4JNEA

Allosteric opening of the polypeptide-binding site when an hsp70 binds atp
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
600
structure length
600
Chain Sequence
SGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Hsp70 CHAPERONE DnaK
publication title Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP.
pubmed doi rcsb
source organism Escherichia coli
total genus 192
structure length 600
sequence length 600
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00012 HSP70 Hsp70 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jneA05
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jneA04
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jneA01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jneA03
2GEMA 1GLBG 7HSCA 3FGUA 4A2BA 2IVNA 1BA0A 3VEOA 1YAGA 3QBWA 4JD2A 5BPMA 3GL1A 2E2PA 2E1ZA 2QWMA 1ZBSA 2FSKA 3BF1A 4AM6A 2E2NA 4FWSA 1BWFO 2NLXA 4FWKA 3EO3A 1J6ZA 3HZ6A 3QFUA 5AQWA 3VGLA 3LDOA 1DKXA 1EQYA 2YCHA 3U9ZA 4B1YB 4K43A 2QWLA 5AQGA 3C7NB 1T44A 3DXMB 2FSJA 2A41A 2FF6A 2QWRA 4XH4A 4HYBA 4AM7A 4CBXA 4EZRA 3R8EA 3M6GA 2AA4A 4R5JA 4WQ4A 5KQ8A 1BPRA 4JAXA 4M7XA 4BRPA 4F9OA 3A5MC 3A0IX 4JHDA 1HKCA 3CHWA 4CZEA 3KZBA 5EVZA 2PAVA 1DEJA 3WQTA 3VF2A 3D2EB 1G99A 4H0TB 4M63C 1QZ6A 4CZLA 1YVNA 3GOIA 3H6EA 3SJHA 3VF4A 1U00A 1GLCG 3IFRA 3ZETA 3WUHA 4JD2B 5LY3A 4BG8A 2GTDA 3VESA 4CBUA 3WXJA 1KXPA 4JWIA 4H5RA 2P9KA 2IVPA 2WINM 1GLLO 1NGAA 4FL9A 1BG3A 4HWIA 4H0XB 4EFHA 3F9MA 3BP8A 1CZAN 4IXCA 2V7YA 5JLHA 3DAWA 2P9NA 2HF4A 3FLCO 1E4FT 2VCPA 3MN6A 3A8YA 1V4SA 2Q2RA 4A62A 4E81A 3GG4A 4EZVA 1MWKA 4BR4A 1T6DA 2D0PA 4BGBA 2UYTA 2WUSA 4MLEA 4EZSA 5AQUA 1BA1A 2ASOA 4BC3A 1NM1A 4F00A 3VPZA 4R5GA 3BF3A 3FR0A 4XH1A 4H6IA 2GUPA 3H3OB 3CQXA 2QW9A 4BGAA 1BUPA 5AQXA 2F9TA 3O1BA 4WV5A 3ZETB 4CZHA 5KQDA 4E1JA 4BRIA 3G25A 4WQ4C 2BPRA 4PO2A 2GWJA 1DG4A 4FSVA 4BRAA 5F2RA 3H1VX 1P8ZA 3N8EA 1BO5O 3KVGA 5AFUH 3MN5A 5AZJA 3TU5A 3UB5A 4BRNA 1NGCA 2VYPA 3SMSA 3LDPA 2P9NB 4L3QA 2A5XA 1NGEA 1YXQA 3CQYA 3WXKA 4B1WB 4CJ7A 4NB4A 3U9DA 3L6QA 4ISFA 1JCGA 5JLFA 4EAHD 3OHXM 4EHTA 3T49A 3O80A 4ISEA 4DCHA 3GDQA 1NGJA 2E1YA 3QBXA 4FWPA 1T6CA 4RCHA 4WYBA 4FWOA 4EZQA 1SQKA 1K8KB 3RSEA 3H3NO 3WEEA 1Q18A 3J8AA 3O5BA 3O08A 4BQLA 5BN9A 3DJCA 4R5KA 2E20A 3EKSA 4FPAA 3O4WA 3WQUA 3GBTA 4XH5A 1GLAG 4K42A 4BC2A 3HI0A 4IWVA 2BUPA 4Y0WA 3VEYA 3FFKB 1YUWA 2P9SA 4BVPA 3T46A 1NMDA 1MA9B 3I8BA 3FZHA 1TUUA 5ADXA 4DB3A 2V7ZA 4CZJA 3CERA 1BDGA 3OHRA 3VEVA 4EZTA 4A2AA 4H0VB 3UE5A 3C0BA 2Q0UA 3D2FA 1XC3A 4B9QA 1BOTO 3JS6A 4FWMA 1BU6O 2W41A 3ZEUB 3L3OM 4BRLA 4BR2A 3CETA 3JXUA 4CBWA 4GY2B 3WT0A 4CZMA 4H0OA 4PKGA 3RSEB 4H5NA 3WEEB 5BN8A 3ID8A 3A5LC 4BQZA 1GLFO 1DKZA 2ASPA 4B1UB 5I9EB 3FZKA 3S41A 1DKGD 2YHWA 4EZOA 3WXIA 2D0OA 2QWQA 3MDQA 3D7EO 1NLVA 3DXKA 2NRHA 3LDNA 1R59O 2P9PA 3DWLA 5AQOA 2FLOA 1NGDA 3CJAA 4XEIA 4CD1A 4FWQA 5EX5A 4ISGA 3O6WA 4IJAA 2Q36A 4WQ5A 3MK6A 4PL7A 5TKYA 4QS7A 2ZWHA 2FF3B 4H5VA 3VF6A 3ULEA 4BRQA 4EZPA 1D4XA 1U6ZA 5AQFA 2J4RA 2Q97A 3HSCA 4KBOA 1ATNA 1E4GT 4FOIA 3CI5A 3TPQA 3O1WA 2H3GX 5AQQA 4EIAA 3A5OC 4CZIA 1Y64A 4JHDB 3KHYA 1SZ2A 4IZ9A 3ENHA 3DXKB 4BC5A 3WXLA 3CJ7A 2I7PA 4MLHA 4H5TA 4I6MA 2A42A 2ZF5O 1RFQA 1WUAA 1XUPO 4YDUA 1ATRA 2QM1A 5AZIA 5AQZA 2D4WA 2P9KB 2OP6A 4NO7A 3VGKA 3DPOA 2A40A 3FZFA 4BR0A 5B8HA 1C0FA 4QS8A 1C0GA 5AR0A 5AQJA 5EY4A 3ULEB 4BRGA 2YI1A 1TYQA 2ASMA 2CH5A 3R9PA 3VGMA 2I7NA 3CJCA 2P9IA 3EKUA 2P9LA 4R5IA 4C23A 3MCPA 3ATVA 3HBTA 1TUYA 3IDHA 1ZC6A 5AQNA 1IG8A 4BRDA 3O8MA 2A6AA 4IJNA 4EZYA 3CJBA 5AQMA 4MO5A 5AQPA 2DPNA 3IUCA 2QFFA 3AY9A 3MN7A 4WQ5C 5AQIA 3ZX3A 1GLDG 1MDUB 1IJJA 3LDLA 1H1VA 3M1FA 3CJ1A 5JMVA 3P4IA 4CI6A 3VENA 4O8KA 2E2OA 2E8AA 3U4LA 1S3XA 4RWTA 4QS9A 3UKRA 4EZXA 4J8FA 1LCUA 5AZIB 3DXMA 1V4TA 4PKHA 4BC4A 5BPLA 4CD3A 1OKJA 3MMVA 4FWRA 4Z94A 4JN4A 3FZMA 1NGGA 4K41A 1TYQB 5AZJB 3ZX0A 4BRMA 2F9WA 3UKUA 2YJFA 4BRCA 1X3NA 2ZGYA 5ADXH 4K25A 2P9IB 3T48A 1QQNA 3LL3A 1NGBA 2QXLA 5EXWA 4A61A 1HUXA 3AAQA 5EOYA 3VEWA 5KPZA 2KHOA 5AQYA 4BG9A 3CIPA 3ENOA 1NGIA 5KPTA 5AQKA 4BROA 3D2EA 1ZXOA 2D1KA 5ELZA 4B1XB 4RTFD 3QICA 4CZKA 3AARA 5BRFA 4H0YB 3BUZB 4JNEA 4FPBA 1JCEA 3HM8A 5AQRA 4JWCA 3SMPA 3VEXA 3GE1A 4WV7A 5E84A 2E2QA 3SLCA 5AQTA 4LC9B 1QHAA 1X9JA 3UKRB 5BPNA 1Z6RA 2AP1A 1DKYA 5FPDA 2P9SB 1KAYA 4H0PA 3FZLA 5LJVA 4BVOA 3BEXA 3DPPA 3EL2A 3LDQA 5E26A 2CGKA 4EZZA 5AQSA 4CZGA 4O5FA 3UKUB 1S22A 4EHUA 3M3ZA 3QMLA 1NBWA 4BRHA 4F01A 3D2FB 1JCFA 3U8XA 5FPEA 3QB0A 5AQHA 