA 5I9EB 4AM7A 1GLLO 2VYPA 4BRGA 4GNIA 3VEOA 3IDHA 1GLCG 4A62A 5BPMA 1BU6O 4BQZA 5ADXA 2A42A 3WUHA 4E81A 3WQTA 1K8KA 2HF3A 1HKGA 4R5LA 3VOVA 4LC9B 3MMVA 1BA1A 4R5JA 1NLVA 2YJEA 1GLEG 4BC2A 3CQXA 3O08A 3WXJA 1DG4A 4AM6A 3A5MC 1V4TA 4EIAA 5JLFA 4I6MB 2Q1NA 4JHDA 3IMXA 1S22A 2P9UA 3DXKA 3VEYA 3N8EA 4M7YA 3O1BA 3A5LC 1NGBA 4CBXA 1HKCA 3MN9A 3CJ9A 3CETA 4EZNA 4EAHD 2CGLA 2P9SA 2VCPA 5AQOA 1GLFO 4JAXA 5LY3A 3LDNA 4BR4A 4O5FA 1NGAA 3SK3A 1SAZA 4ISEA 4CD3A 4PKGA 4PO2A 3L4IA 4QS8A 4Z94A 2J4RA 1X9JA 1QQOA 2QWLA 3QMLA 5AQXA 3R8EA 2FSNA 3ID8A 4BREA 3CJCA 1NBWA 1IG8A 1QZ6A 5TKYA 4IO8A 2BPRA 4CJ7A 4H0OA 5BREA 3G25A 4JWEA 1P8ZA 4BRPA 4H5TA 3T46A 4MO5A 4MLHA 1D4XA 3OHXM 3U9DA 3ZEUB 3RSEA 3H1VX 4R5IA 3QBXA 3C7NA 2GWKA 5FPDA 1XC3A 4NO7A 4Y0WA 4CZHA 5AQTA 2FF6A 2ZWHA 1NGEA 5AZJB 3MN7A 3U8XA 4H0VB 2VWBA 2HMPA 4FWPA 3DOBA 3L3OM 4BRQA 4ISFA 1Z6RA 3GG4A 5FPEA 5AZJA 4YDUA 1JCGA 1Z05A 4BRMA 5BPNA 4XH4A 4B1YB 4BRHA 1TUYA 4BR2A 2FSJA 1HX1A 4K25A 1J6ZA 3LDQA 3VGMA 4H5RA 5FPMA 3BEXA 5F1XA 3EL2A 2A41A 5ELZA 3FE1A 1G99A 2Q0UA 3D2FB 2GWJA 5AZIB 4C23A 2Q97A 4EFHA 4NB4A 1X3NA 1QQNA 3KVGA 3FZLA 1U2VB 1Y64A 4H03B 5BRFA 2AP1A 1ESVA 4BR7A 4DQ8A 4H0PA 4B1UB 3ULEA 4QS7A 5AZIA 2FF3B 2CGKA 1ATNA 3LDLA 1MWKA 2CH6A 2V7YA 1BUPA 1U2VA 4EZVA 3J8AA 4CZKA 3CI5A 2E88A 4EZSA 3H46O 3CJAA 4XEIA 3MCPA 5EX5A 2OP6A 4L3QA 1DKGD 4J8FA 3UKRA 2IVNA 3CJBA 5AQGA 3O1WA 1K8KB 1DKZA 5FPNA 3GDQA 2CGJA 5B8HA 1QZ5A 4CZFA 4BRFA 1DKXA 3F9MA 2IVPA 3O6WA 3ZETA 2GELA 3M1FA 3AY9A 3H45C 4H0YB 5AQHA 1NM1A 5KQDA 1NMDA 4BGBA 3L0QA 4FWKA 4FWSA 3FZKA 1GLAG 3P4IA 2E2NA 4JHDB 4CZGA 2P9UB 3DXKB 3R6MA 4FWQA 1ZC6A 2V52B 4BQLA 3IFRA 2W40A 1NGJA 1BWFO 3BF3A 3GBTA 4JNEA 1TYQA 1MDUB 4CD1A 2QXLA 3QB0A 3CHWA 3U4LA 4EZQA 2P9SB 3SMPA 1BOTO 1BG3A 4H5WA 4EZTA 3TPQA 4EZOA 3DAWA 4FWMA 3DPPA 1HJOA 1R59O 3FR0A
chains in the Genus database with same CATH superfamily
2ZJRL 4CVNE 5AQFA 5IWAK 4BE2A 2O8BA 3DRSA 1Z25A 4Z4EA 4BE1A 5D3GA 2LXYA 1U47A 2GX9A 3EKUA 3KLEA 3LZIA 4LF8K 3ENHA 3M3WA 4BC3A 2I7PA 2WBNA 1ASVA 3A0IX 4NLBA 1B9DA 4PKHA 2BANA 3S9HA 4FJKA 2HHXA 1E2UA 2F9TA 2Z8YA 1YT3A 1A5WA 1QSLA 1XQSC 5AQRA 1FK9A 3RPMA 4B9VA 4JWIA 4YOUA 2V51B 3CCUN 3Q84A 2YHXA 1TAUA 4IKFA 1RTJA 1Q7YO 3NGIA 3V9XA 4IFVA 4B8CA 4CJQA 1LWCA 4KREA 4DTMA 3DDGA 1RT6A 4HUEA 1WSJA 5AFUH 2V0OA 2Z1HA 1KVBA 1NGGA 5MLCQ 3BVWA 2D4WA 4AQYK 4F2SA 3VQ9A 4CIEA 2ND1A 3ER8C 1NNEA 5C15A 1U00A 3P1GA 5BRHA 1SL0A 2B4JA 3P31A 1WN7A 4HCCA 1VSKA 4H8KA 4IO9L 3ZX3A 2BTFA 2WYHA 4CEAA 4H0TB 3K57A 3M3ZA 1IBKK 3HL8A 4B1WB 3MX5A 4DR5K 2HHHK 4YOYA 5C0YA 4M45A 3WNGA 3JYTA 3M8RA 1MU2A 2A3ZA 4IXCA 2C08A 2QWRA 4E3CA 4ID5A 5HBMA 3QEVA 2OANA 3LWLA 1VSJA 3ZEFA 1W9MA 1WB9A 2HHVA 2VGNA 2E1YA 4M3WA 4M7XA 2Q31A 1LWFA 3DRRA 2EFKA 1NK7A 3UKRB 2ATQA 1N34K 4GMJB 4BR0A 3DWLA 1K73O 1EX4A 3K0SA 3AVMA 4PL7A 1E4FT 3VF2A 4JD2A 3TAQA 3RMDA 5J2MA 1BO5O 3CC2N 4LD0A 2Q36A 2IVOA 3O9UA 3AAQA 4WQ5C 2DY4A 1I49A 3WXKA 1FW6A 4E1JA 2WYIA 3SUNA 1E1DA 1WDZA 2YL9A 1J53A 3OJUA 4DV2K 4EZWA 5EVZA 4CESA 2HF4A 2HVHA 1TYQB 1OH7A 1IV0A 1P90A 4NXMK 1I4DA 3K58A 4F01A 2OO2A 2IAJA 3CCMN 4B1VA 3HXMA 4FJNA 1WNSA 3ATUA 3O3GA 3D45A 1GLDG 3WQUA 4CJ3A 1KXPA 2P9PA 1MJGA 1HNXK 4F00A 3J7AP 1TQTA 3T19A 2O8EB 3DX0A 4W5OA 5AQPA 3D0PA 3K5MA 5GAGP 1R34A 4F9OA 1E9VA 3C0BA 4DTUA 4FM3A 3A98A 4FO0A 3QEIA 4FJ7A 2X6NA 2D1KA 4JLHA 4M63C 1C0GA 3OYHA 4KBOA 4ILHA 4Y1CA 1M90O 1ATSA 1SV5A 4I2PA 3VQQA 4DMNA 5C2FA 3SBSA 3OYCA 4JN4A 4FLWA 4WCEL 5I42A 3LM2A 2D0PA 1BI4A 3LZJA 1NGDA 4DS4A 3I56N 3O9SA 2PY5A 4X62K 5AQUA 4IG3A 4CHNA 5C12A 4FLVA 1JLGA 4EHTA 2O8CB 5C24A 1T7PA 5ADXH 2UXDK 3WXMB 3CC4N 1YTUA 4DTNA 3CJ1A 2G8FA 1C1AA 3MDQA 3OYGA 3MEDA 3J81O 3O4WA 3DQGA 2WTUA 2X6SA 4BRAA 3EJPA 2UUCK 1T6DA 3ZEUA 4CZMA 3HOSA 4FLZA 4DR2K 1C0MA 3B6OA 5CZ2A 3VGKA 3HPHA 3TSUA 3VEWA 4YOVA 4ZTJA 5BR9A 3NCIA 3LAKA 4IJAA 1XNQK 1VQON 1OH6A 3DYTA 3AVBA 3NDKA 5CE3A 4CJTA 2YI9A 3DXMB 5HROA 3I0RA 4KH5A 4XH1A 4BROA 4WV7A 3RMAA 1VRUA 4O55A 4DQQA 3S3NA 1LV5A 1Q5LA 4Q5VA 3VQEA 1Q86O 3WEEB 2UXBK 4DR4K 2KFZA 3I39X 4RCHA 3OYJA 4EHUA 3QBWA 1ZXOA 3VENA 3RV0A 4FPBA 4FM2A 3SLCA 4KHUA 4YOXA 4PKIA 3G6EN 5E26A 2RAJA 3TU5A 3AVGA 1O1WA 2JWLA 2OZMA 5KQ8A 3VN5A 2FSKA 1YIJN 1TKZA 4ILGA 3HTVA 1U04A 2QWNA 1X3MA 1O13A 4NQIA 3ATVA 3BZCA 1WBBA 3FZFA 4M3YA 2HMIA 4O0IA 3C95A 1JL2A 1GLLO 2VYPA 3VEOA 5KRSA 4A62A 4KB0A 3AVIA 4CF0A 2QA4N 1TV6A 2NRTA 4I9LA 4DTRA 3LP1A 3SZ2A 1VQLN 3R1XA 3PY8A 3D4ZA 3MXMA 3P5JA 4LC9B 1W97L 3BY5A 4KTQA 4R5JA 1NLVA 1VSHA 3T3FA 3DLBA 1OVYA 2UXCK 3O08A 3ZT1A 1LW0A 4AM6A 3R3LA 1V4TA 2F18A 3CCRN 4DTSA 1T03A 3NFAA 2F1BA 5HLFA 5M1NA 2KZZA 3TAEA 3VEYA 1QSSA 3O3OB 4CBXA 1GN9A 3MN9A 4EAHD 4AHUA 5LY3A 4RW6A 1NGAA 4CJFA 4M3TA 1HQUA 4HR1B 4E72A 4CD3A 4PO2A 1KFDA 4QS8A 3EY1A 4Z0UA 4IBNA 2YKTA 1QQOA 4BDPA 3R8EA 4BREA 1HTYA 3CJCA 1NBWA 5I3UA 1OVQA 2EX3A 3NF8A 3OYDA 4IO8A 4IOCL 3G25A 2RAKA 4JRQA 1I4LA 4LSLA 4H5TA 5HP1A 3SQ0A 3O3FA 3L2VA 3HK2A 3OHXM 2B5JA 5HRPA 4JI0K 3O9QA 3PLAA 5AQTA 2X5CA 3NHGA 3D4YA 1N5YA 4K8XA 1VQ4N 3C65A 4GVMA 5FRNA 3UIQA 2HMPA 4KHPK 3HAHA 2QK9A 2X3WA 1JLQA 4BRQA 4OKJA 4DF8A 1HYVA 3GG4A 4AZIA 2QTDA 3OA9A 4WF9L 3JAMO 4B1YB 4JK9A 4BRHA 2FYVA 3O9RA 4CJUA 1JLFA 1D9DA 3NVMA 4QAGA 4CF8A 1KRPA 1J6ZA 3VGMA 1XC9A 1FJGK 1IKYA 4JL9A 5HRSA 5CYQA 2YNFA 2ND0A 3D2FB 3V9SA 3HSTB 4OO1J 3PIPL 1X3NA 3FZLA 4HHTA 5BRFA 1KLNA 4IEEA 1QVFM 3ZSQA 3CMAN 3CM5A 3S3OA 4H0PA 4QS7A 3DM2A 1I3AA 5J2PA 3BZKA 1OH8A 5HL7L 1BUPA 4LF6K 4DV3K 4MQDA 4I2QA 4CZKA 3CI5A 1GNTA 1CXUA 1VHXA 1N8RO 3OS0A 3VQ7A 4FK4A 3CJBA 3THVA 3CVRA 4M0MA 1DKZA 2IDOA 5C10A 3ZETA 4BWMA 3TAPA 4W5RA 3L0QA 3VMFB 1S72N 4B08A 4FWSA 3FZKA 3LP3A 2YX6A 3G10A 1C1CA 4ID1A 5GADP 4FJJA 3PX4A 4A57A 4EZ6A 3E1YA 2WC9A 1OA1A 2W40A 1BWFO 3KLHA 2O8BB 4JNEA 4JKEA 3AGRA 4DLGA 3OWGA 3NAEA 2OTLN 4EZQA 2P9SB 2YL5A 4EZOA 3DAWA 1IBMK 4FWMA 1QWNA 2G8VA 2X78A 3AVCA 2IS3A 4B1XB 4YNQA 4CBUA 4FYDA 3PSFA 3BVXA 2NRHA 1S9EA 3PV8A 5AQVA 1W2BM 3I8DA 3BUBA 3CC7N 4ZHRA 1NKEA 1N6QA 3NH0A 3S3MA 3BUZB 3BVTA 4IM0A 4ATMA 1RDWX 3C6AA 4NYFA 2NNWA 1JXEA 2ZGYA 2GTDA 4GW6A 4A5AA 3CG7A 4DQSA 2KHOA 4R5KA 5AQJA 1SS6A 3OYNA 1YI2N 3EO3A 3O3HA 3T1HK 3RSEB 3C7NB 1HXKA 2Z0VA 3AO4A 4CZIA 3LDOA 3ZT3A 2WOMA 1NJZA 2XY6A 2KZMA 2O4GA 3P39A 3SAGA 2BGGA 3OYBA 1F21A 1BIZA 2QW9A 4DV5K 4HUFA 4QOZB 2A5XA 3DJCA 3RTVA 1DGKN 4IDKA 1HMVA 3ZEDA 1LOTB 4FWNA 5F0XA 3H3NO 5AQKA 5JMVA 4DHYA 3ENOA 4Z4FA 2Z1GA 4RG8A 4Z4GA 4WQ4C 3L2WA 3T69A 2D0BA 1W0HA 3VQ6A 4AHSA 2JLEA 1NGIA 3ASMA 5M1PA 2B6AA 3HAIA 1V4SA 4BVPA 1NKCA 2ZGZA 1U4BA 1WOQA 1JLBA 3ULEB 4MLEA 4OPHA 3RRHA 1HPMA 3ISNC 2YHBA 3SAFA 5CYMA 4CJEA 1VQNN 4HTLA 1RBRA 3QICA 2F9WA 2FLOA 2F4VK 1TK5A 3MXIA 2Y1IA 5EXWA 2NRXA 2DFHA 4JKCA 4IWQA 4JWDA 3OBWA 3OYEA 4K41A 5KPTA 2UUAK 2QKKA 4GKKK 4ILIA 4HY9A 4WV5A 2ZF5O 3EKSA 2OPSA 2F1AA 1NGCA 1DTQA 4J2EA 2DPNA 3I33A 2KTQA 3THWA 3LDPA 1O7DB 1NK5A 1C0FA 4RW9A 5K14A 1SKWA 3F7WA 4PQUA 4FLXA 4QS9A 5C25A 4FOIA 3AO3A 2QWOA 1VQ9N 4NYNA 3A2FA 1YJNN 4JK8A 1TAQA 4LFBK 2NUBA 4DB3A 3SPYA 3CF5L 3BDPA 2O8DA 4BC5A 4FWRA 2Y1JA 2P9PB 4ISGA 5KRTA 5DM6L 5KGWA 3M8QA 4NLCA 3RVCA 4CF9A 3CMEN 3VKHA 4BRKA 4EZZA 4UDYX 4A61A 1SU6A 3FFKB 3QNIA 3D2EA 4CZJA 3J7YP 4FZXC 4K43A 3NF7A 4DTPA 1S1VA 4IWVA 1ITGA 3LVTA 1YAGA 4CHYA 3OYKA 1X9MA 4O0JA 4AHCA 1ASWA 4C8KA 1ZBFA 1A5XA 1RNHA 3FD9A 2RAIA 5AQWA 1X1PA 3HVTA 4H6HA 3LL3A 4LY7A 5KPRA 4UQGA 2YCHA 3VEZA 5AQMA 3J7ZO 3V9WA 2P9KB 1K8AO 3N4PA 4B9QA 4CEQA 2D5RA 1CZ9A 4B1ZA 3DPQA 1VQMN 3VA0A 4JI4K 3DX4A 1BA0A 3RRGA 4E7JA 1NGHA 3O4QA 4I6MA 3CIPA 1WAJA 2PBDA 2HVIA 4K42A 3P38A 2D1LA 2C1IA 3QE6A 3O8MA 4IOXA 3CCEN 1C1BA 4Q0BA 3QDKA 1ZYLA 2P51A 4CE9A 4N76A 2E2QA 3UITA 3B51X 4NSWA 1QQMA 4DU1A 1YWMA 4BC4A 1H1VA 3SBTA 2QWMA 1RDCA 1HRHA 5F2RA 4F8RA 4K8ZA 3E9PA 4Z4HA 4FPAA 4DV0K 4R5PA 1TVRA 3ULDA 3BUIA 3M8SA 2WONA 4AZCB 3SJHA 4DG1A 5LJVA 2ASOA 1NK8A 3DLRA 1OA0A 4CJSA 3C6UA 2FC0A 3AO5A 2CH5A 4WQ5A 2P9IB 4EZUA 4FJ5A 3T48A 4DF4A 1X9WA 4BNEA 2Z1IA 1S9GA 3PUFA 3EEQA 4N47A 3IUCA 3K9JA 4R79A 1SL2A 4B9NA 1TKXA 4EZYA 4DU4A 4BG9A 4YY3K 4FOEA 3PIOL 1YUWA 4JI3K 1RTHA 2PYJA 3HSCA 4KTWA 4CJVA 1T44A 5LJWA 3DRPA 2E2PA 1IJJA 1BCMA 3B6PA 4B3MK 4DSIA 2YIAA 4CEEA 3H1QA 1HNZK 4FJ9A 2R7YA 3DPOA 4KTZA 5AQSA 1SU7A 4I1QA 1C0UA 1NK0A 5DK5A 4JKBA 4W5NA 3EJTA 3UKUB 4BDYA 3LDSA 3S41A 1VSLA 2P9NA 4CEZA 4DSFA 3TAGA 4AF1A 1NJXA 3PO5A 1R5EA 1B92A 4OGCA 1XI1A 3NF6A 1L5UA 2WFBA 4HCBA 2DTUA 1HKBA 3AVKA 2HBKA 2P9LA 4AZ7A 4XH5A 2IIRA 2GUPA 4FW2A 3LPTA 4OX9K 1ZBSA 5I9EB 4KIKA 1RBTA 2GUIA 2VG7A 1LAWA 1Q81O 4JEPA 