4JWEA 1RDWX 3EN9A 3LM9A 4FOEA 3QDKA 2Q1NA 3H46O 1NGFA 2ITMA 4EZWA 2P9UA 2V51B 1SAZA 2GELA 1HPMA 3R6MA 1CKRA 5BRDA 5BRHA 5F1XA 3DPQA 3LM2A 2E88A 4BR9A 2GWKA 3AAPA 1Q5LA 3DQGA 1DGKN 2V52B 1QQMA 1NGHA 4HTLA 4BR5A 2EWSA 1HLUA 2P9PB 3H1QA 4CZFA 1KAZA 3ZX2A 1WOQA 4B1VA 3QNJA 3H45C 4BRFA 2NZTA 2CH6A 4DQ8A 3I33A 5FPMA 3FE1A 4GNIA 4H5WA 3DOBA 3VETA 3QFPA 2YHXA 3VOVA 4JNFA 1XQSC 1GLEG 1QQOA 4B1ZA 4M7YA 4JWDA 2YHYA 4FWLA 5F0XA 3H0XA 1LOTB 2QWOA 2QWNA 2FXUA 3T47A 1K8KA 3MN9A 3W0LA 1U2VA 2Q31A 4BRKA 5AQVA 5CE3A 3ATUA 4HY9A 1RGIA 2P9UB 1MWMA 5AQLA 2FSNA 1NWKA 4DHYA 3L0QA 2HMPA 1Z05A 4PKIA 5AFUA 2BTFA 4MO4A 1ATSA 1QZ5A 2QWPA 4R5LA 3T4AG 2ZGZA 2OANA 3HTVA 2YJEA 3IMXA 5KPRA 4EZNA 3L4IA 2A3ZA 2Q0RA 2HF3A 4FWNA 3W3DA 2CGLA 5BR9A 1HKGA 4I6MB 2VWBA 2IIRA 2IVOA 2W40A 4H6HA 3B8AX 4PL8A 1HKBA 3SK3A 4IO8A 1KAXA 3C7NA 1HJOA 3ZEUA 2PBDA 1ESVA 3A5NC 5BREA 5LJWA 5FPNA 3VERA 5JICA 4BREA 3VEZA 1U2VB 3CJ9A 2P9LB 1HX1A 3EZWA 4FO0A 2CGJA 2HOEA 1X3MA 4H03B 4BR7A 4YDUC 1GLJO 4EZUA
chains in the Genus database with same CATH superfamily
5CR4A 4M3RA 4A2BA 4YOYA 3VEOA 2WFBA 2A1RA 3DYTA 3QBWA 2F1BA 2UUCK 4IFVA 1RBVA 3KD1E 1ZBSA 3KKSA 1Q8IA 3EO3A 2MI7A 1DKXA 4K43A 3DM2A 3I8DA 3C7NB 1T44A 4LF4K 2Z1JA 1S1TA 2FF6A 2QWRA 4LY7A 4CJPA 4QAGA 4AM7A 4HYBA 4JYAK 4OKKA 4YOWA 5KRSA 4AZGA 4JI2K 2IOCA 3HAIA 4YOVA 4JAXA 4M7XA 4F9OA 4OX9K 3BGRA 1HNVA 1K9MO 3A0IX 1QWUA 1VSHA 4UQGA 4CZEA 3MEDA 3KAWA 4CF0A 1A5WA 1DTQA 4CJ4A 1R5EA 3VQQA 4AILC 3CKDA 3S3NA 4HVJA 4WPEA 4M63C 1QZ6A 4CZLA 3SJHA 3VF4A 3ZSQA 4LFCK 5I42A 3ZETA 1RBRA 4JD2B 5DK5A 3V9WA 1C1CA 4NLCA 2GTDA 3NVMA 4JWIA 2P9KA 1HYVA 3SAFA 5KGWA 1REVA 4FL9A 5HRNA 1JXEA 1OA1A 1JLFA 1CZAN 1QSSA 1N36K 4I9QA 5JLHA 1JJ2M 3O3MB 2YNFA 2Y1IA 1XHZA 3B52X 2KZMA 4CEQA 3MN6A 4FLUA 4A62A 4E81A 3QA8A 1E9VA 3G10A 4R5PA 1D5AA 4PUOA 2O8BA 4EZSA 5AQUA 5FRMA 1JLBA 2ASOA 3THYA 1RILA 4R5GA 2HBKA 3U6FA 1HQEA 1QQCA 2UXDK 1WSFA 3LWLA 3CQXA 2QW9A 2XO7A 4ZTFA 2F9TA 4DV3K 4DTSA 4WFNL 1M1KO 3KLEA 1XNQK 4BRIA 3Q7BA 3WNGA 2ZJRL 3AO5A 1S6QA 4JI3K 1VQ9N 3R3LA 3NGIA 1WSEA 1P8ZA 4OJRA 4RW8A 1BO5O 2B4JA 5AFUH 4FLWA 2IAJA 1YVUA 5AZJA 4O8UA 4BRNA 4DS4A 3SMSA 4CHPA 4ATMA 3L2WA 1JLCA 3CQYA 4HUEA 4CJ7A 4AH9A 4CHQA 2UXBK 2FBXA 2RE2A 5SZTA 4O0IA 2F8SA 4NCAA 1VK0A 1FXXA 3T49A 4ISEA 3SCXA 4FLYA 4JL9A 4B9SA 1NGJA 2FBVA 4JI6K 3NHGA 1I49A 4WYBA 1K8KB 3RSEA 3WEEA 1WSHA 4B3SK 4N47A 2G8IA 4IG0A 4D8JA 1JLEA 1MU2A 3DJCA 4FJ7A 3GBTA 4K42A 5JVHL 3QEPA 4YY3K 4Y0WA 3V1QA 2HNZA 3FFKB 4E72A 1NMDA 4BACA 3I8BA 4FJIA 3FZHA 1JXBA 5ADXA 4CGHA 1IKYA 3R1XA 3CERA 5CY4A 1OAOA 4I2PA 3O4QA 3OK8A 4CCHA 3O3OB 2WYHA 3O9QA 2W6KA 1XC3A 2W6LA 4B9QA 2O4IA 2KFNA 4JKBA 2Z1HA 3KAVA 1BHLA 3ZEUB 3LPTA 4BR2A 3CETA 4CBWA 3GI7A 1RT6A 4CZMA 3G9GA 2IGIA 3MXMA 1FKOA 4M3WA 5C25A 4FZYA 1QVFM 5J2QA 3S41A 3LZJA 4EP5A 2PYLA 3MDQA 3DXKA 2LXYA 3P83D 2I5JA 1S1VA 5AQOA 4FCYA 2QI2A 4A57A 3AO2A 4IDKA 4CD1A 4FWQA 5EX5A 2QXFA 4R79A 1RDAA 2Q36A 1VQ6N 1JLGA 4OKEA 4PL7A 1TGOA 3ZYYX 4JV5K 2Y1JA 2G8WA 2WC9A 3ER8C 4IBNA 2JLEA 3HAHA 3ULEA 1D4XA 4CEOA 2J4RA 3O9SA 1JQKA 3ERCC 4DF8A 2PMRA 3L2UA 3LPUA 3RR8A 5AQQA 4B9VA 4DKWA 5M1QA 3OBWA 3PV8A 4DV0K 2NRRA 3KHYA 4W5TA 3NH1A 1HNXK 3ENHA 3E9OA 4OPJA 3U3GA 2JNSA 4KO0A 3Q84A 4H5TA 2WYIA 2ZF5O 1XUPO 1ATRA 2P9KB 4FM0A 1UOCA 1UPXA 5B8HA 4QS8A 5AR0A 5AQJA 4CECA 3DDFA 4TSXA 3M8PA 1XWLA 2CH5A 5BR8K 3R9PA 4DTRA 2YHBA 1WSIA 3EKUA 2PZSA 4IO9L 3ATVA 3WXMB 2RAKA 4FJMA 3T1YK 4QCLA 3O8MA 2A6AA 2HSTA 4CJQA 4MO5A 4DWIA 3D4ZA 4G1QA 1F21A 3RMAA 4CGIA 4ZHRA 3SBTA 1EKEA 3CJ1A 4AHSA 4V19S 2XRIA 3DOKA 2ND1A 1N32K 4LF8K 2IS3A 4CESA 2ND0A 4O4GA 3AVKA 1EWRA 3KLIA 4DTPA 2XHBA 2HNDA 5KI6A 3UKRA 5J2NA 1LCUA 5AZIB 3NFAA 1W0HA 2ELBA 4PKHA 3RV0A 5HROA 3MMVA 1NGGA 3PX0A 4FZXC 4DQQA 2NCZA 4K41A 1TYQB 5AZJB 1OH8A 4IM2A 2UUAK 3OYMA 4FJXA 2ZGYA 3KWIA 4CK2A 3ALYA 1Y2OA 1HYZA 1Z26A 1NGBA 4Z4HA 4DLGA 5EOYA 4KREA 2KHOA 3DX2A 4KH4A 4ILGA 4DTXA 3D2EA 1ZXOA 5ELZA 1S1XA 2ZJQL 3AO4A 5BRFA 1QE1A 2WBNA 3D52A 1L3VA 4KTWA 2G8HA 4KHWA 3HM8A 4BEBA 1VSMA 3OYEA 2FBYA 3BY5A 2NNWA 1FJGK 4BECA 3CFPA 5AQTA 4LC9B 1YJ9N 1NK8A 5BPNA 1VQ5N 2F7OA 3RPMA 1TAUA 5GAEP 4O55A 3K5MA 4BVOA 1LW0A 4JK7A 3C6TA 3SV3A 4NQIA 4JS4A 1D9DA 1NK4A 2YI8A 3QMLA 2NRTA 1D8YA 4F01A 4DV7K 4DTMA 4JWEA 1RDWX 3EN9A 2Q12A 4WFAL 2ETJA 3QDKA 3RRGA 3H46O 4DU1A 4CF8A 2OBMA 1C0MA 3OS0A 3TABA 4EZWA 2P9UA 2V51B 1SAZA 4J2BA 2DFEA 2O0I1 5BRDA 1RTDA 5F1XA 3I04A 3MXIA 1NNEA 3D0PA 4BR9A 4NYFA 3THWA 1HWWA 4DSKA 5FRNA 1QQMA 4DR6K 3H1QA 3PIPL 1KAZA 3EEQA 1WOQA 3H45C 4B8CA 4CJWA 3CPEA 1VSKA 4GNIA 4H5WA 3VTIA 5LMNK 1YHQN 5C24A 1RTHA 2Z0OA 1QQOA 1KFSA 3DMJA 5C5BA 4FWLA 1ITGA 3O9UA 1U2VA 2Q31A 3BVVA 1RDDA 1SKWA 1NKBA 3MX2A 4HY9A 4WFBL 2V0OA 1KLNA 1RGIA 4CJ3A 2HHHK 3TSQA 5GINA 1LQ7A 2KW4A 1R33A 3HP6A 3G71N 1ATSA 1QZ5A 2OANA 4DR7K 4HTUA 3MECA 3LP1A 3IMXA 1ASWA 3L4IA 5BR9A 1HKGA 3ZSRA 4WPCA 4KB0A 4BNEA 4RG8A 1EX4A 1KAXA 4C1NI 3E9PA 3C7NA 4FK0A 2PY6A 3CMAN 5BREA 3KLHA 1VSJA 4BREA 1J5EK 3VQDA 2Z1GA 2GA9D 3CJ9A 1TK5A 2E6MA 3EZWA 4FO0A 1ZBIA 3CQ8A 3HYFA 3DRRA 2GEMA 1GLBG 4JI0K 3TI0A 4PHTX 1LV5A 1BA0A 1RBSA 2E4LA 3HSTB 3FFIA 3OYCA 1YAGA 2EFKA 4JD2A 2QTDA 3QNNA 2E2PA 4FK4A 2FSKA 4AM6A 5CHIA 4B9LA 4KHSA 1BWFO 2IC3A 2NLXA 4FWKA 3UITA 4JKCA 1J6ZA 5AQWA 4FJ5A 4FXDA 3LDOA 1T8EA 2YCHA 4B1YB 3JSMA 2QWLA 2ZQBA 5HOOA 4E3CA 2DTUA 1QHTA 2HB5A 1HMVA 3M6GA 4O44A 4H8KA 4R5JA 4DS5A 4BRPA 3A5MC 4FJ9A 2O8CB 1I3AA 1WAJA 4JHDA 4NLBA 3CHWA 4W5NA 4FLTA 2PAVA 4IWOA 1VQ8N 4E1NA 2YX6A 2OCEA 2VGNA 3D2EB 1VSDA 3GOIA 3H6EA 4HHTA 1U00A 1GLCG 1L3SA 4DV2K 1QWNA 4G6QA 4BG8A 1HTYA 3VESA 3WXJA 1GLLO 1NGAA 4F4KA 1BG3A 4ELUA 2R7YA 3NF7A 4IXCA 2V7YA 1GN9A 1TVRA 1CZ9A 4X62K 1TQSA 5JENA 2HF4A 3I55N 2DY4A 3EJUA 3FLCO 4KHNA 3L2QA 2Q2RA 3GG4A 4EZVA 4BR4A 1IKXA 3NAEA 3CCLN 3VQCA 3PX4A 4GVEA 2UYTA 2WUSA 3QEWA 2YL8A 3DYAA 1BA1A 2D1LA 3DLKA 1NM1A 4BC3A 3I2WA 3H3OB 2D0BA 4B08A 1M90O 1JLQA 3S5TA 1FK9A 3T69A 4CZHA 4WE1A 5KQDA 3LALA 5I3UA 5HLFA 4WQ4C 2BPRA 1W9MA 2OPSA 4DMNA 3QE6A 1DG4A 5M1NA 1TAQA 4BRAA 4E1MA 3WNFA 3H1VX 4FZSA 3TAQA 3N8EA 4E7LA 4UY8O 4JKDA 4HCCA 1T05A 4MQ3A 4AHVA 1NGCA 2VYPA 2P9NB 2A5XA 2PFUA 1R0AA 3TSUA 4B1WB 3AO3A 3U9DA 3I0SA 2ZE2A 5JLFA 4DV6K 4YFUA 4HUFA 3QIOA 5JS1A 3B6PA 3O80A 1IV0A 4ID5A 4DCHA 1VQLN 5C5BB 2HBLA 2E1YA 1U4BA 3QBXA 1HNWK 4AHRA 1T6CA 1VRUA 4F3TA 1SQKA 3K5OA 3HPHA 2YI9A 2D0AA 2GV9A 5M1PA 5BN9A 2HBJA 2E20A 4FM2A 3CCEN 4CHYA 3H08A 4FJ8A 3NDKA 3LZIA 2BUPA 4A59A 5GAGP 4BVPA 4CERA 3S3OA 4KB1A 4NXNK 2JWLA 1BQMA 1TUUA 2V7ZA 4CZJA 4F8RA 4CIEA 1FW6A 3HK2A 4EZTA 1WBBA 3QERA 4YORA 3N4PA 1OH7A 4NSWA 3CAZA 3D2FA 1LAVA 2HVIA 2XY7A 3ENBA 4FWMA 2OZSA 1BU6O 1X03A 5JS2A 3JXUA 4GY2B 3WT0A 4C1NK 4H5NA 5BN8A 1XMQK 1TKDA 2NRZA 3OJUA 3AVBA 1SKSA 3C6AA 1DKZA 1ZBLA 2ASPA 4B1UB 4Z0UA 3RR7A 2YHWA 1J9AA 4L8RB 1RBUA 3AO1A 2RN2A 1KTQA 3MWTA 3D7EO 1TV6A 3C6UA 2P9PA 3KLGA 4K8ZA 3CJAA 1NGDA 3J7AP 2EWFA 2LSNA 1RTJA 3CM5A 4NCBA 4CFBA 1NK5A 4ILJA 4IJAA 3CCSN 4IM0A 3BVXA 3EY1A 2HBMA 4J2DA 3BVWA 4B9TA 4LF6K 2YIBA 1W7AA 1SV5A 1I39A 4EZPA 5AQFA 2Q97A 3HSCA 4KBOA 2HHTA 1E4GT 3VQBA 2W00A 3IS9A 4KI4A 3VQ6A 5KBPA 1IBMK 3HOSA 3RRHA 4EIAA 3OYAA 1Y64A 4B3RK 4JHDB 4FZZA 3QLHA 4IZ9A 3BDPA 3CV5A 4BC5A 4N41A 1N6QA 3HRGA 3WXLA 3CJ7A 4DG1A 3AGRA 4DR4K 3V9SA 1Z25A 1YF5L 1YTAA 3NVKA 1T03A 4OPHA 4AVMA 1WUAA 3OBYA 1R34A 1RT5A 1NK6A 4YDUA 3U3YA 5AZIA 1ASVA 3G6EN 1TL1A 4BR0A 1X9SA 3QIPA 1TQWA 5GAHP 2OYQA 1TYQA 1TQUA 3JYTA 1T7PA 4C23A 1BIZA 2NUBA 1K8AO 3HBTA 1TUYA 3IDHA 1IG9A 1ZC6A 4NCGA 3DLRA 1IG8A 3T1HK 3MEGA 4EZYA 2GAFD 5T7BA 4AHTA 2DPNA 4WQ5C 3MN7A 3OTOK 4W5OA 3ZT4A 1MDUB 1IJJA 1BQNA 4AF1A 1H1VA 3M1FA 3V9XA 1VQMN 4WF9L 4CF2A 4DQRA 1I4TA 1Q7YO 4RWTA 3DRSA 1KVBA 4EZXA 1YITN 2OPRA 3DXMA 2YKNA 1GNLA 1BCOA 4CD3A 3KLFA 2RF2A 4B9UA 1HR0K 2KZZA 4JK8A 4BWMA 2N3KA 1X3NA 4BRCA 5ADXH 4I2QA 4K25A 3OS2A 2P9IB 2X3WA 1NJIO 3K9JA 4CEDA 1NK7A 5EXWA 3F5TA 4A61A 4U67L 3AAQA 1I94K 3EE9A 3O9TA 3EJQA 3CIPA 3ENOA 1QSYA 2ZD1A 3PUFA 4X66K 3K5NA 1S6PA 4DU4A 2D1KA 2O8DB 4BDPA 3AARA 3L2VA 4H0YB 2OBLA 2BE2A 4JEPA 3BUZB 2W42A 3LLLA 1NKEA 3SPZA 3RMCA 4DFMA 4N56A 4BDYA 5AQRA 4KPYA 3L3VA 3GE1A 2O8FA 3V9ZA 5E84A 1X9JA 1Z6RA 2AP1A 4IOAL 2VG7A 2PY5A 1KRPA 4AZ5A 3OYLA 4DSFA 3HPGA 4OVLA 3TANA 3BEXA 2RKIA 4EZUA 3PSIA 4CZGA 4FW2A 1VQPN 1LW2A 4B3MK 4DFJA 4GV3A 3SBSA 2BDPA 4DSEA 3D2FB 4HR1B 3QB0A 5AQHA 3QO9A 3LM9A 1HPZA 1HNZK 2ITGA 3BUDA 3LAMA 3CZNA 2ITMA 5C10A 4CJKA 4LF7K 2GELA 3P5JA 3TTFA 1Q9XA 3AVNA 1HPMA 2O4GA 1CKRA 1ZYQA 3I56N 2GWKA 3OA9A 2JNKA 2G8KA 2V52B 4HTLA 1NGHA 3NMUA 4BR5A 3OYGA 1NOZA 1HLUA 2P9PB 4CZFA 3RTVA 1E3MA 4B1VA 3TTCA 4BRFA 3THXB 2CH6A 4DQ8A 3PO4A 3I33A 3ISNC 3N4QA 3OVNA 3DOBA 3VETA 3QFPA 2YHXA 3VOVA 4JNFA 1VQON 4GMJB 2QK9A 3T1AA 5FLXO 4KTQA 2QWOA 2FXUA 3T47A 3E01A 5AQVA 3OS1A 4Z4GA 3TAGA 4W5QA 3ATUA 4B3OA 3CFRA 3SQ1A 2OO2A 2PYJA 3CVRA 3TAMA 5C2FA 2O8EB 3NF8A 2HMPA 4E3SA 1VSLA 2BTFA 2YKTA 3DX3A 5J1EA 4NXMK 2ZGZA 3HTVA 3OYJA 1S72N 3SQ4A 1QSLA 2A3ZA 3VA0A 2P51A 1U49A 2IIRA 1YJWN 2W40A 3CMEN 