4CFAA 2O4IA 3OTOK 4E81A 4LF7K 2IGIA 4C8NA 4CGFA 3V9ZA 2YJEA 3K5OA 3L3PA 3CQXA 3THXB 1DG4A 4PA1A 3NMUA 3A5MC 1HYZA 4EIAA 3SUPA 1SU8A 3ABHA 1Q82O 2Q1NA 4CF1A 4RW8A 1S22A 3HP6A 2P9UA 3DXKA 4ELVA 3A5LC 4N56A 2YLAA 1BQMA 1LWEA 3BLBA 2YI8A 3AA2A 1HKCA 1KLMA 4E7KA 1VSMA 4KV8A 4I43A 3THYB 3LDNA 4L8RB 3KTQA 4ISEA 4DQRA 1KFSA 2G8HA 3LAMA 2AJQA 4DYLA 2EX3B 1X9JA 3KLIA 5AQXA 4PWDA 3SV3A 1IG8A 1FKOA 1QZ6A 1IO2A 4CJ7A 5BREA 4CIGA 1NG9A 4JWEA 1P8ZA 3ZSRA 4AVMA 3T46A 5H1SQ 1QVGM 2HBMA 3KWIA 5HOOA 1RT2A 1NJWA 2GWKA 4CZHA 1T3VA 3J80O 2NRZA 2FF6A 4HUGA 1D9FA 2C1GA 1B9FA 1NGEA 3G9GA 3U8XA 3SYZA 2F7TA 4AZGA 1T8EA 1RDDA 2OA8A 2RPIA 2RF2A 4ISFA 1KQSM 3NVKA 3QWEA 4A59A 4CJLA 2ZD1A 3RMCA 4E0DA 3CV5A 4BRMA 1HJRA 3CFPA 4E19A 2ZE2A 4BR2A 3KLFA 2FSJA 3QNOA 1ZBHA 2QKWA 2FICA 5C5BB 5FPMA 2XRIA 3BEXA 1EWRA 1Z26A 2A41A 5ELZA 3NE6A 3FE1A 4W5QA 1JLEA 3CXCM 2W42A 1RTIA 4KPYA 3K2PA 1QQCA 1IG9A 4B3TK 1HR0K 1J5OA 2HHWA 1RDUA 3VQPA 4GV9A 1QQNA 4IEIA 2JNKA 3KVGA 3AA3A 1Y64A 4PHTX 4H03B 2AP1A 1S6PA 1ESVA 4GVEA 1JKHA 4FLYA 2ETJA 3AVJA 1ATNA 2HB5A 4DR1K 3DI6A 2F7RA 2UU9K 5DM7L 2V7YA 2O8FB 3DX2A 1BISA 2YLLA 3HPOA 3H46O 4EP5A 2Q12A 3CJAA 4BECA 3MCPA 5EX5A 4JK7A 4L3QA 4H8SA 3PLTA 2HHUA 3UKRA 2IVNA 5GAHP 5AQGA 5FPNA 1K8KB 4LF5K 4FW1A 3OY9A 1DKXA 2IVPA 4X66K 4DCNC 3H45C 5AQHA 3ZT2A 3HVRA 2XY8A 4FWKA 2ZJQL 5A2QO 1GLAG 3DOLA 3M8PA 4JHDB 3K59A 5M1OA 4FWQA 3L2RA 1ZBLA 4ELTA 3C6TA 3IFRA 3BF3A 3U3GA 3OS1A 1TYQA 2D4CA 3I0SA 3JSMA 2QXLA 3SMPA 1BOTO 4DTJA 1U49A 4EZTA 3K5NA 1C6VA 3FR0A 4AHRA 4OPAA 3ENBA 1L3VA 3KLGA 3T47A 1TKDA 4DLEA 4E7LA 2W00A 2QWPA 3QFPA 2O8EA 3TAMA 2NZTA 4U67L 4DKWA 5FIGA 3PO4A 1QWUA 3C94A 4O44A 3M5RA 2YHWA 2VWKA 1CZAN 1RBSA 4BY9C 3LPUA 5CZ1A 3VEXA 4IW0A 4PUOA 2H3GX 3LWMA 1IBLK 2YI1A 4H4OA 3U3YA 4CIFA 3FFIA 3QETA 1RBUA 2XHBA 1NU0A 5C2DA 3QIPA 1GOCA 4NCAA 1SQKA 1LW2A 4GV3A 2E4LA 3A8YA 3KZBA 1VAZA 5EOYA 3T4AG 1L3TA 5BN9A 3O3NB 4E3SA 3CM6A 2G8UA 1D8YA 4K0KK 4WFNL 3AVFA 2HW3A 4FJGA 3JXUA 1E3MA 2YKMA 1WBDA 4KB1A 4R5GA 4O5BA 3VESA 4B9SA 4EZRA 5JICA 1GOAA 3TANA 3CYGA 1KVCA 2D0AA 3CERA 1EQYA 5EU7A 2O8CA 5KI6A 4IWOA 3EJQA 4JKHA 1Q9YA 1Y97A 3KKRA 5LMNK 1MWMA 3RR7A 2LSNA 2BDPA 4X65K 5AQLA 5FLXO 3OYIA 3CCVN 2E8AA 1VQKN 4LF4K 4HWIA 2E6MA 4ELUA 5AR0A 2HNDA 2OCEA 3LP0A 4U7BA 2F7QA 1XWLA 1QSYA 1X9SA 3B8AX 1PS3A 3E9LA 4CEDA 3FLCO 1S1XA 1IKVA 1G15A 4BRLA 4CFDA 2X3VA 2OW7A 5HRRA 4CF2A 1UA1A 1Q18A 3DXMA 3JS6A 3Q7CA 4F3OA 1NGFA 1M1KO 1QS4A 5AQZA 4FK0A 3SOGA 1YTAA 1QHTA 4H5VA 3WEEA 2O8DB 3VQ8A 3EE8A 1QHAA 4F2RA 2KFNA 2GF4A 1RDAA 1A5VA 4EZPA 2F96A 5JLHA 2ALWA 3WT0A 3F9KA 3QLHA 1S1UA 4FJMA 1VSDA 3NH1A 4CZEA 1KAZA 1S5JA 5AFUA 3H08A 1RDBA 3QEPA 5BRDA 2Z0NA 2ITGA 4FSVA 4JKGB 2G8KA 5JVGL 2Q13A 2EFLA 5GIPA 2DFEA 4KHYA 2VWJA 1DLOA 1RGIA 5BR8K 1XUPO 1ILYA 1IKWA 4EZ9A 1N36K 4A5BA 4FWLA 4LFAK 3OK8A 4RW7A 3EN9A 4H5NA 2KLAA 1E4GT 2A6AA 2ZQBA 1HUXA 4PL8A 4CFCA 2W6LA 4OLAA 4FZYA 3VEVA 4BE7B 2QI2A 4RWTA 2D0OA 2PY6A 1VRTA 3DOKA 4DS5A 4FWOA 4IG0A 4O8KA 1UA0A 4WQ4A 3L3UA 1XMOK 3AVAA 3CFRA 1EO1A 4IJNA 1YXQA 3ZSOA 4E89A 4H6IA 3OYMA 1MA9B 1KSPA 3PX0A 4DR7K 5AQNA 3M6GA 1ZWWA 1N32K 1LCUA 3H0XA 4LH4A 3F73A 5E41A 1ZBIA 3DMJA 3ZT4A 2JNSA 4KFBA 4RTFD 2NRWA 3MN5A 1SKRA 1ZYQA 3FZMA 2YHYA 3AV9A 3DLKA 1HNWK 2Q0RA 1VQ6N 1N33K 3HI0A 3DYAA 3UE5A 4HR1A 3HM8A 4DSEA 4JV5K 3EZWA 4M3XA 4AZHA 5J1EA 1RT5A 1ZBUA 4ZTFA 4A2BA 4FLUA 3HT3A 4FL9A 2ASMA 3HZ6A 5GAEP 4HVJA 3MWTA 3O5BA 4KI4A 2PMRA 3NGZA 4AHVA 3MEEA 3KIOA 3KDRA 3DX3A 2GBZA 4KAZA 3IRXA 3CCJN 4BR9A 4AZ6A 3MWPA 3W0LA 4W5TA 4FJIA 1VSIA 1TQWA 1EKEA 1EWQA 3QEWA 3TWHA 1UAXA 3QNJA 4M41A 3DDFA 2AA4A 1K6YA 4BRIA 1TQSA 1W9HA 3KAWA 3TSQA 5FRMA 3U9ZA 4AHTA 4JD2B 1OAOA 4FVMA 3WNHA 1RFQA 1TL1A 5AQYA 4BVOA 4DU3A 5BPLA 4CCHA 1BDGA 4CHQA 3V1RA 3TAFA 2P9NB 1VQ7N 3MAQA 2JWKA 3SMSA 3SJJA 3K9KA 4J2DA 1RILA 3GL1A 4BDZA 1BQNA 1Q9XA 1RTDA 1CLQA 1I94K 4MFBA 3SBGA 3BVUA 3MXJA 1IKXA 1WLJA 4BGAA 3D2FA 3IS9A 3L6QA 4AZBA 2P9LB 4KRFA 4DV4K 3NH2A 4JI1K 2EWFA 3CD6N 2RKIA 4H0XB 1X03A 4KIKB 4IZ9A 5EY4A 4YDUC 4YORA 4DQPA 4CK3A 7HSCA 4CERA 4DTOA 3H6EA 2OW6A 1HNIA 1HLUA 1HYSA 4BRGA 4GNIA 2MI7A 3IDHA 1GLCG 4I7FA 2LM0A 5BPMA 4JKGA 2NRVA 1BU6O 4BQZA 5ADXA 3LMFA 4G6QA 1EP4A 2RT6A 3L8BA 2NCZA 4IDHA 3WQTA 3CCLN 1HKGA 3EJUA 1Q8IA 4R5LA 3MMVA 2PFUA 1BA1A 2W6KA 1TK8A 3Q0KA 1GLEG 2YNIA 4JKFA 4BC2A 3KWGA 3T1YK 3WXJA 4ILHB 3QA8A 5JLFA 4OLBA 4LFCK 4JS5A 2Q3SA 1IH7A 1EETA 3EZ5A 4CEBA 1ASUA 4OPKA 3VQCA 1BI4B 3CJ9A 3CETA 2CGLA 3ZSWA 4CJ4A 2P9SA 2VCPA 5AQOA 3G0ZA 1GLFO 4JAXA 3KAVA 2OYQA 2HNYA 3OS2A 3DLHA 5JS2A 4BR4A 4FJ8A 5SWMA 3SK3A 4BWJA 3SQ4A 4FM1A 5AJ3K 3SCXA 3L4IA 2RE2A 3AO2A 2J4RA 4KH6A 5TKWA 3TABA 2D0CA 4OVLA 3SNNA 2FSNA 3QO9A 3LP2A 3AGKA 3GI7A 1NOYA 2PYLA 3F2KA 1XNRK 1KCFA 3VQBA 4BRPA 5C42A 2OPQA 4MO5A 3Q7BA 4MLHA 3ZEUB 3U9DA 3RSEA 2F7OA 2Z0OA 4R5IA 3QBXA 3KK3A 3C7NA 1UWBA 3V1QA 5FPDA 1XC3A 4NO7A 4CGHA 4KHWA 2RN2A 4E1NA 3MN7A 2VWBA 3DOBA 3L3OM 3MCAB 3DLLL 4AKVA 2YIVX 3HP9A 5AZJA 4KHSA 3D6RA 4DTXA 1UPXA 4XH4A 1TUYA 5GINA 5CHIA 4YHHK 4FCYA 2HHQA 1HX1A 4K25A 2OPRA 3LDQA 4Z4CA 4H5RA 1S6QA 1JQKA 5F1XA 3EL2A 3CKDA 1J5EK 1SUFA 2Q0UA 4C23A 2GA9D 4NB4A 5KGXA 4LF9K 4CGJA 4E7HA 4GV6A 4FZSA 4ILGB 3TTCA 3U6FA 3KJVA 4BR7A 4IWPA 1U48A 3V9UA 4B1UB 3ULEA 5AZIA 4CW7B 3KD5E 2FF3B 3LDLA 4FZPA 3I2WA 4UDXX 1VQPN 1QX1A 2CH6A 3CPWM 3B52X 4DV7K 2X74A 1U2VA 3V4IA 3J8AA 1WSEA 4J2AA 4EZSA 4XEIA 1DT9A 4CJWA 2E5LK 4J8FA 1SUQA 4B9LA 3O1WA 1BL3A 4CZFA 4BRFA 4DUZK 3O6WA 3AO1A 2GELA 2E6LA 1I4TA 5KQDA 1NMDA 3IAYA 1VQ8N 4WFBL 4KKOA 4FVUA 4FZZA 1YITN 1NJYA 2YHAA 3QNNA 3DX1A 1UOCA 2VG6A 3P4IA 1REVA 1WSHA 4CZGA 3EJRA 1VQ5N 4B9TA 4IOAL 4NCBA 1JL1A 1ZC6A 2V52B 1J9AA 4BQLA 2F8SA 3NF9A 4ILJA 1MDUB 5FLEX 1CZBA 3CHWA 5LMUK 3MX2A 1RT3A 4JI2K 2IOCA 3OW2M 1NOZA 1HJOA 1R59O 3OVNA 3P83D 4CK1A 2P5GA 3OJSA 3T7ZA 4BACA 2ITMA 4Z4IA 4B9UA 2FXUA 3W3DA 5J2QA 1RT7A 1OKJA 2ZM6K 2HHTA 1RBVA 4CGDA 3SPZA 4MDBA 1T05A 3ZSYA 3MN6A 2KW4A 3CZNA 1I39A 3KK1A 1O7DC 4C8OA 1TUUA 3MEGA 1WAFA 4O4GA 1HQEA 3E01A 3SYVA 3KK7A 3V6DA 2YJFA 1NWKA 3QERA 4O8UA 2E20A 5JS1A 3T49A 2KKZA 4CEOA 4ICLA 2A1RA 1GLJO 1S3XA 2HOEA 3ZLJA 1KTQA 2P9KA 1WSFA 2A40A 1Y2OA 1BHLA 4HTUA 3CQYA 2BUPA 2UYTA 3HM9A 3BVVA 2Q2RA 1KAXA 4BRNA 3RV1A 1XHZA 4NXNK 1KD1O 2RHKA 1BPRA 3AVLA 3ACOA 3B53X 4NPHA 1WSGA 3I8BA 4CHOA 1X04A 3EE9A 2FBYA 3N4QA 4D8JA 4CGGA 1JCEA 3D51A 3ZX0A 4FXDA 1TKTA 3PSIA 3CFOA 2NLXA 1BIUA 2FBXA 3MECA 4V19S 3SI6A 2VGMA 2GEMA 1HWWA 4QCLA 3G71N 5AQIA 4XJXA 3E66A 3ZCMA 5KTQA 3QFUA 1DEJA 3T1AA 3CCSN 3DLGA 2P5OA 4AZCA 1WUAA 3LM9A 5HRNA 1L3SA 1JCFA 3VF6A 4BRDA 1NK9A 2OPPA 4EZXA 4JS4A 4DFKA 1NK6A 4B8AB 3HBTA 2P9IA 4JNFA 4M42A 4X64K 3L2QA 4OGEA 3MK6A 1GOBA 1YVUA 3VGLA 1K9MO 1CKRA 2YNGA 3VQ4A 3OYLA 3HOTA 4DR3K 1VSFA 3IG1A 3ZETB 1BCOA 1U45A 1URUA 3NGYA 2YL6A 2PAVA 2QWQA 3AAPA 3HYFA 2XO7A 4DFMA 2QM1A 2NRRA 4A2AA 4JKAA 2DFFA 1DTTA 3RMBA 2YNHA 3SQ1A 3BGRA 1L3UA 4JI7K 1RT4A 3SUOA 3HJFA 1KC8O 3L3VA 5IT9O 3L2UA 5CY4A 4BR5A 4BEBA 2YL8A 4KHQA 3UKUA 1W7AA 4KHNA 4KO0A 2ZXQA 1SL1A 3I04A 4CI6A 1TQVA 3AARA 3CQ8A 4BE0A 3VTIA 4GKJK 4WE1A 2ASPA 1NMNA 4JI6K 3WXIA 4JWCA 3GE1A 3O80A 4BG8A 4BRCA 1DKYA 4DQIA 3R9PA 3L4QA 4M3ZA 1U6ZA 3WNEA 2HSTA 1LQ7A 4N41A 4OJRA 1JLCA 4WPEA 3GOIA 4C8MA 4B3SK 1KAYA 3LLLA 2O0I1 4DCHA 3KD1E 3VETA 2VQFK 4DWIA 4CJPA 4G1QA 4MO4A 3H3OB 1XMQK 3THXA 3VQDA 4CJ5A 1SZ2A 4WYBA 5M1FA 5LL6Z 4C1NI 2YIBA 1TQUA 5AQQA 3OHRA 1BGXT 3BF1A 3AVNA 3LALA 3KHYA 3HO1A 3CZSA 3O3MB 2EHGA 3THYA 3VA3A 2V7ZA 3TTFA 4Y1DA 1TGOA 3CPEA 2XY7A 4NCGA 5E84A 4GY2B 3RWUA 3CJ7A 3A5OC 2X3XA 3CCQN 3V1OA 1VK0A 5KPZA 4CECA 4CBWA 4CJRA 3VERA 3UB5A 3KKSA 4LSNA 3VPZA 3D7EO 4CZLA 5SZTA 2I5JA 5KBPA 3SAHA 2F8TA 2OBLA 2WINM 2E2OA 3TI0A 3TARA 2N3KA 4OKEA 4TSXA 5JENA 2E1ZA 1NKBA 2I7NA 4C8LA 1OH5A 3F5TA 2OZNB 3VF4A 3EJSA 1R0AA 5J2NA 3LANA 1ATRA 4DV1K 1XHXA 3DLEA 3FZHA 4F3TA 3HRGA 1SKSA 5FROA 3BUDA 3FGUA 2QEXN 3THWB 2EWSA 4OKKA 1YVNA 3ZSZA 4FLTA 1YJ9N 3NBPA 3WXLA 4JYAK 2BH1A 1GLBG 5C5BA 3BP8A 4LH5A 5JVHL 3OYFA 3A5NC 4DR6K 2XY5A 4HYBA 3BUQA 4IFEA 4XIUA 4FK2A 4YOWA 4DUYK 5BN8A 1T6CA 2W41A 3ZX2A 4DFPA 2YKNA 3ITHA 3QIOA 3PX6A 4DSKA 3D2EB 4WFAL 4FJXA 2QFFA 2WUSA 2O8FA 4AM7A 1WSIA 2ELBA 3VEAA 3BUPA 2A42A 4IFYA 3WUHA 1TK0A 1NJIO 4FJHA 4UY8O 1RT1A 3C6HA 2FBTA 1K8KA 2HF3A 3VOVA 1KVAA 4YOTA 2OTJN 3QESA 4OPJA 5T7BA 3TSPA 1QTMA 3S5TA 2HHIA 4I6MB 4JHDA 4CHPA 1R33A 4IM2A 2F7PA 3IMXA 5CR4A 3N8EA 2KQ2A 2A1SA 3O1BA 4M7YA 4KI6A 1NGBA 3KK2A 4FZOA 4EZNA 4JLCA 1D5AA 3I01A 3AA5X 4O5FA 1SAZA 3SBTB 1TL3A 4PKGA 3K5LA 2QKBA 1HPZA 2Z1JA 4Z94A 2IC3A 2ZJPL 3OYAA 1YJWN 3VEBA 4M3RA 2QWLA 1NK4A 3QMLA 1HNVA 3ID8A 4RW4A 4CFBA 3TTDA 3VQ5A 5TKYA 2BPRA 4H0OA 3SUQA 2G8WA 2FBVA 4MDAA 4I9QA 2GV9A 1D4XA 4CHZA 3H1VX 4Y0WA 3I55N 5GIOA 4M3UA 2ZWHA 4CK2A 3AA4A 2P1JA 5AZJB 1JLAA 4PY5A 4H0VB 1LAVA 2BE2A 4FWPA 4B3RK 4KH4A 2HNZA 1Z6RA 3D50A 5FPEA 2GAFD 3VTHA 2OBMA 4YDUA 1JCGA 1Z05A 3QINA 4AILC 3RR8A 5BPNA 2JGUA 2VG5A 4J2BA 2HHSA 4IM3A 3EYZA 3CAZA 4E1MA 2HBJA 3ZYYX 1JJ2M 1G99A 4CEFA 3HAJA 4DFJA 4B3OA 3HPGA 2GWJA 5AZIB 1FKPA 4JI8K 3ZT0A 2Q97A 4AH9A 4EFHA 3O9TA 3V81A 3AVHA 1U2VB 4JRPA 4H4MA 4AZ5A 4DQ8A 1VSEA 3ALYA 4FJLA 2CGKA 1C0TA 1MWKA 4YFUA 1JXBA 3G4SN 4EP4A 2VQEK 3ZSXA 4EZVA 1GNLA 3D52A 2E88A 4B9MA 4E7IA 4WPCA 4DSJA 1S1WA 4FM0A 2HBLA 3CYMA 2OP6A 1FXXA 1DKGD 5FDLA 1YHQN 1RCHA 1J54A 4N5SA 3ID6A 5B8HA 3GDQA 2CGJA 4JKDA 1QZ5A 3WNFA 4CJKA 2OZSA 3E9OA 2QXFA 3F9MA 4JI5K 3M1FA 3VQAA 3AY9A 4H0YB 1NM1A 3SQ2A 4BGBA 3ERCC 3TR8A 3SV4A 3IKMA 3QEXA 2PZSA 2UUBK 1QE1A 3OBYA 5M1QA 2E2NA 3ZSVA 5M1KA 4DSLA 5DMRA 2P9UB 3DXKB 3R6MA 4F4KA 2G8IA 4CGIA 4C1NK 1NGJA 3GBTA 1EXQA 4CD1A 3QB0A 4MQ3A 3U4LA 2YV0X 1BG3A 1S1TA 3O4NA 4H5WA 3TPQA 1YF5L 4G9ZA 3DPPA 3ER9B 4DV6K 1CXQA
chains in the Genus database with same CATH topology
3ENBA 2ZJRL 3T7ZA 4B1XB 4CBUA 2ITMA 5AQFA 2FXUA 3W3DA 3T47A 2NRHA 1OKJA 2W00A 1W2BM 5AQVA 2QWPA 2GX9A 3EKUA 4MDBA 3CC7N 3ENHA 3BUZB 3MN6A 4IM0A 1RDWX 3C6AA 3QFPA 4BC3A 2NNWA 2NZTA 4U67L 2ZGYA 4DKWA 2I7PA 1TUUA 5FIGA 2WBNA 2GTDA 4A5AA 3A0IX 4NLBA 3M5RA 4PKHA 2YHWA 2KHOA 3KK7A 2YJFA 4R5KA 1NWKA 1SS6A 5AQJA 1E2UA 4O8UA 2E20A 1CZAN 1YI2N 2F9TA 3EO3A 2Z8YA 3T49A 2KKZA 3RSEB 4BY9C 1GLJO 1XQSC 1S3XA 3C7NB 2HOEA 5AQRA 4CZIA 4JWIA 2P9KA 4IW0A 2V51B 3LDOA 4YOUA 3VEXA 2H3GX 2A40A 3CCUN 2YHXA 2YI1A 3CQYA 3P39A 3SAGA 2BUPA 1ILYA 1Q7YO 2UYTA 2Q2RA 2QW9A 1KAXA 4BRNA 5C2DA 3RV1A 1SQKA 2A5XA 3DJCA 2RHKA 1KD1O 1BPRA 1DGKN 3B53X 3I8BA 4NPHA 3A8YA 3KZBA 4GV3A 3EE9A 3ZEDA 1VAZA 3T4AG 3N4QA 5EOYA 5AFUH 4D8JA 5BN9A 1LOTB 3O3NB 1NGGA 1JCEA 4FWNA 5MLCQ 5F0XA 2D4WA 3ZX0A 3H3NO 5AQKA 5JMVA 4WFNL 4DHYA 3ENOA 2NLXA 3JXUA 4WQ4C 3T69A 2ND1A 3ER8C 4R5GA 5C15A 3VESA 1U00A 4EZRA 5JICA 2VGMA 5BRHA 2GEMA 3G71N 3CERA 3P31A 1EQYA 5AQIA 1NGIA 4XJXA 5M1PA 3E66A 4IO9L 4IWOA 4JKHA 3ZX3A 2BTFA 3QFUA 1DEJA 1V4SA 4BVPA 1MWMA 2ZGZA 3CCSN 4H0TB 3M3ZA 1WOQA 4B1WB 3MX5A 1WUAA 3LM9A 5AQLA 3ULEB 4YOYA 5C0YA 1JCFA 4MLEA 4OPHA 3VF6A 4BRDA 3CCVN 2E8AA 1VQKN 1HPMA 4EZXA 3SAFA 2A3ZA 4HWIA 4IXCA 2QWRA 1VQNN 3HBTA 4E3CA 2P9IA 5AR0A 4JNFA 4HTLA 2OANA 3QICA 2F9WA 2FLOA 4U7BA 3ZEFA 1W9MA 2VGNA 2E1YA 3MK6A 1K9MO 3VGLA 5EXWA 2NRXA 2Q31A 3B8AX 4M7XA 1CKRA 4JKCA 3UKRB 4IWQA 4JWDA 3OBWA 3E9LA 4BR0A 3DWLA 3FLCO 4K41A 5KPTA 1K73O 3HOTA 4BRLA 3ZETB 4PL7A 4ILIA 4HY9A 4WV5A 1E4FT 4JD2A 1Q18A 2ZF5O 3EKSA 3VF2A 2PAVA 2QWQA 1BO5O 1NGCA 3AAPA 3DXMA 3JS6A 3Q7CA 3CC2N 2QM1A 2DPNA 1NGFA 2Q36A 3I33A 2NRRA 1M1KO 2IVOA 4JKAA 4A2AA 3LDPA 3O9UA 3AAQA 1C0FA 4WQ5C 5AQZA 3F7WA 3WXKA 4H5VA 3WEEA 4E1JA 1KC8O 4QS9A 1E1DA 3EE8A 1QHAA 4FOIA 1VQ9N 2QWOA 4EZPA 4EZWA 4BR5A 4BEBA 5JLHA 5EVZA 3WT0A 2HF4A 3UKUA 1TYQB 4JK8A 1YJNN 4CZEA 1KAZA 1P90A 4DB3A 3CF5L 4BC5A 5AFUA 4FWRA 2P9PB 4F01A 3I04A 5BRDA 4ISGA 4JKGB 4CI6A 4FSVA 3CCMN 5JVGL 5DM6L 4B1VA 3AARA 5GIPA 3ATUA 1RGIA 4NLCA 3VTIA 3RVCA 3CMEN 3VKHA 1GLDG 2ASPA 4EZZA 3WQUA 4BRKA 4UDYX 1XUPO 4A61A 1SU6A 1KXPA 4JWCA 3FFKB 2P9PA 1MJGA 3GE1A 3O80A 3WXIA 4BG8A 5C10A 4A5BA 4F00A 4FWLA 3D2EA 4BRCA 4CZJA 1DKYA 3EN9A 4H5NA 4K43A 3L4QA 3R9PA 2KLAA 1U6ZA 4IWVA 1E4GT 1YAGA 2HSTA 5AQPA 2A6AA 4PL8A 1HUXA 5GAGP 3FD9A 3VEVA 4F9OA 5AQWA 1E9VA 3GOIA 3C0BA 4BE7B 4H6HA 1KAYA 3LL3A 5KPRA 2QI2A 4RWTA 2D0OA 2PY6A 4FM3A 3A98A 4FWOA 2YCHA 4O8KA 3VEZA 4DCHA 4FO0A 5AQMA 3VETA 3J7ZO 2D1KA 4WQ4A 2P9KB 4M63C 1K8AO 1EO1A 3N4PA 4B9QA 1C0GA 4IJNA 1YXQA 4B1ZA 1VQMN 3DPQA 4H6IA 4MO4A 3H3OB 1MA9B 1SZ2A 4WYBA 4KBOA 5B8HA 1BA0A 5M1FA 4ILHA 5AQNA 1NGHA 1ATSA 5C2FA 1M90O 4I6MA 3CIPA 3SBSA 4C1NI 3M6GA 4JN4A 2YIBA 2PBDA 1LCUA 3H0XA 5AQQA 4K42A 3P38A 4WCEL 3OHRA 2JNSA 3BF1A 4RTFD 2C1IA 3LM2A 3O8MA 4IOXA 2D0PA 3CCEN 2NRWA 1ZYLA 3KHYA 3MN5A 3QDKA 3FZMA 1NGDA 3UITA 2E2QA 2YHYA 3I56N 3B51X 3O3MB 1QQMA 3O9SA 2Q0RA 2V7ZA 3TTFA 3U4LA 1VQ6N 5AQUA 3HI0A 3UE5A 5C12A 4HR1A 4BC4A 1H1VA 3CPEA 3SBTA 2QWMA 5F2RA 3HM8A 3E9PA 4OPAA 5E84A 3EZWA 4EHTA 4FPAA 4GY2B 3CJ7A 3A5OC 3CCQN 4A2BA 5ADXH 4FL9A 2ASMA 3HZ6A 3WXMB 5GAEP 3CC4N 3MWTA 3O5BA 3CJ1A 5KPZA 3SJHA 3MDQA 4CBWA 5LJVA 2ASOA 1OA0A 3KDRA 3VERA 3UB5A 3O4WA 3VPZA 3DQGA 3D7EO 3CCJN 4CZLA 4BR9A 2CH5A 3MWPA 4WQ5A 4BRAA 3SAHA 2P9IB 3W0LA 1T6DA 3ZEUA 2OBLA 2WINM 4CZMA 2E2OA 4EZUA 3HOSA 2N3KA 3QNJA 3T48A 2E1ZA 2AA4A 2I7NA 3VGKA 3TSUA 3VEWA 3F5TA 4YOVA 5BR9A 3VF4A 3IUCA 3K9JA 4BRIA 4R79A 4IJAA 3KAWA 3TSQA 4EZYA 1VQON 1ATRA 3U9ZA 4FOEA 4BG9A 5CE3A 3PIOL 1YUWA 4JD2B 2YI9A 3DXMB 1OAOA 3FZHA 3HSCA 3HRGA 1T44A 4KH5A 5LJWA 4XH1A 3FGUA 4BROA 2QEXN 2E2PA 4WV7A 1IJJA 1RFQA 2EWSA 5AQYA 4BVOA 1YVNA 5BPLA 2YIAA 1Q5LA 1BDGA 3H1QA 1Q86O 3WEEB 2P9NB 1VQ7N 3DPOA 3I39X 1YJ9N 5AQSA 4RCHA 1SU7A 2JWKA 3SMSA 3WXLA 4EHUA 3QBWA 2BH1A 1GLBG 3K9KA 4GV6A 3BP8A 1ZXOA 3GL1A 3RV0A 4FPBA 3VENA 4JKBA 3SLCA 3UKUB 4PKIA 4YOXA 5E26A 3G6EN 3S41A 3SBGA 3TU5A 5JVHL 4BGAA 2P9NA 3D2FA 3A5NC 2JWLA 4AF1A 3L6QA 2P9LB 5KQ8A 2FSKA 1YIJN 2EWFA 4HYBA 3CD6N 4ILGA 2WFBA 4IFEA 4H0XB 3HTVA 4KIKB 4IZ9A 5EY4A 1HKBA 4YDUC 2QWNA 2HBKA 4YORA 1X3MA 4YOWA 5BN8A 1O13A 1T6CA 2W41A 3ZX2A 2P9LA 3ATVA 7HSCA 4XH5A 2IIRA 3D2EB 3FZFA 2GUPA 3H6EA 4WFAL 1HLUA 2QFFA 1ZBSA 2WUSA 5I9EB 4AM7A 4KIKA 1GLLO 2VYPA 4BRGA 4GNIA 3VEOA 1Q81O 3IDHA 1GLCG 4JEPA 4A62A 2LM0A 5BPMA 2QA4N 2NRVA 3VEAA 1BU6O 4BQZA 2NRTA 5ADXA 2A42A 3LMFA 4G6QA 2RT6A 3WUHA 1NJIO 2NCZA 4IDHA 4UY8O 1VQLN 4E81A 3C6HA 3R1XA 3WQTA 3CCLN 1K8KA 2HF3A 1HKGA 4R5LA 3VOVA 4LC9B 1W97L 3MMVA 2PFUA 1BA1A 4R5JA 1NLVA 2YJEA 4YOTA 1GLEG 4JKFA 4BC2A 1OVYA 2OTJN 3CQXA 3KWGA 3O08A 3WXJA 1DG4A 3CCRN 4AM6A 3A5MC 1V4TA 3R3LA 3NMUA 3TSPA 4EIAA 4ILHB 1SU8A 3QA8A 5JLFA 1Q82O 4I6MB 2Q1NA 4JHDA 5M1NA 4IM2A 1S22A 3IMXA 5CR4A 2P9UA 3DXKA 3VEYA 3N8EA 4M7YA 3O1BA 3O3OB 3A5LC 1NGBA 2YI8A 4CBXA 1GN9A 1HKCA 3MN9A 3CJ9A 3CETA 4EZNA 4EAHD 4JLCA 2CGLA 2P9SA 2VCPA 5AQOA 3I01A 1GLFO 3KAVA 4JAXA 5LY3A 4I43A 3LDNA 4BR4A 4O5FA 1NGAA 3SK3A 1SAZA 4HR1B 3SBTB 4ISEA 4PKGA 4CD3A 4PO2A 3L4IA 2RE2A 4QS8A 4Z94A 2ZJPL 2EX3B 2J4RA 4KH6A 1X9JA 5TKWA 1YJWN 1QQOA 3VEBA 2QWLA 3QMLA 5AQXA 3R8EA 2FSNA 3ID8A 4BREA 3CJCA 1NBWA 3TTDA 1IG8A 3AGKA 1QZ6A 3GI7A 5TKYA 4IO8A 2BPRA 3F2KA 4H0OA 4CJ7A 5BREA 3G25A 4IOCL 4JWEA 1P8ZA 4BRPA 4H5TA 4MDAA 3T46A 3Q7BA 4MO5A 4MLHA 5H1SQ 1QVGM 2HBMA 1D4XA 3OHXM 3U9DA 3ZEUB 3KWIA 3H1VX 3RSEA 5HOOA 4R5IA 3QBXA 3C7NA 2GWKA 3O9QA 5FPDA 1XC3A 1T3VA 4NO7A 4Y0WA 2NRZA 4CZHA 3I55N 5AQTA 3PLAA 2X5CA 2FF6A 5GIOA 2ZWHA 2C1GA 1NGEA 5AZJB 1VQ4N 3C65A 3MN7A 3U8XA 4H0VB 2VWBA 2HMPA 2F7TA 4FWPA 4KH4A 3DOBA 3L3OM 3MCAB 4BRQA 4ISFA 3DLLL 1Z6RA 1KQSM 3NVKA 3GG4A 2YIVX 2GAFD 4A59A 5FPEA 2QTDA 3VTHA 2OBMA 5AZJA 4YDUA 1JCGA 1Z05A 3OA9A 4WF9L 4BRMA 5BPNA 3D6RA 1UPXA 4XH4A 4B1YB 4JK9A 4BRHA 3O9RA 4IM3A 1TUYA 4BR2A 5CHIA 5GINA 2FSJA 1HX1A 3NVMA 4K25A 1J6ZA 3LDQA 3VGMA 4H5RA 4JL9A 5FPMA 1JQKA 2HBJA 3BEXA 5F1XA 3EL2A 3ZYYX 2A41A 5ELZA 3FE1A 2ND0A 1SUFA 1JJ2M 1G99A 2Q0UA 3CXCM 3D2FB 2GWJA 5AZIB 4C23A 2Q97A 4OO1J 1RDUA 2GA9D 4NB4A 4EFHA 1X3NA 1QQNA 4IEIA 3KVGA 3O9TA 3PIPL 4GV9A 3FZLA 4ILGB 1U2VB 1Y64A 4PHTX 4H03B 3TTCA 5BRFA 2AP1A 4GVEA 1ESVA 4IEEA 1QVFM 4BR7A 4IWPA 4DQ8A 3CMAN 4H0PA 4B1UB 3ULEA 4QS7A 5AZIA 2FF3B 2CGKA 1ATNA 3LDLA 4UDXX 1MWKA 3G4SN 1VQPN 2CH6A 3CPWM 3B52X 5DM7L 2V7YA 5HL7L 1BUPA 1U2VA 4EZVA 4MQDA 3J8AA 4CZKA 1GNLA 3CI5A 1GNTA 2E88A 4EZSA 3H46O 3CJAA 4BECA 4XEIA 2HBLA 3MCPA 1DT9A 5EX5A 4JK7A 1N8RO 2OP6A 4L3QA 1DKGD 4J8FA 1YHQN 3UKRA 2IVNA 5GAHP 3CJBA 3ID6A 3O1WA 4M0MA 1DKZA 1K8KB 3GDQA 2CGJA 4JKDA 1QZ5A 5AQGA 5FPNA 4BRFA 3E9OA 4CZFA 1DKXA 3F9MA 2IVPA 3O6WA 3ZETA 2GELA 3M1FA 3AY9A 3H45C 4H0YB 5AQHA 1NM1A 5KQDA 1NMDA 1VQ8N 4BGBA 3ERCC 3L0QA 4WFBL 3VMFB 4FVUA 2ZJQL 4FWKA 1YITN 3IKMA 1S72N 4FWSA 3FZKA 1GLAG 2YX6A 5GADP 2OTLN 3OBYA 5M1QA 3P4IA 2E2NA 4JHDB 4CZGA 4A57A 5M1KA 1VQ5N 4IOAL 3E1YA 2P9UB 3DXKB 3R6MA 2WC9A 1ZC6A 2V52B 4FWQA 5M1OA 1OA1A 3IFRA 4BQLA 2W40A 4C1NK 1NGJA 1BWFO 3BF3A 4ILJA 3GBTA 4JNEA 1TYQA 1MDUB 5FLEX 3AGRA 4JKEA 4CD1A 2QXLA 3OWGA 3CHWA 3QB0A 4EZQA 2P9SB 3MX2A 1BOTO 1BG3A 4H5WA 4EZTA 3SMPA 1YF5L 4EZOA 3DAWA 3TPQA 4FWMA 3DPPA 3OW2M 4G9ZA 1HJOA 1R59O 3ER9B 3FR0A 4JKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1X