3SK3A 1HKBA 2ATQA 4IO8A 4E7HA 5FLEX 3O3HA 4CGJA 1ESVA 2OZNB 5LJWA 1EO1A 4M3YA 2DFHA 4CJSA 3M8SA 1K73O 2O8CA 4FVMA 1HX1A 3TAEA 1OH5A 2OTLN 2HOEA 3P38A 1GNTA 3M8QA 1EETA 4YDUC 1GOAA 3QINA 2Z0VA 7HSCA 1DLOA 1TL3A 3OYIA 3FGUA 4GVMA 2YKMA 1Q82O 3GL1A 5CYMA 4IOCL 3HP9A 2E1ZA 2QWMA 4AZHA 1UWBA 3BF1A 4CEAA 5SWMA 1MJGA 3VGLA 3QFUA 1HJRA 1UA1A 2OZMA 3WNEA 2OW6A 3DXMB 4EZ6A 2FSJA 5HRRA 4EZRA 1SUQA 2AA4A 3C6HA 3V6DA 4WQ4A 5KQ8A 3P39A 4AZ6A 3S9HA 4I1QA 3QETA 2G8UA 5J2MA 3BZCA 1HKCA 1N33K 4LF9K 4Q5VA 4KIKB 3EJPA 3WQTA 3CC2N 3VF2A 1BL3A 3AVJA 3ZSVA 4C8KA 4N5SA 3NBPA 4BE0A 1YVNA 4DV1K 1C6VA 1XHXA 4M3ZA 3IFRA 4MQDA 3WUHA 3RMBA 1UA0A 3LP3A 4CBUA 3SQ2A 1KXPA 2WONA 4H5RA 4DQPA 2IVPA 1G15A 2O8FB 4FJKA 1UAXA 4LFBK 4HWIA 3MWPA 1NG9A 3F9MA 4Y1CA 1S1WA 3CC4N 1OH6A 4M0MA 4RW4A 4M3XA 2P9NA 3RVCA 3EZ5A 3B51X 1X1PA 2Q13A 4BWJA 1E4FT 1SKRA 3NH2A 3DX1A 3CXCM 1V4SA 3LANA 4JRQA 1RTIA 5J2PA 4LFAK 2D0PA 3S3MA 4FLXA 4MLEA 1E2UA 4AZIA 2VG5A 3VPZA 4F00A 4CJFA 2Z1IA 3HVRA 3CG7A 3FR0A 2GUPA 3OYBA 2D4CA 5AQXA 3CYMA 2P5GA 3O1BA 4E7JA 4CJ5A 3ZT3A 4FZPA 1NU0A 4KFBA 3BLBA 4CFAA 4PO2A 2GWJA 4C8LA 4FSVA 3ABHA 1QVGM 5F2RA 2FC0A 2JGUA 3KVGA 3FD9A 3TU5A 3UB5A 3A98A 4UDYX 3SPYA 4LSLA 2GUIA 1NGEA 1YXQA 2EX3A 3WXKA 3CZSA 3L6QA 4ISFA 4J2EA 4EHTA 5FIGA 2OPPA 3GDQA 4CHZA 4CIGA 4RCHA 3AVCA 2KFZA 4EZQA 4JI8K 5GADP 5A2QO 5E41A 1Q18A 3J8AA 3O5BA 3O08A 4IM3A 3MCAB 4ZTJA 4EZ9A 4BQLA 5H1SQ 4R5KA 1X9WA 3EKSA 3WQUA 4XH5A 5C12A 3HI0A 4IWVA 3CCRN 5GIPA 1J54A 3VEYA 2OW7A 2P9SA 1MA9B 1NMNA 1X9MA 1BDGA 3OHRA 3TSPA 3M8RA 3KIOA 4A2AA 2FYVA 3EE8A 4GKJK 3C0BA 2X74A 4KTZA 3JS6A 4PA1A 3G0ZA 3ZEFA 4QOZB 1S5JA 2P1JA 4I7FA 4KRFA 3KWGA 2QA4N 1J5OA 3AVFA 4BQZA 3J7YP 1U48A 1GLFO 1Q9YA 5I9EB 3FZKA 4DV5K 1DKGD 4CJEA 3WXIA 2GX9A 2QEXN 4C8OA 1RT7A 4X65K 1KFDA 3ZSYA 4AQYK 2UUBK 2NRHA 1WSGA 3C94A 2C1GA 3L2RA 1CXUA 3AGKA 2X3VA 4KH5A 3PO5A 4HUGA 4O0JA 4ISGA 4WQ5A 2HMIA 5TKYA 1L3UA 4ELTA 2ZWHA 3F73A 2ZJPL 3HPOA 2RAIA 4BRQA 4DTUA 4CHNA 1U6ZA 4AHUA 3VEBA 4F2RA 1WN7A 4FOIA 1SU7A 3TPQA 1NKCA 4FJNA 2ZM6K 2F96A 2IDOA 1B9FA 2QKKA 2XY6A 1A5XA 3ASMA 4K8XA 2HHUA 5IT9O 1SZ2A 2Z0NA 2HHSA 2EHGA 4OLBA 2KQ2A 3AVAA 4DF4A 4MLHA 4BE1A 1SU8A 3L8BA 3ZLJA 3ACOA 1NK0A 2A42A 4AZ7A 3IAYA 1RFQA 2GBZA 5HL7L 2F7TA 3SZ2A 4KHQA 2QM1A 3ZT1A 5AQZA 1RBTA 2D4WA 2WTUA 4PQUA 3ULDA 3D51A 1LWEA 3VGKA 3DPOA 2A40A 2C08A 4OKJA 1C0GA 5EY4A 1SUFA 3MEEA 2YI1A 3AV9A 5M1OA 3O9RA 2P9IA 2P9LA 5C15A 1BI4A 3MCPA 3TWHA 2LM0A 1EXQA 4FJJA 4BRDA 1RCHA 1O7DB 1VAZA 3SUNA 5LL6Z 4JKEA 3NCIA 5AQPA 1VQ7N 3IUCA 2QFFA 4FW1A 2O8DA 3HAJA 4B9NA 3AVMA 2HHXA 1RDCA 3V1RA 3LDLA 3QWEA 4AZCB 4YOXA 5JMVA 3P4IA 4CI6A 4LF5K 2E2OA 2E8AA 1XI1A 3U4LA 5C42A 3D6RA 1N5YA 4Z4CA 4FJGA 4QS9A 4JLHA 4CIFA 3PY8A 1EWQA 1V4TA 3B6OA 1O7DC 4FWRA 4JN4A 3FZMA 3O3NB 1KLMA 1JLAA 4BRMA 2F9WA 2YJFA 1XMOK 4IWPA 2P5OA 5HRSA 3T48A 1QQNA 1QS4A 3LL3A 4J2AA 2EX3B 2YLAA 1JL1A 1NJXA 1HUXA 1HXKA 2QKWA 4HR1A 3ER9B 4KI6A 5AQYA 4BG9A 4IW0A 4DR1K 5KPTA 4H4OA 4KAZA 3DDGA 4LSNA 4B1XB 4AHCA 4RTFD 4FZOA 3QICA 3M3WA 4CZKA 2YLLA 5HBMA 2X6NA 1LWFA 3QEVA 3ZSOA 4KHUA 3B53X 1QX1A 3OY9A 1NJZA 4DFPA 1L5UA 4ILIA 3SMPA 1QTMA 3E1YA 2F4VK 3BZKA 4FVUA 4E19A 4MDBA 1VQKN 1DKYA 2GF4A 5DM6L 2P9SB 5KTQA 1HQUA 3VQ7A 3E9LA 4FJLA 3FZLA 3NH0A 5LJVA 3THXA 4CF1A 3EL2A 4JKGB 4EZZA 3DLHA 1ZBUA 4O5FA 3UKUB 1RT1A 1S22A 1HYSA 3AA4A 3QESA 1NBWA 4X64K 3HL8A 1OA0A 3NF6A 1C0UA 3ZSWA 2FBTA 3SUOA 4FOEA 4G9ZA 1IKVA 1LWCA 1W2BM 1W9HA 4IEEA 3OYFA 2O8EA 5BRHA 3I39X 3ZEDA 3NF9A 4DLEA 3DPQA 3LM2A 2E88A 3O4NA 4CGGA 5KRTA 5C2DA 3AAPA 3AA2A 3DQGA 5D3GA 2EWSA 3ZX2A 3VQEA 4OGEA 4BY9C 3QNJA 5LMUK 5FPMA 3KJVA 4CEEA 3FE1A 1NK9A 1WLJA 4JKFA 4BE7B 1XQSC 4B1ZA 3KK7A 4M7YA 1C0TA 4M42A 4A5AA 3H0XA 1LOTB 2QWNA 3TAPA 4CEBA 5CE3A 1MWMA 5KGXA 2RT6A 5AQLA 3SV4A 3DLEA 1NWKA 5FDLA 4CE9A 3L0QA 3EYZA 2F18A 4YNQA 4PKIA 3KKRA 5AFUA 4MO4A 4PWDA 2QWPA 4C8MA 4R5LA 3F9KA 5JVGL 3CD6N 3DRPA 1SL1A 3K5LA 5KPRA 4EZNA 3CF5L 2Q0RA 2CGLA 3RV1A 2IVOA 1B92A 3K2PA 4DQSA 4OO1J 2XY5A 3AVHA 5IWAK 4WCEL 2PBDA 1W97L 3A5NC 4JKHA 2F8TA 3ZT2A 1IBKK 3DLBA 3LWMA 1LAWA 3VTHA 2P9LB 5AJ3K 3SYZA 3MXJA 1BI4B 5DM7L 2HW3A 4LD0A 2VWKA 3T7ZA 4KIKA 4ICLA 2X3XA 4BR7A 1GLJO 1KCFA 3C65A 3K58A 2YNHA 2IVNA 4M3UA 1TQTA 3EJSA 1Q86O 5BPMA 2OA8A 3BUQA 3DLGA 3LAKA 1KD1O 4CJTA 2E2NA 4FWSA 4CHOA 4IG3A 1J53A 3HZ6A 2FICA 1EQYA 4DU3A 3U9ZA 2UXCK 1WNSA 5AQGA 3ITHA 2ALWA 1IH7A 5EU7A 4B8AB 2A41A 2NRVA 4XH4A 4CBXA 3R8EA 4KHPK 1ZYLA 3CCVN 4CK3A 1BPRA 4FYDA 3QNIA 2VWJA 