B;  4CBU A;  2ITM A;  5AQF A;  2FXU A;  3W3D A;  3T47 A;  2NRH A;  1OKJ A;  5AQV A;  2QWP A;  3EKU A;  3ENH A;  3BUZ B;  3MN6 A;  1RDW X;  3QFP A;  4BC3 A;  2NZT A;  2ZGY A;  2I7P A;  1TUU A;  2GTD A;  3A0I X;  4PKH A;  2YHW A;  2KHO A;  2YJF A;  4R5K A;  1NWK A;  5AQJ A;  2E20 A;  1CZA N;  2F9T A;  3EO3 A;  3T49 A;  3RSE B;  1GLJ O;  1XQS C;  1S3X A;  3C7N B;  2HOE A;  5AQR A;  4CZI A;  4JWI A;  2P9K A;  2V51 B;  3LDO A;  3VEX A;  2H3G X;  2A40 A;  2YHX A;  2YI1 A;  3CQY A;  2BUP A;  2UYT A;  2Q2R A;  2QW9 A;  1KAX A;  4BRN A;  1SQK A;  2A5X A;  3DJC A;  1BPR A;  1DGK N;  3I8B A;  3A8Y A;  3KZB A;  5EOY A;  3T4A G;  5AFU H;  5BN9 A;  1LOT B;  1NGG A;  1JCE A;  4FWN A;  5F0X A;  2D4W A;  3ZX0 A;  3H3N O;  5AQK A;  5JMV A;  4DHY A;  3ENO A;  2NLX A;  3JXU A;  4WQ4 C;  4R5G A;  3VES A;  1U00 A;  4EZR A;  5JIC A;  5BRH A;  2GEM A;  3CER A;  1EQY A;  5AQI A;  1NGI A;  3ZX3 A;  2BTF A;  3QFU A;  1DEJ A;  1V4S A;  4BVP A;  1MWM A;  2ZGZ A;  4H0T B;  3M3Z A;  1WOQ A;  4B1W B;  1WUA A;  3LM9 A;  5AQL A;  3ULE B;  1JCF A;  4MLE A;  3VF6 A;  4BRD A;  2E8A A;  1HPM A;  4EZX A;  2A3Z A;  4HWI A;  4IXC A;  2QWR A;  3HBT A;  5AR0 A;  2P9I A;  4JNF A;  4HTL A;  2OAN A;  3QIC A;  2F9W A;  2FLO A;  2E1Y A;  3MK6 A;  3VGL A;  5EXW A;  4M7X A;  2Q31 A;  3B8A X;  1CKR A;  3UKR B;  4JWD A;  4BR0 A;  3DWL A;  3FLC O;  4K41 A;  5KPT A;  4BRL A;  3ZET B;  4PL7 A;  4HY9 A;  4WV5 A;  1E4F T;  4JD2 A;  1Q18 A;  2ZF5 O;  3EKS A;  3VF2 A;  2PAV A;  2QWQ A;  1BO5 O;  1NGC A;  3AAP A;  3DXM A;  3JS6 A;  2QM1 A;  2Q36 A;  1NGF A;  2DPN A;  3I33 A;  2IVO A;  4A2A A;  3LDP A;  3AAQ A;  1C0F A;  4WQ5 C;  5AQZ A;  3WXK A;  4H5V A;  3WEE A;  4E1J A;  4QS9 A;  1QHA A;  4FOI A;  2QWO A;  4EZP A;  4EZW A;  4BR5 A;  5JLH A;  5EVZ A;  3WT0 A;  2HF4 A;  3UKU A;  1TYQ B;  4CZE A;  1KAZ A;  4DB3 A;  4BC5 A;  5AFU A;  4FWR A;  2P9P B;  4F01 A;  5BRD A;  4ISG A;  4CI6 A;  4FSV A;  4B1V A;  3AAR A;  3ATU A;  1RGI A;  1GLD G;  2ASP A;  4EZZ A;  3WQU A;  4BRK A;  1XUP O;  4A61 A;  1KXP A;  3FFK B;  4JWC A;  3WXI A;  2P9P A;  3GE1 A;  3O80 A;  4BG8 A;  4F00 A;  4FWL A;  3D2E A;  4BRC A;  4CZJ A;  1DKY A;  3EN9 A;  4H5N A;  4K43 A;  3R9P A;  1U6Z A;  4IWV A;  1E4G T;  1YAG A;  5AQP A;  2A6A A;  4PL8 A;  1HUX A;  4F9O A;  3VEV A;  5AQW A;  3GOI A;  3C0B A;  4H6H A;  1KAY A;  3LL3 A;  5KPR A;  4RWT A;  2D0O A;  4FWO A;  2YCH A;  4O8K A;  3VEZ A;  4DCH A;  4FO0 A;  5AQM A;  3VET A;  2D1K A;  4WQ4 A;  2P9K B;  4M63 C;  4B9Q A;  1C0G A;  4IJN A;  1YXQ A;  4B1Z A;  3DPQ A;  4H6I A;  4MO4 A;  3H3O B;  1MA9 B;  1SZ2 A;  4WYB A;  4KBO A;  1BA0 A;  5AQN A;  1NGH A;  1ATS A;  4I6M A;  3CIP A;  3M6G A;  4JN4 A;  2PBD A;  1LCU A;  3H0X A;  5AQQ A;  4K42 A;  3OHR A;  3BF1 A;  4RTF D;  3LM2 A;  3O8M A;  2D0P A;  3KHY A;  3MN5 A;  3QDK A;  3FZM A;  1NGD A;  2E2Q A;  2YHY A;  1QQM A;  2Q0R A;  2V7Z A;  5AQU A;  3HI0 A;  3UE5 A;  4BC4 A;  1H1V A;  2QWM A;  5F2R A;  3HM8 A;  5E84 A;  3EZW A;  4EHT A;  4FPA A;  4GY2 B;  3CJ7 A;  3A5O C;  4A2B A;  5ADX H;  4FL9 A;  2ASM A;  3HZ6 A;  3O5B A;  3CJ1 A;  5KPZ A;  3SJH A;  3MDQ A;  4CBW A;  5LJV A;  2ASO A;  3VER A;  3UB5 A;  3O4W A;  3VPZ A;  3DQG A;  3D7E O;  4CZL A;  4BR9 A;  2CH5 A;  4WQ5 A;  4BRA A;  2P9I B;  3W0L A;  1T6D A;  3ZEU A;  2WIN M;  4CZM A;  2E2O A;  4EZU A;  3QNJ A;  3T48 A;  2E1Z A;  2AA4 A;  2I7N A;  3VGK A;  3VEW A;  5BR9 A;  3VF4 A;  3IUC A;  4BRI A;  4IJA A;  4EZY A;  1ATR A;  3U9Z A;  4FOE A;  4BG9 A;  5CE3 A;  1YUW A;  4JD2 B;  3DXM B;  3FZH A;  3HSC A;  1T44 A;  5LJW A;  4XH1 A;  3FGU A;  4BRO A;  2E2P A;  4WV7 A;  1IJJ A;  1RFQ A;  2EWS A;  5AQY A;  4BVO A;  1YVN A;  5BPL A;  1Q5L A;  1BDG A;  3H1Q A;  3WEE B;  2P9N B;  3DPO A;  5AQS A;  4RCH A;  3WXL A;  3SMS A;  4EHU A;  3QBW A;  1GLB G;  3BP8 A;  1ZXO A;  3GL1 A;  4FPB A;  3VEN A;  3SLC A;  3UKU B;  4PKI A;  5E26 A;  3S41 A;  3TU5 A;  4BGA A;  2P9N A;  3D2F A;  3A5N C;  3L6Q A;  2P9L B;  5KQ8 A;  2FSK A;  4HYB A;  4H0X B;  3HTV A;  4IZ9 A;  5EY4 A;  1HKB A;  4YDU C;  2QWN A;  1X3M A;  5BN8 A;  1T6C A;  2W41 A;  3ZX2 A;  2P9L A;  3ATV A;  7HSC A;  4XH5 A;  2IIR A;  3D2E B;  3FZF A;  2GUP A;  3H6E A;  1HLU A;  2QFF A;  1ZBS A;  2WUS A;  5I9E B;  4AM7 A;  1GLL O;  2VYP A;  4BRG A;  4GNI A;  3VEO A;  3IDH A;  1GLC G;  4A62 A;  5BPM A;  1BU6 O;  4BQZ A;  5ADX A;  2A42 A;  3WUH A;  4E81 A;  3WQT A;  1K8K A;  2HF3 A;  1HKG A;  4R5L A;  3VOV A;  4LC9 B;  3MMV A;  1BA1 A;  4R5J A;  1NLV A;  2YJE A;  1GLE G;  4BC2 A;  3CQX A;  3O08 A;  3WXJ A;  1DG4 A;  4AM6 A;  3A5M C;  1V4T A;  4EIA A;  5JLF A;  4I6M B;  2Q1N A;  4JHD A;  3IMX A;  1S22 A;  2P9U A;  3DXK A;  3VEY A;  3N8E A;  4M7Y A;  3O1B A;  3A5L C;  1NGB A;  4CBX A;  1HKC A;  3MN9 A;  3CJ9 A;  3CET A;  4EZN A;  4EAH D;  2CGL A;  2P9S A;  2VCP A;  5AQO A;  1GLF O;  4JAX A;  5LY3 A;  3LDN A;  4BR4 A;  4O5F A;  1NGA A;  3SK3 A;  1SAZ A;  4ISE A;  4CD3 A;  4PKG A;  4PO2 A;  3L4I A;  4QS8 A;  4Z94 A;  2J4R A;  1X9J A;  1QQO A;  2QWL A;  3QML A;  5AQX A;  3R8E A;  2FSN A;  3ID8 A;  4BRE A;  3CJC A;  1NBW A;  1IG8 A;  1QZ6 A;  5TKY A;  4IO8 A;  2BPR A;  4CJ7 A;  4H0O A;  5BRE A;  3G25 A;  4JWE A;  1P8Z A;  4BRP A;  4H5T A;  3T46 A;  4MO5 A;  4MLH A;  1D4X A;  3OHX M;  3U9D A;  3ZEU B;  3RSE A;  3H1V X;  4R5I A;  3QBX A;  3C7N A;  2GWK A;  5FPD A;  1XC3 A;  4NO7 A;  4Y0W A;  4CZH A;  5AQT A;  2FF6 A;  2ZWH A;  1NGE A;  5AZJ B;  3MN7 A;  3U8X A;  4H0V B;  2VWB A;  2HMP A;  4FWP A;  3DOB A;  3L3O M;  4BRQ A;  4ISF A;  1Z6R A;  3GG4 A;  5FPE A;  5AZJ A;  4YDU A;  1JCG A;  1Z05 A;  4BRM A;  5BPN A;  4XH4 A;  4B1Y B;  4BRH A;  1TUY A;  4BR2 A;  2FSJ A;  1HX1 A;  4K25 A;  1J6Z A;  3LDQ A;  3VGM A;  4H5R A;  5FPM A;  3BEX A;  5F1X A;  3EL2 A;  2A41 A;  5ELZ A;  3FE1 A;  1G99 A;  2Q0U A;  3D2F B;  2GWJ A;  5AZI B;  4C23 A;  2Q97 A;  4EFH A;  4NB4 A;  1X3N A;  1QQN A;  3KVG A;  3FZL A;  1U2V B;  1Y64 A;  4H03 B;  5BRF A;  2AP1 A;  1ESV A;  4BR7 A;  4DQ8 A;  4H0P A;  4B1U B;  3ULE A;  4QS7 A;  5AZI A;  2FF3 B;  2CGK A;  1ATN A;  3LDL A;  1MWK A;  2CH6 A;  2V7Y A;  1BUP A;  1U2V A;  4EZV A;  3J8A A;  4CZK A;  3CI5 A;  2E88 A;  4EZS A;  3H46 O;  3CJA A;  4XEI A;  3MCP A;  5EX5 A;  2OP6 A;  4L3Q A;  1DKG D;  4J8F A;  3UKR A;  2IVN A;  3CJB A;  5AQG A;  3O1W A;  1K8K B;  1DKZ A;  5FPN A;  3GDQ A;  2CGJ A;  5B8H A;  1QZ5 A;  4CZF A;  4BRF A;  1DKX A;  3F9M A;  2IVP A;  3O6W A;  3ZET A;  2GEL A;  3M1F A;  3AY9 A;  3H45 C;  4H0Y B;  5AQH A;  1NM1 A;  5KQD A;  1NMD A;  4BGB A;  3L0Q A;  4FWK A;  4FWS A;  3FZK A;  1GLA G;  3P4I A;  2E2N A;  4JHD B;  4CZG A;  2P9U B;  3DXK B;  3R6M A;  4FWQ A;  1ZC6 A;  2V52 B;  4BQL A;  3IFR A;  2W40 A;  1NGJ A;  1BWF O;  3BF3 A;  3GBT A;  4JNE A;  1TYQ A;  1MDU B;  4CD1 A;  2QXL A;  3QB0 A;  3CHW A;  3U4L A;  4EZQ A;  2P9S B;  3SMP A;  1BOT O;  1BG3 A;  4H5W A;  4EZT A;  3TPQ A;  4EZO A;  3DAW A;  4FWM A;  3DPP A;  1HJO A;  1R59 O;  3FR0 A; 
#chains in the Genus database with same CATH topology
 2ZJR L;  4CVN E;  5AQF A;  5IWA K;  4BE2 A;  2O8B A;  3DRS A;  1Z25 A;  4Z4E A;  4BE1 A;  5D3G A;  2LXY A;  1U47 A;  2GX9 A;  3EKU A;  3KLE A;  3LZI A;  4LF8 K;  3ENH A;  3M3W A;  4BC3 A;  2I7P A;  2WBN A;  1ASV A;  3A0I X;  4NLB A;  1B9D A;  4PKH A;  2BAN A;  3S9H A;  4FJK A;  2HHX A;  1E2U A;  2F9T A;  2Z8Y A;  1YT3 A;  1A5W A;  1QSL A;  1XQS C;  5AQR A;  1FK9 A;  3RPM A;  4B9V A;  4JWI A;  4YOU A;  2V51 B;  3CCU N;  3Q84 A;  2YHX A;  1TAU A;  4IKF A;  1RTJ A;  1Q7Y O;  3NGI A;  3V9X A;  4IFV A;  4B8C A;  4CJQ A;  1LWC A;  4KRE A;  4DTM A;  3DDG A;  1RT6 A;  4HUE A;  1WSJ A;  5AFU H;  2V0O A;  2Z1H A;  1KVB A;  1NGG A;  5MLC Q;  3BVW A;  2D4W A;  4AQY K;  4F2S A;  3VQ9 A;  4CIE A;  2ND1 A;  3ER8 C;  1NNE A;  5C15 A;  1U00 A;  3P1G A;  5BRH A;  1SL0 A;  2B4J A;  3P31 A;  1WN7 A;  4HCC A;  1VSK A;  4H8K A;  4IO9 L;  3ZX3 A;  2BTF A;  2WYH A;  4CEA A;  4H0T B;  3K57 A;  3M3Z A;  1IBK K;  3HL8 A;  4B1W B;  3MX5 A;  4DR5 K;  2HHH K;  4YOY A;  5C0Y A;  4M45 A;  3WNG A;  3JYT A;  3M8R A;  1MU2 A;  2A3Z A;  4IXC A;  2C08 A;  2QWR A;  4E3C A;  4ID5 A;  5HBM A;  3QEV A;  2OAN A;  3LWL A;  1VSJ A;  3ZEF A;  1W9M A;  1WB9 A;  2HHV A;  2VGN A;  2E1Y A;  4M3W A;  4M7X A;  2Q31 A;  1LWF A;  3DRR A;  2EFK A;  1NK7 A;  3UKR B;  2ATQ A;  1N34 K;  4GMJ B;  4BR0 A;  3DWL A;  1K73 O;  1EX4 A;  3K0S A;  3AVM A;  4PL7 A;  1E4F T;  3VF2 A;  4JD2 A;  3TAQ A;  3RMD A;  5J2M A;  1BO5 O;  3CC2 N;  4LD0 A;  2Q36 A;  2IVO A;  3O9U A;  3AAQ A;  4WQ5 C;  2DY4 A;  1I49 A;  3WXK A;  1FW6 A;  4E1J A;  2WYI A;  3SUN A;  1E1D A;  1WDZ A;  2YL9 A;  1J53 A;  3OJU A;  4DV2 K;  4EZW A;  5EVZ A;  4CES A;  2HF4 A;  2HVH A;  1TYQ B;  1OH7 A;  1IV0 A;  1P90 A;  4NXM K;  1I4D A;  3K58 A;  4F01 A;  2OO2 A;  2IAJ A;  3CCM N;  4B1V A;  3HXM A;  4FJN A;  1WNS A;  3ATU A;  3O3G A;  3D45 A;  1GLD G;  3WQU A;  4CJ3 A;  1KXP A;  2P9P A;  1MJG A;  1HNX K;  4F00 A;  3J7A P;  1TQT A;  3T19 A;  2O8E B;  3DX0 A;  4W5O A;  5AQP A;  3D0P A;  3K5M A;  5GAG P;  1R34 A;  4F9O A;  1E9V A;  3C0B A;  4DTU A;  4FM3 A;  3A98 A;  4FO0 A;  3QEI A;  4FJ7 A;  2X6N A;  2D1K A;  4JLH A;  4M63 C;  1C0G A;  3OYH A;  4KBO A;  4ILH A;  4Y1C A;  1M90 O;  1ATS A;  1SV5 A;  4I2P A;  3VQQ A;  4DMN A;  5C2F A;  3SBS A;  3OYC A;  4JN4 A;  4FLW A;  4WCE L;  5I42 A;  3LM2 A;  2D0P A;  1BI4 A;  3LZJ A;  1NGD A;  4DS4 A;  3I56 N;  3O9S A;  2PY5 A;  4X62 K;  5AQU A;  4IG3 A;  4CHN A;  5C12 A;  4FLV A;  1JLG A;  4EHT A;  2O8C B;  5C24 A;  1T7P A;  5ADX H;  2UXD K;  3WXM B;  3CC4 N;  1YTU A;  4DTN A;  3CJ1 A;  2G8F A;  1C1A A;  3MDQ A;  3OYG A;  3MED A;  3J81 O;  3O4W A;  3DQG A;  2WTU A;  2X6S A;  4BRA A;  3EJP A;  2UUC K;  1T6D A;  3ZEU A;  4CZM A;  3HOS A;  4FLZ A;  4DR2 K;  1C0M A;  3B6O A;  5CZ2 A;  3VGK A;  3HPH A;  3TSU A;  3VEW A;  4YOV A;  4ZTJ A;  5BR9 A;  3NCI A;  3LAK A;  4IJA A;  1XNQ K;  1VQO N;  1OH6 A;  3DYT A;  3AVB A;  3NDK A;  5CE3 A;  4CJT A;  2YI9 A;  3DXM B;  5HRO A;  3I0R A;  4KH5 A;  4XH1 A;  4BRO A;  4WV7 A;  3RMA A;  1VRU A;  4O55 A;  4DQQ A;  3S3N A;  1LV5 A;  1Q5L A;  4Q5V A;  3VQE A;  1Q86 O;  3WEE B;  2UXB K;  4DR4 K;  2KFZ A;  3I39 X;  4RCH A;  3OYJ A;  4EHU A;  3QBW A;  1ZXO A;  3VEN A;  3RV0 A;  4FPB A;  4FM2 A;  3SLC A;  4KHU A;  4YOX A;  4PKI A;  3G6E N;  5E26 A;  2RAJ A;  3TU5 A;  3AVG A;  1O1W A;  2JWL A;  2OZM A;  5KQ8 A;  3VN5 A;  2FSK A;  1YIJ N;  1TKZ A;  4ILG A;  3HTV A;  1U04 A;  2QWN A;  1X3M A;  1O13 A;  4NQI A;  3ATV A;  3BZC A;  1WBB A;  3FZF A;  4M3Y A;  2HMI A;  4O0I A;  3C95 A;  1JL2 A;  1GLL O;  2VYP A;  3VEO A;  5KRS A;  4A62 A;  4KB0 A;  3AVI A;  4CF0 A;  2QA4 N;  1TV6 A;  2NRT A;  4I9L A;  4DTR A;  3LP1 A;  3SZ2 A;  1VQL N;  3R1X A;  3PY8 A;  3D4Z A;  3MXM A;  3P5J A;  4LC9 B;  1W97 L;  3BY5 A;  4KTQ A;  4R5J A;  1NLV A;  1VSH A;  3T3F A;  3DLB A;  1OVY A;  2UXC K;  3O08 A;  3ZT1 A;  1LW0 A;  4AM6 A;  3R3L A;  1V4T A;  2F18 A;  3CCR N;  4DTS A;  1T03 A;  3NFA A;  2F1B A;  5HLF A;  5M1N A;  2KZZ A;  3TAE A;  3VEY A;  1QSS A;  3O3O B;  4CBX A;  1GN9 A;  3MN9 A;  4EAH D;  4AHU A;  5LY3 A;  4RW6 A;  1NGA A;  4CJF A;  4M3T A;  1HQU A;  4HR1 B;  4E72 A;  4CD3 A;  4PO2 A;  1KFD A;  4QS8 A;  3EY1 A;  4Z0U A;  4IBN A;  2YKT A;  1QQO A;  4BDP A;  3R8E A;  4BRE A;  1HTY A;  3CJC A;  1NBW A;  5I3U A;  1OVQ A;  2EX3 A;  3NF8 A;  3OYD A;  4IO8 A;  4IOC L;  3G25 A;  2RAK A;  4JRQ A;  1I4L A;  4LSL A;  4H5T A;  5HP1 A;  3SQ0 A;  3O3F A;  3L2V A;  3HK2 A;  3OHX M;  2B5J A;  5HRP A;  4JI0 K;  3O9Q A;  3PLA A;  5AQT A;  2X5C A;  3NHG A;  3D4Y A;  1N5Y A;  4K8X A;  1VQ4 N;  3C65 A;  4GVM A;  5FRN A;  3UIQ A;  2HMP A;  4KHP K;  3HAH A;  2QK9 A;  2X3W A;  1JLQ A;  4BRQ A;  4OKJ A;  4DF8 A;  1HYV A;  3GG4 A;  4AZI A;  2QTD A;  3OA9 A;  4WF9 L;  3JAM O;  4B1Y B;  4JK9 A;  4BRH A;  2FYV A;  3O9R A;  4CJU A;  1JLF A;  1D9D A;  3NVM A;  4QAG A;  4CF8 A;  1KRP A;  1J6Z A;  3VGM A;  1XC9 A;  1FJG K;  1IKY A;  4JL9 A;  5HRS A;  5CYQ A;  2YNF A;  2ND0 A;  3D2F B;  3V9S A;  3HST B;  4OO1 J;  3PIP L;  1X3N A;  3FZL A;  4HHT A;  5BRF A;  1KLN A;  4IEE A;  1QVF M;  3ZSQ A;  3CMA N;  3CM5 A;  3S3O A;  4H0P A;  4QS7 A;  3DM2 A;  1I3A A;  5J2P A;  3BZK A;  1OH8 A;  5HL7 L;  1BUP A;  4LF6 K;  4DV3 K;  4MQD A;  4I2Q A;  4CZK A;  3CI5 A;  1GNT A;  1CXU A;  1VHX A;  1N8R O;  3OS0 A;  3VQ7 A;  4FK4 A;  3CJB A;  3THV A;  3CVR A;  4M0M A;  1DKZ A;  2IDO A;  5C10 A;  3ZET A;  4BWM A;  3TAP A;  4W5R A;  3L0Q A;  3VMF B;  1S72 N;  4B08 A;  4FWS A;  3FZK A;  3LP3 A;  2YX6 A;  3G10 A;  1C1C A;  4ID1 A;  5GAD P;  4FJJ A;  3PX4 A;  4A57 A;  4EZ6 A;  3E1Y A;  2WC9 A;  1OA1 A;  2W40 A;  1BWF O;  3KLH A;  2O8B B;  4JNE A;  4JKE A;  3AGR A;  4DLG A;  3OWG A;  3NAE A;  2OTL N;  4EZQ A;  2P9S B;  2YL5 A;  4EZO A;  3DAW A;  1IBM K;  4FWM A;  1QWN A;  2G8V A;  2X78 A;  3AVC A;  2IS3 A;  4B1X B;  4YNQ A;  4CBU A;  4FYD A;  3PSF A;  3BVX A;  2NRH A;  1S9E A;  3PV8 A;  5AQV A;  1W2B M;  3I8D A;  3BUB A;  3CC7 N;  4ZHR A;  1NKE A;  1N6Q A;  3NH0 A;  3S3M A;  3BUZ B;  3BVT A;  4IM0 A;  4ATM A;  1RDW X;  3C6A A;  4NYF A;  2NNW A;  1JXE A;  2ZGY A;  2GTD A;  4GW6 A;  4A5A A;  3CG7 A;  4DQS A;  2KHO A;  4R5K A;  5AQJ A;  1SS6 A;  3OYN A;  1YI2 N;  3EO3 A;  3O3H A;  3T1H K;  3RSE B;  3C7N B;  1HXK A;  2Z0V A;  3AO4 A;  4CZI A;  3LDO A;  3ZT3 A;  2WOM A;  1NJZ A;  2XY6 A;  2KZM A;  2O4G A;  3P39 A;  3SAG A;  2BGG A;  3OYB A;  1F21 A;  1BIZ A;  2QW9 A;  4DV5 K;  4HUF A;  4QOZ B;  2A5X A;  3DJC A;  3RTV A;  1DGK N;  4IDK A;  1HMV A;  3ZED A;  1LOT B;  4FWN A;  5F0X A;  3H3N O;  5AQK A;  5JMV A;  4DHY A;  3ENO A;  4Z4F A;  2Z1G A;  4RG8 A;  4Z4G A;  4WQ4 C;  3L2W A;  3T69 A;  2D0B A;  1W0H A;  3VQ6 A;  4AHS A;  2JLE A;  1NGI A;  3ASM A;  5M1P A;  2B6A A;  3HAI A;  1V4S A;  4BVP A;  1NKC A;  2ZGZ A;  1U4B A;  1WOQ A;  1JLB A;  3ULE B;  4MLE A;  4OPH A;  3RRH A;  1HPM A;  3ISN C;  2YHB A;  3SAF A;  5CYM A;  4CJE A;  1VQN N;  4HTL A;  1RBR A;  3QIC A;  2F9W A;  2FLO A;  2F4V K;  1TK5 A;  3MXI A;  2Y1I A;  5EXW A;  2NRX A;  2DFH A;  4JKC A;  4IWQ A;  4JWD A;  3OBW A;  3OYE A;  4K41 A;  5KPT A;  2UUA K;  2QKK A;  4GKK K;  4ILI A;  4HY9 A;  4WV5 A;  2ZF5 O;  3EKS A;  2OPS A;  2F1A A;  1NGC A;  1DTQ A;  4J2E A;  2DPN A;  3I33 A;  2KTQ A;  3THW A;  3LDP A;  1O7D B;  1NK5 A;  1C0F A;  4RW9 A;  5K14 A;  1SKW A;  3F7W A;  4PQU A;  4FLX A;  4QS9 A;  5C25 A;  4FOI A;  3AO3 A;  2QWO A;  1VQ9 N;  4NYN A;  3A2F A;  1YJN N;  4JK8 A;  1TAQ A;  4LFB K;  2NUB A;  4DB3 A;  3SPY A;  3CF5 L;  3BDP A;  2O8D A;  4BC5 A;  4FWR A;  2Y1J A;  2P9P B;  4ISG A;  5KRT A;  5DM6 L;  5KGW A;  3M8Q A;  4NLC A;  3RVC A;  4CF9 A;  3CME N;  3VKH A;  4BRK A;  4EZZ A;  4UDY X;  4A61 A;  1SU6 A;  3FFK B;  3QNI A;  3D2E A;  4CZJ A;  3J7Y P;  4FZX C;  4K43 A;  3NF7 A;  4DTP A;  1S1V A;  4IWV A;  1ITG A;  3LVT A;  1YAG A;  4CHY A;  3OYK A;  1X9M A;  4O0J A;  4AHC A;  1ASW A;  4C8K A;  1ZBF A;  1A5X A;  1RNH A;  3FD9 A;  2RAI A;  5AQW A;  1X1P A;  3HVT A;  4H6H A;  3LL3 A;  4LY7 A;  5KPR A;  4UQG A;  2YCH A;  3VEZ A;  5AQM A;  3J7Z O;  3V9W A;  2P9K B;  1K8A O;  3N4P A;  4B9Q A;  4CEQ A;  2D5R A;  1CZ9 A;  4B1Z A;  3DPQ A;  1VQM N;  3VA0 A;  4JI4 K;  3DX4 A;  1BA0 A;  3RRG A;  4E7J A;  1NGH A;  3O4Q A;  4I6M A;  3CIP A;  1WAJ A;  2PBD A;  2HVI A;  4K42 A;  3P38 A;  2D1L A;  2C1I A;  3QE6 A;  3O8M A;  4IOX A;  3CCE N;  1C1B A;  4Q0B A;  3QDK A;  1ZYL A;  2P51 A;  4CE9 A;  4N76 A;  2E2Q A;  3UIT A;  3B51 X;  4NSW A;  1QQM A;  4DU1 A;  1YWM A;  4BC4 A;  1H1V A;  3SBT A;  2QWM A;  1RDC A;  1HRH A;  5F2R A;  4F8R A;  4K8Z A;  3E9P A;  4Z4H A;  4FPA A;  4DV0 K;  4R5P A;  1TVR A;  3ULD A;  3BUI A;  3M8S A;  2WON A;  4AZC B;  3SJH A;  4DG1 A;  5LJV A;  2ASO A;  1NK8 A;  3DLR A;  1OA0 A;  4CJS A;  3C6U A;  2FC0 A;  3AO5 A;  2CH5 A;  4WQ5 A;  2P9I B;  4EZU A;  4FJ5 A;  3T48 A;  4DF4 A;  1X9W A;  4BNE A;  2Z1I A;  1S9G A;  3PUF A;  3EEQ A;  4N47 A;  3IUC A;  3K9J A;  4R79 A;  1SL2 A;  4B9N A;  1TKX A;  4EZY A;  4DU4 A;  4BG9 A;  4YY3 K;  4FOE A;  3PIO L;  1YUW A;  4JI3 K;  1RTH A;  2PYJ A;  3HSC A;  4KTW A;  4CJV A;  1T44 A;  5LJW A;  3DRP A;  2E2P A;  1IJJ A;  1BCM A;  3B6P A;  4B3M K;  4DSI A;  2YIA A;  4CEE A;  3H1Q A;  1HNZ K;  4FJ9 A;  2R7Y A;  3DPO A;  4KTZ A;  5AQS A;  1SU7 A;  4I1Q A;  1C0U A;  1NK0 A;  5DK5 A;  4JKB A;  4W5N A;  3EJT A;  3UKU B;  4BDY A;  3LDS A;  3S41 A;  1VSL A;  2P9N A;  4CEZ A;  4DSF A;  3TAG A;  4AF1 A;  1NJX A;  3PO5 A;  1R5E A;  1B92 A;  4OGC A;  1XI1 A;  3NF6 A;  1L5U A;  2WFB A;  4HCB A;  2DTU A;  1HKB A;  3AVK A;  2HBK A;  2P9L A;  4AZ7 A;  4XH5 A;  2IIR A;  2GUP A;  4FW2 A;  3LPT A;  4OX9 K;  1ZBS A;  5I9E B;  4KIK A;  1RBT A;  2GUI A;  