1YIJN 1IO2A 2YNGA 1JL2A 4FLVA 4CFCA 3K59A 3ZSXA 4DR2K 1YTUA 3KZBA 1ZBFA 3OYKA 1TKZA 5EVZA 2YL6A 1DEJA 1HNIA 4DR3K 4E89A 1VQNN 1CXQA 1G99A 4I43A 4H0TB 1VRTA 2BH1A 3EJTA 3QEIA 4DSIA 3VQ9A 4KH6A 3BVUA 3AA5X 3CC7N 5LY3A 4E7IA 3O3GA 4I9LA 2JWKA 2YL5A 3OYDA 2WINM 3NGYA 3F2KA 4H0XB 4IOXA 1XC9A 3CCMN 2X78A 4EFHA 2BGGA 4ILHA 3BP8A 4XJXA 3L4QA 3CFOA 4YHHK 3DAWA 4DQIA 3D45A 3L3UA 4CJRA 4FM3A 3C95A 3WNHA 1NJWA 4B9MA 4M41A 2VCPA 3A8YA 1YWMA 4LH4A 2XY8A 3MAQA 1MWKA 3VMFB 1T6DA 4Q0BA 2HHWA 2KTQA 4FM1A 4BGBA 5FROA 2X6SA 3IRXA 4ID1A 2D5RA 1S9EA 1TK0A 2Q3SA 3BF3A 4IEIA 3G4SN 3NGZA 4XH1A 1EP4A 4H6IA 4W5RA 4BGAA 4DUZK 2YIVX 1BUPA 5C0YA 4WV5A 3ZETB 1I4DA 4GV6A 4E1JA 3G25A 4FJHA 4N76A 1E1DA 2WOMA 4U7BA 1SS6A 3Q7CA 5CZ1A 1DTTA 1BGXT 4DCNC 3MN5A 3Q0KA 3LDPA 4L3QA 4NB4A 3MX5A 4AZBA 1NJYA 1JCGA 4EAHD 1Y97A 3OHXM 3ID6A 3OWGA 2YHAA 4MDAA 4A5BA 3ZT0A 3E66A 2O8BB 4DTJA 4FWPA 3K9KA 3KK3A 4FWOA 2YV0X 5M1FA 3THYB 1S9GA 3TARA 3H3NO 5K14A 2G8FA 1GOCA 3SOGA 2NRWA 4RW9A 3NE6A 1NOYA 4FPAA 3VQ4A 4M3TA 1O1WA 3O4WA 4GKKK 3RWUA 2RHKA 3LMFA 2HHQA 1GLAG 4BC2A 4F3OA 1IBLK 4JRPA 3DX4A 1BIUA 1YUWA 3T46A 1K6YA 4DB3A 3K0SA 3V9UA 3VEVA 3PLTA 3V81A 3LDSA 4CFDA 2D0CA 3VN5A 4F2SA 3PSFA 4H0VB 3LP2A 3UE5A 2Q0UA 2AJQA 1WAFA 4DSJA 4JI7K 3O3FA 3D4YA 1BOTO 1RDUA 3QEXA 2W41A 4ELVA 3L3OM 4BRLA 3SUPA 3T3FA 4K0KK 4H0OA 3SNNA 4UDXX 4PKGA 3RSEB 3WEEB 3ID8A 3A5LC 3SJJA 3SQ0A 3PLAA 4RW7A 3J80O 1WSJA 5HP1A 4CW7B 3OYHA 4DUYK 4IKFA 4EZOA 4XIUA 2D0OA 2QWQA 5HRPA 3KK1A 1NLVA 3LDNA 2EFLA 1R59O 5M1KA 3DWLA 2FLOA 4XEIA 3KD5E 4C8NA 3CCQN 1SL2A 3CPWM 3ZCMA 3O6WA 4DTNA 4JI5K 3MK6A 4QS7A 4H8SA 1T3VA 2FF3B 4H5VA 3OW2M 3VF6A 3DI6A 4CEFA 1XNRK 1ATNA 4DTOA 4LH5A 3CI5A 2E6LA 3LVTA 3O1WA 4CEZA 2H3GX 3TR8A 4CJLA 1FKPA 3A5OC 3VKHA 4CZIA 2VG6A 1B9DA 4IFEA 1X04A 2VQEK 1C1AA 2OTJN 1I4LA 3BUBA 3RMDA 3DXKB 3PX6A 3THVA 2F7RA 4AZCA 2B5JA 3DLLL 1RT2A 2I7PA 3SI6A 4JI1K 4I6MA 4JLCA 1TKTA 3EJRA 4E0DA 1PS3A 3OJSA 1ZBHA 3SUQA 2YIAA 2RAJA 2OP6A 4NO7A 3JAMO 3FZFA 1WBDA 2OPQA 4NPHA 1C0FA 4DR5K 3HVTA 4ILHB 3ULEB 4BRGA 4IDHA 5CYQA 1KSPA 1A5VA 2ASMA 2C1IA 3VGMA 2I7NA 3CJCA 3SYVA 1URUA 1OVQA 4R5IA 4MFBA 3VQ8A 3HXMA 1IKWA 5AQNA 4IJNA 5AQMA 3CJBA 4CJVA 2B6AA 3HOTA 4OGCA 3AY9A 3HT3A 1N34K 3D50A 5AQIA 1YT3A 3ZX3A 4AKVA 1GLDG 3KK2A 2HHIA 3I0RA 3T19A 3P1GA 2DFFA 3VENA 4O8KA 2BANA 2RPIA 2X5CA 3VEAA 1S3XA 4CJUA 1C1BA 4J8FA 5MLCQ 4BC4A 4IWQA 5BPLA 1OKJA 4Z94A 5TKWA 2HVHA 3A2FA 1BCMA 4OLAA 4JKGA 4JKAA 3ZX0A 3AVGA 4YOTA 3UKUA 1TK8A 2YNIA 4KKOA 1VSIA 4OPAA 4BE2A 3L3PA 1TKXA 4NYNA 2QXLA 1N8RO 3VEWA 2VQFK 5KPZA 2F7QA 3V4IA 1NGIA 3IKMA 5AQKA 4BROA 1VSFA 4CVNE 2G8VA 3SAHA 2YL9A 1DT9A 4CGDA 1RNHA 1CLQA 1BISA 1P90A 4JNEA 4YOUA 3SBTB 4FPBA 1JCEA 3UIQA 4JWCA 3KTQA 3AVIA 3VEXA 4CF9A 4WV7A 2E2QA 4KHYA 3SLCA 3HM9A 4BDZA 1QHAA 3UKRB 1Q81O 4DFKA 5GIOA 3SBGA 3J81O 1KAYA 3CM6A 3M5RA 4H0PA 1RT4A 3PIOL 3IG1A 1S1UA 3DPPA 3LDQA 5E26A 2CGKA 5AQSA 3TAFA 1KQSM 1ASUA 4EHUA 1U47A 3M3ZA 4BRHA 4E7KA 3BVTA 1JCFA 3U8XA 5FPEA 1VSEA 1KVAA 3TTDA 5CZ2A 4KV8A 1WDZA 2Z8YA 4ILGB 5DMRA 4DSLA 2Q1NA 1NGFA 3BUPA 3CYGA 3BUIA 1KC8O 3HO1A 2HHVA 3F7WA 1HRHA 2HNYA 4JK9A 3R6MA 4IFYA 1YI2N 1TQVA 4PY5A 4DYLA 1Q5LA 1DGKN 2F1AA 1GOBA 1D9FA 4Y1DA 4JI4K 3VQ5A 4FLZA 3QNOA 4Z4FA 4JS5A 1CZBA 3VA3A 2NZTA 1RDBA 2UU9K 2VGMA 1ZWWA 4FK2A 3V1OA 2QKBA 3CCUN 1GLEG 4H4MA 4JWDA 2YHYA 4HCBA 5F0XA 1L3TA 2ZXQA 3W0LA 1K8KA 1JKHA 3MN9A 1VQ4N 4BRKA 3VQAA 4GW6A 1O13A 4M45A 4Z4IA 4EP4A 2P9UB 3K57A 2FSNA 3ZSZA 1SL0A 4GV9A 4DHYA 3DX0A 3DOLA 1Z05A 3T4AG 2KKZA 3THWB 3KDRA 1SU6A 1U45A 2YJEA 1U04A 2F7PA 4FWNA 2HF3A 1RT3A 3W3DA 1WB9A 4I6MB 2VWBA 4H6HA 4Z4EA 3B8AX 2KLAA 4PL8A 1ILYA 2NRXA 4DV4K 4O5BA 1HJOA 3SAGA 1VHXA 3ZEUA 3VQPA 2E5LK 5FPNA 3VERA 4B3TK 5JICA 1OVYA 3J7ZO 1YJNN 3AVLA 3VEZA 3HJFA 1U2VB 4CK1A 4OPKA 3OYNA 4CGFA 2CGJA 4RW6A 1X3MA 2A1SA 4H03B 3LP0A 3P31A 5FPDA 1KVCA 3I01A 3CCJN 3AA3A
chains in the Genus database with same CATH topology