2VG7 A;  1LAW A;  1Q81 O;  4JEP A;  4CFA A;  2O4I A;  3OTO K;  4E81 A;  4LF7 K;  2IGI A;  4C8N A;  4CGF A;  3V9Z A;  2YJE A;  3K5O A;  3L3P A;  3CQX A;  3THX B;  1DG4 A;  4PA1 A;  3NMU A;  3A5M C;  1HYZ A;  4EIA A;  3SUP A;  1SU8 A;  3ABH A;  1Q82 O;  2Q1N A;  4CF1 A;  4RW8 A;  1S22 A;  3HP6 A;  2P9U A;  3DXK A;  4ELV A;  3A5L C;  4N56 A;  2YLA A;  1BQM A;  1LWE A;  3BLB A;  2YI8 A;  3AA2 A;  1HKC A;  1KLM A;  4E7K A;  1VSM A;  4KV8 A;  4I43 A;  3THY B;  3LDN A;  4L8R B;  3KTQ A;  4ISE A;  4DQR A;  1KFS A;  2G8H A;  3LAM A;  2AJQ A;  4DYL A;  2EX3 B;  1X9J A;  3KLI A;  5AQX A;  4PWD A;  3SV3 A;  1IG8 A;  1FKO A;  1QZ6 A;  1IO2 A;  4CJ7 A;  5BRE A;  4CIG A;  1NG9 A;  4JWE A;  1P8Z A;  3ZSR A;  4AVM A;  3T46 A;  5H1S Q;  1QVG M;  2HBM A;  3KWI A;  5HOO A;  1RT2 A;  1NJW A;  2GWK A;  4CZH A;  1T3V A;  3J80 O;  2NRZ A;  2FF6 A;  4HUG A;  1D9F A;  2C1G A;  1B9F A;  1NGE A;  3G9G A;  3U8X A;  3SYZ A;  2F7T A;  4AZG A;  1T8E A;  1RDD A;  2OA8 A;  2RPI A;  2RF2 A;  4ISF A;  1KQS M;  3NVK A;  3QWE A;  4A59 A;  4CJL A;  2ZD1 A;  3RMC A;  4E0D A;  3CV5 A;  4BRM A;  1HJR A;  3CFP A;  4E19 A;  2ZE2 A;  4BR2 A;  3KLF A;  2FSJ A;  3QNO A;  1ZBH A;  2QKW A;  2FIC A;  5C5B B;  5FPM A;  2XRI A;  3BEX A;  1EWR A;  1Z26 A;  2A41 A;  5ELZ A;  3NE6 A;  3FE1 A;  4W5Q A;  1JLE A;  3CXC M;  2W42 A;  1RTI A;  4KPY A;  3K2P A;  1QQC A;  1IG9 A;  4B3T K;  1HR0 K;  1J5O A;  2HHW A;  1RDU A;  3VQP A;  4GV9 A;  1QQN A;  4IEI A;  2JNK A;  3KVG A;  3AA3 A;  1Y64 A;  4PHT X;  4H03 B;  2AP1 A;  1S6P A;  1ESV A;  4GVE A;  1JKH A;  4FLY A;  2ETJ A;  3AVJ A;  1ATN A;  2HB5 A;  4DR1 K;  3DI6 A;  2F7R A;  2UU9 K;  5DM7 L;  2V7Y A;  2O8F B;  3DX2 A;  1BIS A;  2YLL A;  3HPO A;  3H46 O;  4EP5 A;  2Q12 A;  3CJA A;  4BEC A;  3MCP A;  5EX5 A;  4JK7 A;  4L3Q A;  4H8S A;  3PLT A;  2HHU A;  3UKR A;  2IVN A;  5GAH P;  5AQG A;  5FPN A;  1K8K B;  4LF5 K;  4FW1 A;  3OY9 A;  1DKX A;  2IVP A;  4X66 K;  4DCN C;  3H45 C;  5AQH A;  3ZT2 A;  3HVR A;  2XY8 A;  4FWK A;  2ZJQ L;  5A2Q O;  1GLA G;  3DOL A;  3M8P A;  4JHD B;  3K59 A;  5M1O A;  4FWQ A;  3L2R A;  1ZBL A;  4ELT A;  3C6T A;  3IFR A;  3BF3 A;  3U3G A;  3OS1 A;  1TYQ A;  2D4C A;  3I0S A;  3JSM A;  2QXL A;  3SMP A;  1BOT O;  4DTJ A;  1U49 A;  4EZT A;  3K5N A;  1C6V A;  3FR0 A;  4AHR A;  4OPA A;  3ENB A;  1L3V A;  3KLG A;  3T47 A;  1TKD A;  4DLE A;  4E7L A;  2W00 A;  2QWP A;  3QFP A;  2O8E A;  3TAM A;  2NZT A;  4U67 L;  4DKW A;  5FIG A;  3PO4 A;  1QWU A;  3C94 A;  4O44 A;  3M5R A;  2YHW A;  2VWK A;  1CZA N;  1RBS A;  4BY9 C;  3LPU A;  5CZ1 A;  3VEX A;  4IW0 A;  4PUO A;  2H3G X;  3LWM A;  1IBL K;  2YI1 A;  4H4O A;  3U3Y A;  4CIF A;  3FFI A;  3QET A;  1RBU A;  2XHB A;  1NU0 A;  5C2D A;  3QIP A;  1GOC A;  4NCA A;  1SQK A;  1LW2 A;  4GV3 A;  2E4L A;  3A8Y A;  3KZB A;  1VAZ A;  5EOY A;  3T4A G;  1L3T A;  5BN9 A;  3O3N B;  4E3S A;  3CM6 A;  2G8U A;  1D8Y A;  4K0K K;  4WFN L;  3AVF A;  2HW3 A;  4FJG A;  3JXU A;  1E3M A;  2YKM A;  1WBD A;  4KB1 A;  4R5G A;  4O5B A;  3VES A;  4B9S A;  4EZR A;  5JIC A;  1GOA A;  3TAN A;  3CYG A;  1KVC A;  2D0A A;  3CER A;  1EQY A;  5EU7 A;  2O8C A;  5KI6 A;  4IWO A;  3EJQ A;  4JKH A;  1Q9Y A;  1Y97 A;  3KKR A;  5LMN K;  1MWM A;  3RR7 A;  2LSN A;  2BDP A;  4X65 K;  5AQL A;  5FLX O;  3OYI A;  3CCV N;  2E8A A;  1VQK N;  4LF4 K;  4HWI A;  2E6M A;  4ELU A;  5AR0 A;  2HND A;  2OCE A;  3LP0 A;  4U7B A;  2F7Q A;  1XWL A;  1QSY A;  1X9S A;  3B8A X;  1PS3 A;  3E9L A;  4CED A;  3FLC O;  1S1X A;  1IKV A;  1G15 A;  4BRL A;  4CFD A;  2X3V A;  2OW7 A;  5HRR A;  4CF2 A;  1UA1 A;  1Q18 A;  3DXM A;  3JS6 A;  3Q7C A;  4F3O A;  1NGF A;  1M1K O;  1QS4 A;  5AQZ A;  4FK0 A;  3SOG A;  1YTA A;  1QHT A;  4H5V A;  3WEE A;  2O8D B;  3VQ8 A;  3EE8 A;  1QHA A;  4F2R A;  2KFN A;  2GF4 A;  1RDA A;  1A5V A;  4EZP A;  2F96 A;  5JLH A;  2ALW A;  3WT0 A;  3F9K A;  3QLH A;  1S1U A;  4FJM A;  1VSD A;  3NH1 A;  4CZE A;  1KAZ A;  1S5J A;  5AFU A;  3H08 A;  1RDB A;  3QEP A;  5BRD A;  2Z0N A;  2ITG A;  4FSV A;  4JKG B;  2G8K A;  5JVG L;  2Q13 A;  2EFL A;  5GIP A;  2DFE A;  4KHY A;  2VWJ A;  1DLO A;  1RGI A;  5BR8 K;  1XUP O;  1ILY A;  1IKW A;  4EZ9 A;  1N36 K;  4A5B A;  4FWL A;  4LFA K;  3OK8 A;  4RW7 A;  3EN9 A;  4H5N A;  2KLA A;  1E4G T;  2A6A A;  2ZQB A;  1HUX A;  4PL8 A;  4CFC A;  2W6L A;  4OLA A;  4FZY A;  3VEV A;  4BE7 B;  2QI2 A;  4RWT A;  2D0O A;  2PY6 A;  1VRT A;  3DOK A;  4DS5 A;  4FWO A;  4IG0 A;  4O8K A;  1UA0 A;  4WQ4 A;  3L3U A;  1XMO K;  3AVA A;  3CFR A;  1EO1 A;  4IJN A;  1YXQ A;  3ZSO A;  4E89 A;  4H6I A;  3OYM A;  1MA9 B;  1KSP A;  3PX0 A;  4DR7 K;  5AQN A;  3M6G A;  1ZWW A;  1N32 K;  1LCU A;  3H0X A;  4LH4 A;  3F73 A;  5E41 A;  1ZBI A;  3DMJ A;  3ZT4 A;  2JNS A;  4KFB A;  4RTF D;  2NRW A;  3MN5 A;  1SKR A;  1ZYQ A;  3FZM A;  2YHY A;  3AV9 A;  3DLK A;  1HNW K;  2Q0R A;  1VQ6 N;  1N33 K;  3HI0 A;  3DYA A;  3UE5 A;  4HR1 A;  3HM8 A;  4DSE A;  4JV5 K;  3EZW A;  4M3X A;  4AZH A;  5J1E A;  1RT5 A;  1ZBU A;  4ZTF A;  4A2B A;  4FLU A;  3HT3 A;  4FL9 A;  2ASM A;  3HZ6 A;  5GAE P;  4HVJ A;  3MWT A;  3O5B A;  4KI4 A;  2PMR A;  3NGZ A;  4AHV A;  3MEE A;  3KIO A;  3KDR A;  3DX3 A;  2GBZ A;  4KAZ A;  3IRX A;  3CCJ N;  4BR9 A;  4AZ6 A;  3MWP A;  3W0L A;  4W5T A;  4FJI A;  1VSI A;  1TQW A;  1EKE A;  1EWQ A;  3QEW A;  3TWH A;  1UAX A;  3QNJ A;  4M41 A;  3DDF A;  2AA4 A;  1K6Y A;  4BRI A;  1TQS A;  1W9H A;  3KAW A;  3TSQ A;  5FRM A;  3U9Z A;  4AHT A;  4JD2 B;  1OAO A;  4FVM A;  3WNH A;  1RFQ A;  1TL1 A;  5AQY A;  4BVO A;  4DU3 A;  5BPL A;  4CCH A;  1BDG A;  4CHQ A;  3V1R A;  3TAF A;  2P9N B;  1VQ7 N;  3MAQ A;  2JWK A;  3SMS A;  3SJJ A;  3K9K A;  4J2D A;  1RIL A;  3GL1 A;  4BDZ A;  1BQN A;  1Q9X A;  1RTD A;  1CLQ A;  1I94 K;  4MFB A;  3SBG A;  3BVU A;  3MXJ A;  1IKX A;  1WLJ A;  4BGA A;  3D2F A;  3IS9 A;  3L6Q A;  4AZB A;  2P9L B;  4KRF A;  4DV4 K;  3NH2 A;  4JI1 K;  2EWF A;  3CD6 N;  2RKI A;  4H0X B;  1X03 A;  4KIK B;  4IZ9 A;  5EY4 A;  4YDU C;  4YOR A;  4DQP A;  4CK3 A;  7HSC A;  4CER A;  4DTO A;  3H6E A;  2OW6 A;  1HNI A;  1HLU A;  1HYS A;  4BRG A;  4GNI A;  2MI7 A;  3IDH A;  1GLC G;  4I7F A;  2LM0 A;  5BPM A;  4JKG A;  2NRV A;  1BU6 O;  4BQZ A;  5ADX A;  3LMF A;  4G6Q A;  1EP4 A;  2RT6 A;  3L8B A;  2NCZ A;  4IDH A;  3WQT A;  3CCL N;  1HKG A;  3EJU A;  1Q8I A;  4R5L A;  3MMV A;  2PFU A;  1BA1 A;  2W6K A;  1TK8 A;  3Q0K A;  1GLE G;  2YNI A;  4JKF A;  4BC2 A;  3KWG A;  3T1Y K;  3WXJ A;  4ILH B;  3QA8 A;  5JLF A;  4OLB A;  4LFC K;  4JS5 A;  2Q3S A;  1IH7 A;  1EET A;  3EZ5 A;  4CEB A;  1ASU A;  4OPK A;  3VQC A;  1BI4 B;  3CJ9 A;  3CET A;  2CGL A;  3ZSW A;  4CJ4 A;  2P9S A;  2VCP A;  5AQO A;  3G0Z A;  1GLF O;  4JAX A;  3KAV A;  2OYQ A;  2HNY A;  3OS2 A;  3DLH A;  5JS2 A;  4BR4 A;  4FJ8 A;  5SWM A;  3SK3 A;  4BWJ A;  3SQ4 A;  4FM1 A;  5AJ3 K;  3SCX A;  3L4I A;  2RE2 A;  3AO2 A;  2J4R A;  4KH6 A;  5TKW A;  3TAB A;  2D0C A;  4OVL A;  3SNN A;  2FSN A;  3QO9 A;  3LP2 A;  3AGK A;  3GI7 A;  1NOY A;  2PYL A;  3F2K A;  1XNR K;  1KCF A;  3VQB A;  4BRP A;  5C42 A;  2OPQ A;  4MO5 A;  3Q7B A;  4MLH A;  3ZEU B;  3U9D A;  3RSE A;  2F7O A;  2Z0O A;  4R5I A;  3QBX A;  3KK3 A;  3C7N A;  1UWB A;  3V1Q A;  5FPD A;  1XC3 A;  4NO7 A;  4CGH A;  4KHW A;  2RN2 A;  4E1N A;  3MN7 A;  2VWB A;  3DOB A;  3L3O M;  3MCA B;  3DLL L;  4AKV A;  2YIV X;  3HP9 A;  5AZJ A;  4KHS A;  3D6R A;  4DTX A;  1UPX A;  4XH4 A;  1TUY A;  5GIN A;  5CHI A;  4YHH K;  4FCY A;  2HHQ A;  1HX1 A;  4K25 A;  2OPR A;  3LDQ A;  4Z4C A;  4H5R A;  1S6Q A;  1JQK A;  5F1X A;  3EL2 A;  3CKD A;  1J5E K;  1SUF A;  2Q0U A;  4C23 A;  2GA9 D;  4NB4 A;  5KGX A;  4LF9 K;  4CGJ A;  4E7H A;  4GV6 A;  4FZS A;  4ILG B;  3TTC A;  3U6F A;  3KJV A;  4BR7 A;  4IWP A;  1U48 A;  3V9U A;  4B1U B;  3ULE A;  5AZI A;  4CW7 B;  3KD5 E;  2FF3 B;  3LDL A;  4FZP A;  3I2W A;  4UDX X;  1VQP N;  1QX1 A;  2CH6 A;  3CPW M;  3B52 X;  4DV7 K;  2X74 A;  1U2V A;  3V4I A;  3J8A A;  1WSE A;  4J2A A;  4EZS A;  4XEI A;  1DT9 A;  4CJW A;  2E5L K;  4J8F A;  1SUQ A;  4B9L A;  3O1W A;  1BL3 A;  4CZF A;  4BRF A;  4DUZ K;  3O6W A;  3AO1 A;  2GEL A;  2E6L A;  1I4T A;  5KQD A;  1NMD A;  3IAY A;  1VQ8 N;  4WFB L;  4KKO A;  4FVU A;  4FZZ A;  1YIT N;  1NJY A;  2YHA A;  3QNN A;  3DX1 A;  1UOC A;  2VG6 A;  3P4I A;  1REV A;  1WSH A;  4CZG A;  3EJR A;  1VQ5 N;  4B9T A;  4IOA L;  4NCB A;  1JL1 A;  1ZC6 A;  2V52 B;  1J9A A;  4BQL A;  2F8S A;  3NF9 A;  4ILJ A;  1MDU B;  5FLE X;  1CZB A;  3CHW A;  5LMU K;  3MX2 A;  1RT3 A;  4JI2 K;  2IOC A;  3OW2 M;  1NOZ A;  1HJO A;  1R59 O;  3OVN A;  3P83 D;  4CK1 A;  2P5G A;  3OJS A;  3T7Z A;  4BAC A;  2ITM A;  4Z4I A;  4B9U A;  2FXU A;  3W3D A;  5J2Q A;  1RT7 A;  1OKJ A;  2ZM6 K;  2HHT A;  1RBV A;  4CGD A;  3SPZ A;  4MDB A;  1T05 A;  3ZSY A;  3MN6 A;  2KW4 A;  3CZN A;  1I39 A;  3KK1 A;  1O7D C;  4C8O A;  1TUU A;  3MEG A;  1WAF A;  4O4G A;  1HQE A;  3E01 A;  3SYV A;  3KK7 A;  3V6D A;  2YJF A;  1NWK A;  3QER A;  4O8U A;  2E20 A;  5JS1 A;  3T49 A;  2KKZ A;  4CEO A;  4ICL A;  2A1R A;  1GLJ O;  1S3X A;  2HOE A;  3ZLJ A;  1KTQ A;  2P9K A;  1WSF A;  2A40 A;  1Y2O A;  1BHL A;  4HTU A;  3CQY A;  2BUP A;  2UYT A;  3HM9 A;  3BVV A;  2Q2R A;  1KAX A;  4BRN A;  3RV1 A;  1XHZ A;  4NXN K;  1KD1 O;  2RHK A;  1BPR A;  3AVL A;  3ACO A;  3B53 X;  4NPH A;  1WSG A;  3I8B A;  4CHO A;  1X04 A;  3EE9 A;  2FBY A;  3N4Q A;  4D8J A;  4CGG A;  1JCE A;  3D51 A;  3ZX0 A;  4FXD A;  1TKT A;  3PSI A;  3CFO A;  2NLX A;  1BIU A;  2FBX A;  3MEC A;  4V19 S;  3SI6 A;  2VGM A;  2GEM A;  1HWW A;  4QCL A;  3G71 N;  5AQI A;  4XJX A;  3E66 A;  3ZCM A;  5KTQ A;  3QFU A;  1DEJ A;  3T1A A;  3CCS N;  3DLG A;  2P5O A;  4AZC A;  1WUA A;  3LM9 A;  5HRN A;  1L3S A;  1JCF A;  3VF6 A;  4BRD A;  1NK9 A;  2OPP A;  4EZX A;  4JS4 A;  4DFK A;  1NK6 A;  4B8A B;  3HBT A;  2P9I A;  4JNF A;  4M42 A;  4X64 K;  3L2Q A;  4OGE A;  3MK6 A;  1GOB A;  1YVU A;  3VGL A;  1K9M O;  1CKR A;  2YNG A;  3VQ4 A;  3OYL A;  3HOT A;  4DR3 K;  1VSF A;  3IG1 A;  3ZET B;  1BCO A;  1U45 A;  1URU A;  3NGY A;  2YL6 A;  2PAV A;  2QWQ A;  3AAP A;  3HYF A;  2XO7 A;  4DFM A;  2QM1 A;  2NRR A;  4A2A A;  4JKA A;  2DFF A;  1DTT A;  3RMB A;  2YNH A;  3SQ1 A;  3BGR A;  1L3U A;  4JI7 K;  1RT4 A;  3SUO A;  3HJF A;  1KC8 O;  3L3V A;  5IT9 O;  3L2U A;  5CY4 A;  4BR5 A;  4BEB A;  2YL8 A;  4KHQ A;  3UKU A;  1W7A A;  4KHN A;  4KO0 A;  2ZXQ A;  1SL1 A;  3I04 A;  4CI6 A;  1TQV A;  3AAR A;  3CQ8 A;  4BE0 A;  3VTI A;  4GKJ K;  4WE1 A;  2ASP A;  1NMN A;  4JI6 K;  3WXI A;  4JWC A;  3GE1 A;  3O80 A;  4BG8 A;  4BRC A;  1DKY A;  4DQI A;  3R9P A;  3L4Q A;  4M3Z A;  1U6Z A;  3WNE A;  2HST A;  1LQ7 A;  4N41 A;  4OJR A;  1JLC A;  4WPE A;  3GOI A;  4C8M A;  4B3S K;  1KAY A;  3LLL A;  2O0I 1;  4DCH A;  3KD1 E;  3VET A;  2VQF K;  4DWI A;  4CJP A;  4G1Q A;  4MO4 A;  3H3O B;  1XMQ K;  3THX A;  3VQD A;  4CJ5 A;  1SZ2 A;  4WYB A;  5M1F A;  5LL6 Z;  4C1N I;  2YIB A;  1TQU A;  5AQQ A;  3OHR A;  1BGX T;  3BF1 A;  3AVN A;  3LAL A;  3KHY A;  3HO1 A;  3CZS A;  3O3M B;  2EHG A;  3THY A;  3VA3 A;  2V7Z A;  3TTF A;  4Y1D A;  1TGO A;  3CPE A;  2XY7 A;  4NCG A;  5E84 A;  4GY2 B;  3RWU A;  3CJ7 A;  3A5O C;  2X3X A;  3CCQ N;  3V1O A;  1VK0 A;  5KPZ A;  4CEC A;  4CBW A;  4CJR A;  3VER A;  3UB5 A;  3KKS A;  4LSN A;  3VPZ A;  3D7E O;  4CZL A;  5SZT A;  2I5J A;  5KBP A;  3SAH A;  2F8T A;  2OBL A;  2WIN M;  2E2O A;  3TI0 A;  3TAR A;  2N3K A;  4OKE A;  4TSX A;  5JEN A;  2E1Z A;  1NKB A;  2I7N A;  4C8L A;  1OH5 A;  3F5T A;  2OZN B;  3VF4 A;  3EJS A;  1R0A A;  5J2N A;  3LAN A;  1ATR A;  4DV1 K;  1XHX A;  3DLE A;  3FZH A;  4F3T A;  3HRG A;  1SKS A;  5FRO A;  3BUD A;  3FGU A;  2QEX N;  3THW B;  2EWS A;  4OKK A;  1YVN A;  3ZSZ A;  4FLT A;  1YJ9 N;  3NBP A;  3WXL A;  4JYA K;  2BH1 A;  1GLB G;  5C5B A;  3BP8 A;  4LH5 A;  5JVH L;  3OYF A;  3A5N C;  4DR6 K;  2XY5 A;  4HYB A;  3BUQ A;  4IFE A;  4XIU A;  4FK2 A;  4YOW A;  4DUY K;  5BN8 A;  1T6C A;  2W41 A;  3ZX2 A;  4DFP A;  2YKN A;  3ITH A;  3QIO A;  3PX6 A;  4DSK A;  3D2E B;  4WFA L;  4FJX A;  2QFF A;  2WUS A;  2O8F A;  4AM7 A;  1WSI A;  2ELB A;  3VEA A;  3BUP A;  2A42 A;  4IFY A;  3WUH A;  1TK0 A;  1NJI O;  4FJH A;  4UY8 O;  1RT1 A;  3C6H A;  2FBT A;  1K8K A;  2HF3 A;  3VOV A;  1KVA A;  4YOT A;  2OTJ N;  3QES A;  4OPJ A;  5T7B A;  3TSP A;  1QTM A;  3S5T A;  2HHI A;  4I6M B;  4JHD A;  4CHP A;  1R33 A;  4IM2 A;  2F7P A;  3IMX A;  5CR4 A;  3N8E A;  2KQ2 A;  2A1S A;  3O1B A;  4M7Y A;  4KI6 A;  1NGB A;  3KK2 A;  4FZO A;  4EZN A;  4JLC A;  1D5A A;  3I01 A;  3AA5 X;  4O5F A;  1SAZ A;  3SBT B;  1TL3 A;  4PKG A;  3K5L A;  2QKB A;  1HPZ A;  2Z1J A;  4Z94 A;  2IC3 A;  2ZJP L;  3OYA A;  1YJW N;  3VEB A;  4M3R A;  2QWL A;  1NK4 A;  3QML A;  1HNV A;  3ID8 A;  4RW4 A;  4CFB A;  3TTD A;  3VQ5 A;  5TKY A;  2BPR A;  4H0O A;  3SUQ A;  2G8W A;  2FBV A;  4MDA A;  4I9Q A;  2GV9 A;  1D4X A;  4CHZ A;  3H1V X;  4Y0W A;  3I55 N;  5GIO A;  4M3U A;  2ZWH A;  4CK2 A;  3AA4 A;  2P1J A;  5AZJ B;  1JLA A;  4PY5 A;  4H0V B;  1LAV A;  2BE2 A;  4FWP A;  4B3R K;  4KH4 A;  2HNZ A;  1Z6R A;  3D50 A;  5FPE A;  2GAF D;  3VTH A;  2OBM A;  4YDU A;  1JCG A;  1Z05 A;  3QIN A;  4AIL C;  3RR8 A;  5BPN A;  2JGU A;  2VG5 A;  4J2B A;  2HHS A;  4IM3 A;  3EYZ A;  3CAZ A;  4E1M A;  2HBJ A;  3ZYY X;  1JJ2 M;  1G99 A;  4CEF A;  3HAJ A;  4DFJ A;  4B3O A;  3HPG A;  2GWJ A;  5AZI B;  1FKP A;  4JI8 K;  3ZT0 A;  2Q97 A;  4AH9 A;  4EFH A;  3O9T A;  3V81 A;  3AVH A;  1U2V B;  4JRP A;  4H4M A;  4AZ5 A;  4DQ8 A;  1VSE A;  3ALY A;  4FJL A;  2CGK A;  1C0T A;  1MWK A;  4YFU A;  1JXB A;  3G4S N;  4EP4 A;  2VQE K;  3ZSX A;  4EZV A;  1GNL A;  3D52 A;  2E88 A;  4B9M A;  4E7I A;  4WPC A;  4DSJ A;  1S1W A;  4FM0 A;  2HBL A;  3CYM A;  2OP6 A;  1FXX A;  1DKG D;  5FDL A;  1YHQ N;  1RCH A;  1J54 A;  4N5S A;  3ID6 A;  5B8H A;  3GDQ A;  2CGJ A;  4JKD A;  1QZ5 A;  3WNF A;  4CJK A;  2OZS A;  3E9O A;  2QXF A;  3F9M A;  4JI5 K;  3M1F A;  3VQA A;  3AY9 A;  4H0Y B;  1NM1 A;  3SQ2 A;  4BGB A;  3ERC C;  3TR8 A;  3SV4 A;  3IKM A;  3QEX A;  2PZS A;  2UUB K;  1QE1 A;  3OBY A;  5M1Q A;  2E2N A;  3ZSV A;  5M1K A;  4DSL A;  5DMR A;  2P9U B;  3DXK B;  3R6M A;  4F4K A;  2G8I A;  4CGI A;  4C1N K;  1NGJ A;  3GBT A;  1EXQ A;  4CD1 A;  3QB0 A;  4MQ3 A;  3U4L A;  2YV0 X;  1BG3 A;  1S1T A;  3O4N A;  4H5W A;  3TPQ A;  1YF5 L;  4G9Z A;  3DPP A;  3ER9 B;  4DV6 K;  1CXQ A; 
#chains in the Genus database with same CATH homology
 3ENB A;  2ZJR L;  3T7Z A;  4B1X B;  4CBU A;  2ITM A;  5AQF A;  2FXU A;  3W3D A;  3T47 A;  2NRH A;  1OKJ A;  2W00 A;  1W2B M;  5AQV A;  2QWP A;  2GX9 A;  3EKU A;  4MDB A;  3CC7 N;  3ENH A;  3BUZ B;  3MN6 A;  4IM0 A;  1RDW X;  3C6A A;  3QFP A;  4BC3 A;  2NNW A;  2NZT A;  4U67 L;  2ZGY A;  4DKW A;  2I7P A;  1TUU A;  5FIG A;  2WBN A;  2GTD A;  4A5A A;  3A0I X;  4NLB A;  3M5R A;  4PKH A;  2YHW A;  2KHO A;  3KK7 A;  2YJF A;  4R5K A;  1NWK A;  1SS6 A;  5AQJ A;  1E2U A;  4O8U A;  2E20 A;  1CZA N;  1YI2 N;  2F9T A;  3EO3 A;  2Z8Y A;  3T49 A;  2KKZ A;  3RSE B;  4BY9 C;  1GLJ O;  1XQS C;  1S3X A;  3C7N B;  2HOE A;  5AQR A;  4CZI A;  4JWI A;  2P9K A;  4IW0 A;  2V51 B;  3LDO A;  4YOU A;  3VEX A;  2H3G X;  2A40 A;  3CCU N;  2YHX A;  2YI1 A;  3CQY A;  3P39 A;  3SAG A;  2BUP A;  1ILY A;  1Q7Y O;  2UYT A;  2Q2R A;  2QW9 A;  1KAX A;  4BRN A;  5C2D A;  3RV1 A;  1SQK A;  2A5X A;  3DJC A;  2RHK A;  1KD1 O;  1BPR A;  1DGK N;  3B53 X;  3I8B A;  4NPH A;  3A8Y A;  3KZB A;  4GV3 A;  3EE9 A;  3ZED A;  1VAZ A;  3T4A G;  3N4Q A;  5EOY A;  5AFU H;  4D8J A;  5BN9 A;  1LOT B;  3O3N B;  1NGG A;  1JCE A;  4FWN A;  5MLC Q;  5F0X A;  2D4W A;  3ZX0 A;  3H3N O;  5AQK A;  5JMV A;  4WFN L;  4DHY A;  3ENO A;  2NLX A;  3JXU A;  4WQ4 C;  3T69 A;  2ND1 A;  3ER8 C;  4R5G A;  5C15 A;  3VES A;  1U00 A;  4EZR A;  5JIC A;  2VGM A;  5BRH A;  2GEM A;  3G71 N;  3CER A;  3P31 A;  1EQY A;  5AQI A;  1NGI A;  4XJX A;  5M1P A;  3E66 A;  4IO9 L;  4IWO A;  4JKH A;  3ZX3 A;  2BTF A;  3QFU A;  1DEJ A;  1V4S A;  4BVP A;  1MWM A;  2ZGZ A;  3CCS N;  4H0T B;  3M3Z A;  1WOQ A;  4B1W B;  3MX5 A;  1WUA A;  3LM9 A;  5AQL A;  3ULE B;  4YOY A;  5C0Y A;  1JCF A;  4MLE A;  4OPH A;  3VF6 A;  4BRD A;  3CCV N;  2E8A A;  1VQK N;  1HPM A;  4EZX A;  3SAF A;  2A3Z A;  4HWI A;  4IXC A;  2QWR A;  1VQN N;  3HBT A;  4E3C A;  2P9I A;  5AR0 A;  4JNF A;  4HTL A;  2OAN A;  3QIC A;  2F9W A;  2FLO A;  4U7B A;  3ZEF A;  1W9M A;  2VGN A;  2E1Y A;  3MK6 A;  1K9M O;  3VGL A;  5EXW A;  2NRX A;  2Q31 A;  3B8A X;  4M7X A;  1CKR A;  4JKC A;  3UKR B;  4IWQ A;  4JWD A;  3OBW A;  3E9L A;  4BR0 A;  3DWL A;  3FLC O;  4K41 A;  5KPT A;  1K73 O;  3HOT A;  4BRL A;  3ZET B;  4PL7 A;  4ILI A;  4HY9 A;  4WV5 A;  1E4F T;  4JD2 A;  1Q18 A;  2ZF5 O;  3EKS A;  3VF2 A;  2PAV A;  2QWQ A;  1BO5 O;  1NGC A;  3AAP A;  