2GEMA 1GLBG 7HSCA 3C65A 5CR4A 4PHTX 3FGUA 4A2BA 2IVNA 1BA0A 4YOYA 3VEOA 2WFBA 1Q82O 1Q86O 1YAGA 3QBWA 4JD2A 5BPMA 2QTDA 3GL1A 4IOCL 2E2PA 2E1ZA 2QWMA 1KD1O 1ZBSA 2FSKA 3BF1A 4AM6A 5CHIA 2E2NA 1MJGA 4FWSA 1BWFO 4JKCA 2NLXA 4FWKA 3UITA 3EO3A 1J6ZA 3HZ6A 3QFUA 5AQWA 3VGLA 3LDOA 1DKXA 1EQYA 2YCHA 3U9ZA 4B1YB 4K43A 2QWLA 5AQGA 3C7NB 1T44A 3DXMB 5HOOA 2FSJA 2A41A 2FF6A 2QWRA 2NRVA 4E3CA 4XH4A 4HYBA 4AM7A 4CBXA 4EZRA 3R8EA 3M6GA 4YOWA 2AA4A 3C6HA 4R5JA 1ZYLA 4WQ4A 3CCVN 5KQ8A 1BPRA 1YIJN 4YOVA 4JAXA 4M7XA 4BRPA 4F9OA 3P39A 3A5MC 1K9MO 3A0IX 4JHDA 1N8RO 1HKCA 3CHWA 4NLBA 3KZBA 4CZEA 3KAWA 4KIKB 2PAVA 4IWOA 1DEJA 5EVZA 3VF2A 2YX6A 3WQTA 1VQ8N 3CC2N 1VQNN 2VGNA 3D2EB 1G99A 4I43A 4H0TB 4M63C 1QZ6A 2BH1A 4CZLA 1YVNA 3GOIA 3H6EA 3SJHA 3VF4A 1U00A 1GLCG 3IFRA 4MQDA 4KH6A 3ZETA 3WUHA 3CC7N 4G6QA 4JD2B 5LY3A 4NLCA 4BG8A 2GTDA 3VESA 4CBUA 3WXJA 3NVMA 1KXPA 4JWIA 4H5RA 2P9KA 2IVPA 2JWKA 3SAFA 2WINM 1GLLO 1NGAA 4FL9A 3F2KA 1BG3A 4HWIA 4H0XB 4IOXA 3MWPA 3CCMN 4EFHA 3F9MA 4ILHA 3BP8A 1OA1A 4XJXA 3L4QA 1CZAN 3CC4N 4IXCA 2V7YA 1GN9A 4M0MA 5JLHA 1JJ2M 3DAWA 3O3MB 2P9NA 2HF4A 3RVCA 3B51X 3FLCO 4FM3A 3I55N 1E4FT 3B52X 2VCPA 3CXCM 3MN6A 3A8YA 1V4SA 2Q2RA 4A62A 4E81A 3QA8A 1E9VA 3GG4A 4EZVA 1MWKA 3VMFB 1T6DA 4BR4A 2D0PA 3CCLN 4GVEA 4BGBA 2UYTA 2WUSA 4MLEA 4EZSA 1E2UA 5AQUA 1BA1A 2ASOA 4BC3A 1NM1A 4F00A 3VPZA 4R5GA 2HBKA 3BF3A 4IEIA 3G4SN 3FR0A 4XH1A 4H6IA 2GUPA 3H3OB 3CQXA 2QW9A 4BGAA 1M90O 2YIVX 1BUPA 5AQXA 2F9TA 5C0YA 3O1BA 4WV5A 3ZETB 3T69A 4CZHA 4WFNL 4GV6A 5KQDA 1M1KO 4E1JA 4BRIA 3G25A 3Q7BA 4WQ4C 2BPRA 1W9MA 4PO2A 2GWJA 2ZJRL 1E1DA 4U7BA 1VQ9N 1DG4A 4FSVA 1SS6A 4BRAA 3R3LA 5M1NA 3Q7CA 1QVGM 5F2RA 3H1VX 1P8ZA 3N8EA 1BO5O 3KVGA 4JKDA 5AFUH 4UY8O 3MN5A 5AZJA 3FD9A 3TU5A 3UB5A 4O8UA 3A98A 4BRNA 4UDYX 1NGCA 2VYPA 3SMSA 3LDPA 2P9NB 4L3QA 2A5XA 2PFUA 1NGEA 3TSUA 1YXQA 3CQYA 3WXKA 4B1WB 4CJ7A 4NB4A 3U9DA 3MX5A 3L6QA 4ISFA 1JCGA 5JLFA 2RE2A 4EAHD 3ID6A 3OHXM 3OWGA 4EHTA 5FIGA 3T49A 4MDAA 3O80A 4ISEA 4A5BA 4DCHA 4JL9A 3E66A 3GDQA 1NGJA 1VQLN 2HBLA 2E1YA 3QBXA 4FWPA 1T6CA 3K9KA 4RCHA 4WYBA 4FWOA 4EZQA 5M1FA 1SQKA 5GADP 1K8KB 3RSEA 3H3NO 3WEEA 2YI9A 1Q18A 3J8AA 3O5BA 3O08A 4IM3A 2NRWA 3MCAB 5M1PA 5BN9A 4D8JA 3DJCA 4BQLA 2HBJA 5H1SQ 4R5KA 2E20A 3EKSA 4FPAA 3CCEN 3O4WA 3WQUA 3GBTA 4XH5A 2RHKA 3LMFA 1GLAG 4K42A 5JVHL 4BC2A 5C12A 3HI0A 4IWVA 3CCRN 5GIPA 2BUPA 4Y0WA 4A59A 3VEYA 3FFKB 1YUWA 2P9SA 4BVPA 3T46A 5GAGP 1NMDA 1MA9B 2JWLA 3I8BA 3FZHA 1TUUA 5ADXA 4DB3A 2V7ZA 3R1XA 3CERA 1BDGA 3OHRA 4CZJA 1OAOA 3TSPA 3VEVA 4EZTA 3O3OB 4A2AA 4H0VB 3EE8A 3N4PA 4YORA 3O9QA 3UE5A 3C0BA 2Q0UA 3D2FA 1XC3A 3ENBA 5KPZA 4B9QA 1BOTO 1RDUA 3JS6A 4FWMA 3ZEFA 1BU6O 2W41A 4JKBA 3KAVA 3ZEUB 3L3OM 4BRLA 4BR2A 3CETA 3JXUA 4CBWA 4GY2B 3WT0A 3GI7A 4CZMA 3KWGA 4H0OA 4C1NK 4UDXX 2QA4N 4PKGA 3RSEB 4H5NA 3WEEB 5BN8A 3ID8A 3A5LC 2NRZA 4BQZA 1QVFM 3C6AA 1GLFO 1DKZA 3PLAA 2ASPA 4B1UB 5I9EB 3FZKA 3S41A 1DKGD 2YHWA 4EZOA 3WXIA 2D0OA 2GX9A 2QWQA 3MDQA 2QEXN 3MWTA 3D7EO 1NLVA 3DXKA 2NRHA 3LDNA 1R59O 5M1KA 2C1GA 2P9PA 3DWLA 2QI2A 2FLOA 1NGDA 3CJAA 4XEIA 5AQOA 4A57A 2EWFA 4FWQA 5EX5A 4CD1A 3CCQN 3AGKA 4KH5A 4R79A 3CPWM 4ILJA 4ISGA 3O6WA 4IJAA 2Q36A 3CCSN 1VQ6N 4IM0A 4WQ5A 3MK6A 4PL7A 2HBMA 3ZYYX 5TKYA 4QS7A 2YIBA 2ZWHA 1T3VA 2FF3B 4H5VA 2WC9A 3ER8C 2ZJPL 3VF6A 3OW2M 3ULEA 4BRQA 4EZPA 1D4XA 1U6ZA 5AQFA 2J4RA 3O9SA 2Q97A 1JQKA 3HSCA 4KBOA 3VEBA 3ERCC 1ATNA 1E4GT 2W00A 4FOIA 1SU7A 3CI5A 3TPQA 3O1WA 3HOSA 2H3GX 5AQQA 4EIAA 3A5OC 3VKHA 4CZIA 4DKWA 5M1QA 1Y64A 3OBWA 4IFEA 4JHDB 2OTJN 2NRRA 3KHYA 1SZ2A 4IZ9A 3ENHA 3E9OA 3DXKB 4BC5A 2JNSA 3HRGA 3DLLL 3WXLA 3CJ7A 2I7PA 3AGRA 4MLHA 1SU8A 4H5TA 1YF5L 3NVKA 4I6MA 2A42A 2ZF5O 4JLCA 4OPHA 1RFQA 1WUAA 1XUPO 3OBYA 4YDUA 1ATRA 2F7TA 5HL7L 2QM1A 5AZIA 5AQZA 2YIAA 2D4WA 2P9KB 2OP6A 4NO7A 3VGKA 3DPOA 3G6EN 2A40A 3FZFA 4BR0A 1UPXA 5B8HA 4NPHA 1C0FA 1C0GA 4QS8A 5AQJA 1SUFA 4ILHB 5AR0A 5EY4A 2YI1A 3ULEB 1TYQA 4IDHA 4BRGA 5GAHP 2ASMA 2CH5A 2C1IA 3R9PA 3VGMA 2I7NA 3CJCA 5M1OA 3O9RA 2P9IA 3EKUA 2P9LA 5C15A 4R5IA 4IO9L 4C23A 3MCPA 3ATVA 1K8AO 3WXMB 2LM0A 3HBTA 1TUYA 3IDHA 1ZC6A 5AQNA 1IG8A 4BRDA 3O8MA 2A6AA 2HSTA 4EZYA 3CJBA 4IJNA 1VAZA 2GAFD 4MO5A 5AQMA 4JKEA 5AQPA 2DPNA 3HOTA 3IUCA 2QFFA 3AY9A 3MN7A 4WQ5C 1VQ7N 5AQIA 3ZX3A 1GLDG 1MDUB 1IJJA 3LDLA 4AF1A 1H1VA 3M1FA 3SBTA 4YOXA 1VQMN 3CJ1A 5JMVA 3P4IA 4CI6A 3VENA 4O8KA 2E2OA 4WF9L 2E8AA 2ND1A 2X5CA 1Q7YO 3VEAA 3U4LA 1S3XA 4RWTA 2ND0A 3D6RA 4QS9A 3UKRA 4EZXA 4J8FA 1LCUA 5AZIB 5MLCQ 1YITN 3DXMA 1V4TA 4PKHA 4BC4A 1GNLA 4IWQA 3RV0A 1OKJA 3MMVA 4CD3A 4FWRA 4Z94A 4JN4A 5TKWA 3FZMA 1NGGA 3O3NB 2NCZA 4K41A 1TYQB 4JKGA 4JKAA 4IM2A 5AZJB 3ZX0A 4YOTA 2F9WA 4JK8A 3UKUA 2YJFA 4BRMA 2N3KA 4IWPA 1X3NA 2ZGYA 3KWIA 4BRCA 4K25A 5ADXH 2P9IB 3T48A 1QQNA 3LL3A 1NGBA 1NJIO 4OPAA 3K9JA 2EX3B 2QXLA 5EXWA 3F5TA 4A61A 1HUXA 3AAQA 5EOYA 4HR1A 3ER9B 3EE9A 3VEWA 2KHOA 5AQYA 3O9TA 4IW0A 3CIPA 3ENOA 1NGIA 4BG9A 3IKMA 5KPTA 4KH4A 4ILGA 5AQKA 4BROA 3D2EA 1ZXOA 2D1KA 5ELZA 4B1XB 4RTFD 3QICA 3SAHA 4CZKA 3AARA 2ZJQL 5BRFA 1DT9A 4H0YB 2OBLA 2WBNA 1P90A 4JEPA 3BUZB 4JNEA 4YOUA 3SBTB 3B53X 4FPBA 1JCEA 3HM8A 4BEBA 5AQRA 4JWCA 4ILIA 3SMPA 3VEXA 2NNWA 4BECA 3E1YA 3GE1A 4WV7A 5E84A 2E2QA 3SLCA 5AQTA 4LC9B 1QHAA 1X9JA 3UKRB 1YJ9N 4MDBA 1Q81O 1VQKN 5BPNA 1Z6RA 2AP1A 1DKYA 5FPDA 5GIOA 5DM6L 3SBGA 2P9SB 4IOAL 1VQ5N 1KAYA 3I01A 3E9LA 3M5RA 4H0PA 5GAEP 3FZLA 3PIOL 5LJVA 4BVOA 4JK7A 3BEXA 3DPPA 3EL2A 3LDQA 4JKGB 4EZZA 2CGKA 5E26A 5AQSA 4O5FA 4CZGA 1KQSM 3UKUB 1S22A 1VQPN 4EHUA 4GV3A 3SBSA 3M3ZA 2YI8A 3QMLA 1NBWA 2NRTA 4BRHA 4F01A 3D2FB 1JCFA 3U8XA 1OA0A 4HR1B 5FPEA 3QB0A 5AQHA 3TTDA 4U67L 4JWEA 1RDWX 3EN9A 3LM9A 4FOEA 2Z8YA 4ILGB 3QDKA 4WFAL 2Q1NA 3H46O 4G9ZA 2OBMA 1NGFA 1W2BM 2ITMA 4EZWA 5C10A 2P9UA 1KC8O 2V51B 3F7WA 1SAZA 2GELA 5BPLA 4IEEA 3TTFA 1HPMA 4JK9A 3R6MA 1CKRA 5BRDA 5BRHA 5F1XA 3I04A 3I39X 1YI2N 3ZEDA 3DPQA 3LM2A 2E88A 3I56N 4BR9A 5C2DA 2GWKA 3AAPA 3OA9A 1Q5LA 3DQGA 1DGKN 2V52B 1QQMA 1NGHA 4HTLA 4BR5A 3NMUA 2EWSA 1HLUA 2P9PB 3H1QA 4CZFA 3PIPL 1KAZA 3ZX2A 1WOQA 4BY9C 4B1VA 3QNJA 3H45C 3TTCA 4BRFA 2NZTA 2CH6A 2VGMA 4DQ8A 3CPEA 3I33A 3N4QA 5FPMA 3FE1A 4GNIA 4H5WA 3VTIA 3DOBA 3VETA 3QFPA 1YHQN 2YHXA 4JKFA 3VOVA 4JNFA 1VQON 4BE7B 3CCUN 1XQSC 1GLEG 1QQOA 3KK7A 4M7YA 4B1ZA 4JWDA 2YHYA 4A5AA 4FWLA 5F0XA 3H0XA 3O9UA 1LOTB 2QWOA 2QWNA 2FXUA 3T47A 1K8KA 3MN9A 3W0LA 1U2VA 2Q31A 1VQ4N 4BRKA 5AQVA 5CE3A 3ATUA 1O13A 4HY9A 3MX2A 4WFBL 1RGIA 2P9UB 1MWMA 2RT6A 5AQLA 2FSNA 1NWKA 3TSQA 4GV9A 4DHYA 3L0QA 5GINA 5C2FA 2HMPA 1Z05A 4PKIA 5AFUA 2BTFA 4MO4A 3G71N 1ATSA 1QZ5A 2QWPA 4R5LA 3T4AG 2KKZA 2OANA 2ZGZA 5JVGL 3KDRA 3CD6N 1SU6A 3HTVA 2YJEA 3IMXA 5KPRA 4EZNA 1S72N 3CF5L 3L4IA 2A3ZA 2Q0RA 2HF3A 4FWNA 3W3DA 2CGLA 5BR9A 1HKGA 3RV1A 4I6MB 2IIRA 2IVOA 2VWBA 2W40A 4H6HA 1YJWN 3CMEN 3B8AX 2KLAA 1HKBA 4PL8A 3SK3A 4IO8A 4OO1J 1ILYA 2NRXA 1KAXA 4C1NI 3E9PA 3C7NA 1HJOA 4FVUA 5FLEX 4WCEL 2PY6A 3ZEUA 3SAGA 2PBDA 3CMAN 1ESVA 1W97L 3A5NC 4JKHA 5BREA 5LJWA 5FPNA 3VERA 1EO1A 5JICA 1OVYA 3J7ZO 1YJNN 4BREA 3VEZA 1U2VB 2GA9D 3CJ9A 1K73O 3VTHA 2P9LB 1HX1A 3EZWA 5DM7L 4FO0A 2CGJA 2OTLN 2HOEA 3T7ZA 1X3MA 4H03B 3P38A 4KIKA 1GNTA 3P31A 4BR7A 4YDUC 1GLJO 3CCJN 4EZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GEM A;  1GLB G;  7HSC A;  3FGU A;  4A2B A;  2IVN A;  1BA0 A;  3VEO A;  1YAG A;  3QBW A;  4JD2 A;  5BPM A;  3GL1 A;  2E2P A;  2E1Z A;  2QWM A;  1ZBS A;  2FSK A;  3BF1 A;  4AM6 A;  2E2N A;  4FWS A;  1BWF O;  2NLX A;  4FWK A;  3EO3 A;  1J6Z A;  3HZ6 A;  3QFU A;  5AQW A;  3VGL A;  3LDO A;  1DKX A;  1EQY A;  2YCH A;  3U9Z A;  4B1Y B;  4K43 A;  2QWL A;  5AQG A;  3C7N B;  1T44 A;  3DXM B;  2FSJ A;  2A41 A;  2FF6 A;  2QWR A;  4XH4 A;  4HYB A;  4AM7 A;  4CBX A;  4EZR A;  3R8E A;  3M6G A;  2AA4 A;  4R5J A;  4WQ4 A;  5KQ8 A;  1BPR A;  4JAX A;  4M7X A;  4BRP A;  4F9O A;  3A5M C;  3A0I X;  4JHD A;  1HKC A;  3CHW A;  4CZE A;  3KZB A;  5EVZ A;  2PAV A;  1DEJ A;  3WQT A;  3VF2 A;  3D2E B;  1G99 A;  4H0T B;  4M63 C;  1QZ6 A;  4CZL A;  1YVN A;  3GOI A;  3H6E A;  3SJH A;  3VF4 A;  1U00 A;  1GLC G;  3IFR A;  3ZET A;  3WUH A;  4JD2 B;  5LY3 A;  4BG8 A;  2GTD A;  3VES A;  4CBU A;  3WXJ A;  1KXP A;  4JWI A;  4H5R A;  2P9K A;  2IVP A;  2WIN M;  1GLL O;  1NGA A;  4FL9 A;  1BG3 A;  4HWI A;  4H0X B;  4EFH A;  3F9M A;  3BP8 A;  1CZA N;  4IXC A;  2V7Y A;  5JLH A;  3DAW A;  2P9N A;  2HF4 A;  3FLC O;  1E4F T;  2VCP A;  3MN6 A;  3A8Y A;  1V4S A;  2Q2R A;  4A62 A;  4E81 A;  3GG4 A;  4EZV A;  1MWK A;  4BR4 A;  1T6D A;  2D0P A;  4BGB A;  2UYT A;  2WUS A;  4MLE A;  4EZS A;  5AQU A;  1BA1 A;  2ASO A;  4BC3 A;  1NM1 A;  4F00 A;  3VPZ A;  4R5G A;  3BF3 A;  3FR0 A;  4XH1 A;  4H6I A;  2GUP A;  3H3O B;  3CQX A;  2QW9 A;  4BGA A;  1BUP A;  5AQX A;  2F9T A;  3O1B A;  4WV5 A;  3ZET B;  4CZH A;  5KQD A;  4E1J A;  4BRI A;  3G25 A;  4WQ4 C;  2BPR A;  4PO2 A;  2GWJ A;  1DG4 A;  4FSV A;  4BRA A;  5F2R A;  3H1V X;  1P8Z A;  3N8E A;  1BO5 O;  3KVG A;  5AFU H;  3MN5 A;  5AZJ A;  3TU5 A;  3UB5 A;  4BRN A;  1NGC A;  2VYP A;  3SMS A;  3LDP A;  2P9N B;  4L3Q A;  2A5X A;  1NGE A;  1YXQ A;  3CQY A;  3WXK A;  4B1W B;  4CJ7 A;  4NB4 A;  3U9D A;  3L6Q A;  4ISF A;  1JCG A;  5JLF A;  4EAH D;  3OHX M;  4EHT A;  3T49 A;  3O80 A;  4ISE A;  4DCH A;  3GDQ A;  1NGJ A;  2E1Y A;  3QBX A;  4FWP A;  1T6C A;  4RCH A;  4WYB A;  4FWO A;  4EZQ A;  1SQK A;  1K8K B;  3RSE A;  3H3N O;  3WEE A;  1Q18 A;  3J8A A;  3O5B A;  3O08 A;  4BQL A;  5BN9 A;  3DJC A;  4R5K A;  2E20 