3DXM A;  3JS6 A;  3Q7C A;  3CC2 N;  2QM1 A;  2DPN A;  1NGF A;  2Q36 A;  3I33 A;  2NRR A;  1M1K O;  2IVO A;  4JKA A;  4A2A A;  3LDP A;  3O9U A;  3AAQ A;  1C0F A;  4WQ5 C;  5AQZ A;  3F7W A;  3WXK A;  4H5V A;  3WEE A;  4E1J A;  1KC8 O;  4QS9 A;  1E1D A;  3EE8 A;  1QHA A;  4FOI A;  1VQ9 N;  2QWO A;  4EZP A;  4EZW A;  4BR5 A;  4BEB A;  5JLH A;  5EVZ A;  3WT0 A;  2HF4 A;  3UKU A;  1TYQ B;  4JK8 A;  1YJN N;  4CZE A;  1KAZ A;  1P90 A;  4DB3 A;  3CF5 L;  4BC5 A;  5AFU A;  4FWR A;  2P9P B;  4F01 A;  3I04 A;  5BRD A;  4ISG A;  4JKG B;  4CI6 A;  4FSV A;  3CCM N;  5JVG L;  5DM6 L;  4B1V A;  3AAR A;  5GIP A;  3ATU A;  1RGI A;  4NLC A;  3VTI A;  3RVC A;  3CME N;  3VKH A;  1GLD G;  2ASP A;  4EZZ A;  3WQU A;  4BRK A;  4UDY X;  1XUP O;  4A61 A;  1SU6 A;  1KXP A;  4JWC A;  3FFK B;  2P9P A;  1MJG A;  3GE1 A;  3O80 A;  3WXI A;  4BG8 A;  5C10 A;  4A5B A;  4F00 A;  4FWL A;  3D2E A;  4BRC A;  4CZJ A;  1DKY A;  3EN9 A;  4H5N A;  4K43 A;  3L4Q A;  3R9P A;  2KLA A;  1U6Z A;  4IWV A;  1E4G T;  1YAG A;  2HST A;  5AQP A;  2A6A A;  4PL8 A;  1HUX A;  5GAG P;  3FD9 A;  3VEV A;  4F9O A;  5AQW A;  1E9V A;  3GOI A;  3C0B A;  4BE7 B;  4H6H A;  1KAY A;  3LL3 A;  5KPR A;  2QI2 A;  4RWT A;  2D0O A;  2PY6 A;  4FM3 A;  3A98 A;  4FWO A;  2YCH A;  4O8K A;  3VEZ A;  4DCH A;  4FO0 A;  5AQM A;  3VET A;  3J7Z O;  2D1K A;  4WQ4 A;  2P9K B;  4M63 C;  1K8A O;  1EO1 A;  3N4P A;  4B9Q A;  1C0G A;  4IJN A;  1YXQ A;  4B1Z A;  1VQM N;  3DPQ A;  4H6I A;  4MO4 A;  3H3O B;  1MA9 B;  1SZ2 A;  4WYB A;  4KBO A;  5B8H A;  1BA0 A;  5M1F A;  4ILH A;  5AQN A;  1NGH A;  1ATS A;  5C2F A;  1M90 O;  4I6M A;  3CIP A;  3SBS A;  4C1N I;  3M6G A;  4JN4 A;  2YIB A;  2PBD A;  1LCU A;  3H0X A;  5AQQ A;  4K42 A;  3P38 A;  4WCE L;  3OHR A;  2JNS A;  3BF1 A;  4RTF D;  2C1I A;  3LM2 A;  3O8M A;  4IOX A;  2D0P A;  3CCE N;  2NRW A;  1ZYL A;  3KHY A;  3MN5 A;  3QDK A;  3FZM A;  1NGD A;  3UIT A;  2E2Q A;  2YHY A;  3I56 N;  3B51 X;  3O3M B;  1QQM A;  3O9S A;  2Q0R A;  2V7Z A;  3TTF A;  3U4L A;  1VQ6 N;  5AQU A;  3HI0 A;  3UE5 A;  5C12 A;  4HR1 A;  4BC4 A;  1H1V A;  3CPE A;  3SBT A;  2QWM A;  5F2R A;  3HM8 A;  3E9P A;  4OPA A;  5E84 A;  3EZW A;  4EHT A;  4FPA A;  4GY2 B;  3CJ7 A;  3A5O C;  3CCQ N;  4A2B A;  5ADX H;  4FL9 A;  2ASM A;  3HZ6 A;  3WXM B;  5GAE P;  3CC4 N;  3MWT A;  3O5B A;  3CJ1 A;  5KPZ A;  3SJH A;  3MDQ A;  4CBW A;  5LJV A;  2ASO A;  1OA0 A;  3KDR A;  3VER A;  3UB5 A;  3O4W A;  3VPZ A;  3DQG A;  3D7E O;  3CCJ N;  4CZL A;  4BR9 A;  2CH5 A;  3MWP A;  4WQ5 A;  4BRA A;  3SAH A;  2P9I B;  3W0L A;  1T6D A;  3ZEU A;  2OBL A;  2WIN M;  4CZM A;  2E2O A;  4EZU A;  3HOS A;  2N3K A;  3QNJ A;  3T48 A;  2E1Z A;  2AA4 A;  2I7N A;  3VGK A;  3TSU A;  3VEW A;  3F5T A;  4YOV A;  5BR9 A;  3VF4 A;  3IUC A;  3K9J A;  4BRI A;  4R79 A;  4IJA A;  3KAW A;  3TSQ A;  4EZY A;  1VQO N;  1ATR A;  3U9Z A;  4FOE A;  4BG9 A;  5CE3 A;  3PIO L;  1YUW A;  4JD2 B;  2YI9 A;  3DXM B;  1OAO A;  3FZH A;  3HSC A;  3HRG A;  1T44 A;  4KH5 A;  5LJW A;  4XH1 A;  3FGU A;  4BRO A;  2QEX N;  2E2P A;  4WV7 A;  1IJJ A;  1RFQ A;  2EWS A;  5AQY A;  4BVO A;  1YVN A;  5BPL A;  2YIA A;  1Q5L A;  1BDG A;  3H1Q A;  1Q86 O;  3WEE B;  2P9N B;  1VQ7 N;  3DPO A;  3I39 X;  1YJ9 N;  5AQS A;  4RCH A;  1SU7 A;  2JWK A;  3SMS A;  3WXL A;  4EHU A;  3QBW A;  2BH1 A;  1GLB G;  3K9K A;  4GV6 A;  3BP8 A;  1ZXO A;  3GL1 A;  3RV0 A;  4FPB A;  3VEN A;  4JKB A;  3SLC A;  3UKU B;  4PKI A;  4YOX A;  5E26 A;  3G6E N;  3S41 A;  3SBG A;  3TU5 A;  5JVH L;  4BGA A;  2P9N A;  3D2F A;  3A5N C;  2JWL A;  4AF1 A;  3L6Q A;  2P9L B;  5KQ8 A;  2FSK A;  1YIJ N;  2EWF A;  4HYB A;  3CD6 N;  4ILG A;  2WFB A;  4IFE A;  4H0X B;  3HTV A;  4KIK B;  4IZ9 A;  5EY4 A;  1HKB A;  4YDU C;  2QWN A;  2HBK A;  4YOR A;  1X3M A;  4YOW A;  5BN8 A;  1O13 A;  1T6C A;  2W41 A;  3ZX2 A;  2P9L A;  3ATV A;  7HSC A;  4XH5 A;  2IIR A;  3D2E B;  3FZF A;  2GUP A;  3H6E A;  4WFA L;  1HLU A;  2QFF A;  1ZBS A;  2WUS A;  5I9E B;  4AM7 A;  4KIK A;  1GLL O;  2VYP A;  4BRG A;  4GNI A;  3VEO A;  1Q81 O;  3IDH A;  1GLC G;  4JEP A;  4A62 A;  2LM0 A;  5BPM A;  2QA4 N;  2NRV A;  3VEA A;  1BU6 O;  4BQZ A;  2NRT A;  5ADX A;  2A42 A;  3LMF A;  4G6Q A;  2RT6 A;  3WUH A;  1NJI O;  2NCZ A;  4IDH A;  4UY8 O;  1VQL N;  4E81 A;  3C6H A;  3R1X A;  3WQT A;  3CCL N;  1K8K A;  2HF3 A;  1HKG A;  4R5L A;  3VOV A;  4LC9 B;  1W97 L;  3MMV A;  2PFU A;  1BA1 A;  4R5J A;  1NLV A;  2YJE A;  4YOT A;  1GLE G;  4JKF A;  4BC2 A;  1OVY A;  2OTJ N;  3CQX A;  3KWG A;  3O08 A;  3WXJ A;  1DG4 A;  3CCR N;  4AM6 A;  3A5M C;  1V4T A;  3R3L A;  3NMU A;  3TSP A;  4EIA A;  4ILH B;  1SU8 A;  3QA8 A;  5JLF A;  1Q82 O;  4I6M B;  2Q1N A;  4JHD A;  5M1N A;  4IM2 A;  1S22 A;  3IMX A;  5CR4 A;  2P9U A;  3DXK A;  3VEY A;  3N8E A;  4M7Y A;  3O1B A;  3O3O B;  3A5L C;  1NGB A;  2YI8 A;  4CBX A;  1GN9 A;  1HKC A;  3MN9 A;  3CJ9 A;  3CET A;  4EZN A;  4EAH D;  4JLC A;  2CGL A;  2P9S A;  2VCP A;  5AQO A;  3I01 A;  1GLF O;  3KAV A;  4JAX A;  5LY3 A;  4I43 A;  3LDN A;  4BR4 A;  4O5F A;  1NGA A;  3SK3 A;  1SAZ A;  4HR1 B;  3SBT B;  4ISE A;  4PKG A;  4CD3 A;  4PO2 A;  3L4I A;  2RE2 A;  4QS8 A;  4Z94 A;  2ZJP L;  2EX3 B;  2J4R A;  4KH6 A;  1X9J A;  5TKW A;  1YJW N;  1QQO A;  3VEB A;  2QWL A;  3QML A;  5AQX A;  3R8E A;  2FSN A;  3ID8 A;  4BRE A;  3CJC A;  1NBW A;  3TTD A;  1IG8 A;  3AGK A;  1QZ6 A;  3GI7 A;  5TKY A;  4IO8 A;  2BPR A;  3F2K A;  4H0O A;  4CJ7 A;  5BRE A;  3G25 A;  4IOC L;  4JWE A;  1P8Z A;  4BRP A;  4H5T A;  4MDA A;  3T46 A;  3Q7B A;  4MO5 A;  4MLH A;  5H1S Q;  1QVG M;  2HBM A;  1D4X A;  3OHX M;  3U9D A;  3ZEU B;  3KWI A;  3H1V X;  3RSE A;  5HOO A;  4R5I A;  3QBX A;  3C7N A;  2GWK A;  3O9Q A;  5FPD A;  1XC3 A;  1T3V A;  4NO7 A;  4Y0W A;  2NRZ A;  4CZH A;  3I55 N;  5AQT A;  3PLA A;  2X5C A;  2FF6 A;  5GIO A;  2ZWH A;  2C1G A;  1NGE A;  5AZJ B;  1VQ4 N;  3C65 A;  3MN7 A;  3U8X A;  4H0V B;  2VWB A;  2HMP A;  2F7T A;  4FWP A;  4KH4 A;  3DOB A;  3L3O M;  3MCA B;  4BRQ A;  4ISF A;  3DLL L;  1Z6R A;  1KQS M;  3NVK A;  3GG4 A;  2YIV X;  2GAF D;  4A59 A;  5FPE A;  2QTD A;  3VTH A;  2OBM A;  5AZJ A;  4YDU A;  1JCG A;  1Z05 A;  3OA9 A;  4WF9 L;  4BRM A;  5BPN A;  3D6R A;  1UPX A;  4XH4 A;  4B1Y B;  4JK9 A;  4BRH A;  3O9R A;  4IM3 A;  1TUY A;  4BR2 A;  5CHI A;  5GIN A;  2FSJ A;  1HX1 A;  3NVM A;  4K25 A;  1J6Z A;  3LDQ A;  3VGM A;  4H5R A;  4JL9 A;  5FPM A;  1JQK A;  2HBJ A;  3BEX A;  5F1X A;  3EL2 A;  3ZYY X;  2A41 A;  5ELZ A;  3FE1 A;  2ND0 A;  1SUF A;  1JJ2 M;  1G99 A;  2Q0U A;  3CXC M;  3D2F B;  2GWJ A;  5AZI B;  4C23 A;  2Q97 A;  4OO1 J;  1RDU A;  2GA9 D;  4NB4 A;  4EFH A;  1X3N A;  1QQN A;  4IEI A;  3KVG A;  3O9T A;  3PIP L;  4GV9 A;  3FZL A;  4ILG B;  1U2V B;  1Y64 A;  4PHT X;  4H03 B;  3TTC A;  5BRF A;  2AP1 A;  4GVE A;  1ESV A;  4IEE A;  1QVF M;  4BR7 A;  4IWP A;  4DQ8 A;  3CMA N;  4H0P A;  4B1U B;  3ULE A;  4QS7 A;  5AZI A;  2FF3 B;  2CGK A;  1ATN A;  3LDL A;  4UDX X;  1MWK A;  3G4S N;  1VQP N;  2CH6 A;  3CPW M;  3B52 X;  5DM7 L;  2V7Y A;  5HL7 L;  1BUP A;  1U2V A;  4EZV A;  4MQD A;  3J8A A;  4CZK A;  1GNL A;  3CI5 A;  1GNT A;  2E88 A;  4EZS A;  3H46 O;  3CJA A;  4BEC A;  4XEI A;  2HBL A;  3MCP A;  1DT9 A;  5EX5 A;  4JK7 A;  1N8R O;  2OP6 A;  4L3Q A;  1DKG D;  4J8F A;  1YHQ N;  3UKR A;  2IVN A;  5GAH P;  3CJB A;  3ID6 A;  3O1W A;  4M0M A;  1DKZ A;  1K8K B;  3GDQ A;  2CGJ A;  4JKD A;  1QZ5 A;  5AQG A;  5FPN A;  4BRF A;  3E9O A;  4CZF A;  1DKX A;  3F9M A;  2IVP A;  3O6W A;  3ZET A;  2GEL A;  3M1F A;  3AY9 A;  3H45 C;  4H0Y B;  5AQH A;  1NM1 A;  5KQD A;  1NMD A;  1VQ8 N;  4BGB A;  3ERC C;  3L0Q A;  4WFB L;  3VMF B;  4FVU A;  2ZJQ L;  4FWK A;  1YIT N;  3IKM A;  1S72 N;  4FWS A;  3FZK A;  1GLA G;  2YX6 A;  5GAD P;  2OTL N;  3OBY A;  5M1Q A;  3P4I A;  2E2N A;  4JHD B;  4CZG A;  4A57 A;  5M1K A;  1VQ5 N;  4IOA L;  3E1Y A;  2P9U B;  3DXK B;  3R6M A;  2WC9 A;  1ZC6 A;  2V52 B;  4FWQ A;  5M1O A;  1OA1 A;  3IFR A;  4BQL A;  2W40 A;  4C1N K;  1NGJ A;  1BWF O;  3BF3 A;  4ILJ A;  3GBT A;  4JNE A;  1TYQ A;  1MDU B;  5FLE X;  3AGR A;  4JKE A;  4CD1 A;  2QXL A;  3OWG A;  3CHW A;  3QB0 A;  4EZQ A;  2P9S B;  3MX2 A;  1BOT O;  1BG3 A;  4H5W A;  4EZT A;  3SMP A;  1YF5 L;  4EZO A;  3DAW A;  3TPQ A;  4FWM A;  3DPP A;  3OW2 M;  4G9Z A;  1HJO A;  1R59 O;  3ER9 B;  3FR0 A;  4JKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...