A;  3EKS A;  4FPA A;  3O4W A;  3WQU A;  3GBT A;  4XH5 A;  1GLA G;  4K42 A;  4BC2 A;  3HI0 A;  4IWV A;  2BUP A;  4Y0W A;  3VEY A;  3FFK B;  1YUW A;  2P9S A;  4BVP A;  3T46 A;  1NMD A;  1MA9 B;  3I8B A;  3FZH A;  1TUU A;  5ADX A;  4DB3 A;  2V7Z A;  4CZJ A;  3CER A;  1BDG A;  3OHR A;  3VEV A;  4EZT A;  4A2A A;  4H0V B;  3UE5 A;  3C0B A;  2Q0U A;  3D2F A;  1XC3 A;  4B9Q A;  1BOT O;  3JS6 A;  4FWM A;  1BU6 O;  2W41 A;  3ZEU B;  3L3O M;  4BRL A;  4BR2 A;  3CET A;  3JXU A;  4CBW A;  4GY2 B;  3WT0 A;  4CZM A;  4H0O A;  4PKG A;  3RSE B;  4H5N A;  3WEE B;  5BN8 A;  3ID8 A;  3A5L C;  4BQZ A;  1GLF O;  1DKZ A;  2ASP A;  4B1U B;  5I9E B;  3FZK A;  3S41 A;  1DKG D;  2YHW A;  4EZO A;  3WXI A;  2D0O A;  2QWQ A;  3MDQ A;  3D7E O;  1NLV A;  3DXK A;  2NRH A;  3LDN A;  1R59 O;  2P9P A;  3DWL A;  5AQO A;  2FLO A;  1NGD A;  3CJA A;  4XEI A;  4CD1 A;  4FWQ A;  5EX5 A;  4ISG A;  3O6W A;  4IJA A;  2Q36 A;  4WQ5 A;  3MK6 A;  4PL7 A;  5TKY A;  4QS7 A;  2ZWH A;  2FF3 B;  4H5V A;  3VF6 A;  3ULE A;  4BRQ A;  4EZP A;  1D4X A;  1U6Z A;  5AQF A;  2J4R A;  2Q97 A;  3HSC A;  4KBO A;  1ATN A;  1E4G T;  4FOI A;  3CI5 A;  3TPQ A;  3O1W A;  2H3G X;  5AQQ A;  4EIA A;  3A5O C;  4CZI A;  1Y64 A;  4JHD B;  3KHY A;  1SZ2 A;  4IZ9 A;  3ENH A;  3DXK B;  4BC5 A;  3WXL A;  3CJ7 A;  2I7P A;  4MLH A;  4H5T A;  4I6M A;  2A42 A;  2ZF5 O;  1RFQ A;  1WUA A;  1XUP O;  4YDU A;  1ATR A;  2QM1 A;  5AZI A;  5AQZ A;  2D4W A;  2P9K B;  2OP6 A;  4NO7 A;  3VGK A;  3DPO A;  2A40 A;  3FZF A;  4BR0 A;  5B8H A;  1C0F A;  4QS8 A;  1C0G A;  5AR0 A;  5AQJ A;  5EY4 A;  3ULE B;  4BRG A;  2YI1 A;  1TYQ A;  2ASM A;  2CH5 A;  3R9P A;  3VGM A;  2I7N A;  3CJC A;  2P9I A;  3EKU A;  2P9L A;  4R5I A;  4C23 A;  3MCP A;  3ATV A;  3HBT A;  1TUY A;  3IDH A;  1ZC6 A;  5AQN A;  1IG8 A;  4BRD A;  3O8M A;  2A6A A;  4IJN A;  4EZY A;  3CJB A;  5AQM A;  4MO5 A;  5AQP A;  2DPN A;  3IUC A;  2QFF A;  3AY9 A;  3MN7 A;  4WQ5 C;  5AQI A;  3ZX3 A;  1GLD G;  1MDU B;  1IJJ A;  3LDL A;  1H1V A;  3M1F A;  3CJ1 A;  5JMV A;  3P4I A;  4CI6 A;  3VEN A;  4O8K A;  2E2O A;  2E8A A;  3U4L A;  1S3X A;  4RWT A;  4QS9 A;  3UKR A;  4EZX A;  4J8F A;  1LCU A;  5AZI B;  3DXM A;  1V4T A;  4PKH A;  4BC4 A;  5BPL A;  4CD3 A;  1OKJ A;  3MMV A;  4FWR A;  4Z94 A;  4JN4 A;  3FZM A;  1NGG A;  4K41 A;  1TYQ B;  5AZJ B;  3ZX0 A;  4BRM A;  2F9W A;  3UKU A;  2YJF A;  4BRC A;  1X3N A;  2ZGY A;  5ADX H;  4K25 A;  2P9I B;  3T48 A;  1QQN A;  3LL3 A;  1NGB A;  2QXL A;  5EXW A;  4A61 A;  1HUX A;  3AAQ A;  5EOY A;  3VEW A;  5KPZ A;  2KHO A;  5AQY A;  4BG9 A;  3CIP A;  3ENO A;  1NGI A;  5KPT A;  5AQK A;  4BRO A;  3D2E A;  1ZXO A;  2D1K A;  5ELZ A;  4B1X B;  4RTF D;  3QIC A;  4CZK A;  3AAR A;  5BRF A;  4H0Y B;  3BUZ B;  4JNE A;  4FPB A;  1JCE A;  3HM8 A;  5AQR A;  4JWC A;  3SMP A;  3VEX A;  3GE1 A;  4WV7 A;  5E84 A;  2E2Q A;  3SLC A;  5AQT A;  4LC9 B;  1QHA A;  1X9J A;  3UKR B;  5BPN A;  1Z6R A;  2AP1 A;  1DKY A;  5FPD A;  2P9S B;  1KAY A;  4H0P A;  3FZL A;  5LJV A;  4BVO A;  3BEX A;  3DPP A;  3EL2 A;  3LDQ A;  5E26 A;  2CGK A;  4EZZ A;  5AQS A;  4CZG A;  4O5F A;  3UKU B;  1S22 A;  4EHU A;  3M3Z A;  3QML A;  1NBW A;  4BRH A;  4F01 A;  3D2F B;  1JCF A;  3U8X A;  5FPE A;  3QB0 A;  5AQH A;  4JWE A;  1RDW X;  3EN9 A;  3LM9 A;  4FOE A;  3QDK A;  2Q1N A;  3H46 O;  1NGF A;  2ITM A;  4EZW A;  2P9U A;  2V51 B;  1SAZ A;  2GEL A;  1HPM A;  3R6M A;  1CKR A;  5BRD A;  5BRH A;  5F1X A;  3DPQ A;  3LM2 A;  2E88 A;  4BR9 A;  2GWK A;  3AAP A;  1Q5L A;  3DQG A;  1DGK N;  2V52 B;  1QQM A;  1NGH A;  4HTL A;  4BR5 A;  2EWS A;  1HLU A;  2P9P B;  3H1Q A;  4CZF A;  1KAZ A;  3ZX2 A;  1WOQ A;  4B1V A;  3QNJ A;  3H45 C;  4BRF A;  2NZT A;  2CH6 A;  4DQ8 A;  3I33 A;  5FPM A;  3FE1 A;  4GNI A;  4H5W A;  3DOB A;  3VET A;  3QFP A;  2YHX A;  3VOV A;  4JNF A;  1XQS C;  1GLE G;  1QQO A;  4B1Z A;  4M7Y A;  4JWD A;  2YHY A;  4FWL A;  5F0X A;  3H0X A;  1LOT B;  2QWO A;  2QWN A;  2FXU A;  3T47 A;  1K8K A;  3MN9 A;  3W0L A;  1U2V A;  2Q31 A;  4BRK A;  5AQV A;  5CE3 A;  3ATU A;  4HY9 A;  1RGI A;  2P9U B;  1MWM A;  5AQL A;  2FSN A;  1NWK A;  4DHY A;  3L0Q A;  2HMP A;  1Z05 A;  4PKI A;  5AFU A;  2BTF A;  4MO4 A;  1ATS A;  1QZ5 A;  2QWP A;  4R5L A;  3T4A G;  2ZGZ A;  2OAN A;  3HTV A;  2YJE A;  3IMX A;  5KPR A;  4EZN A;  3L4I A;  2A3Z A;  2Q0R A;  2HF3 A;  4FWN A;  3W3D A;  2CGL A;  5BR9 A;  1HKG A;  4I6M B;  2VWB A;  2IIR A;  2IVO A;  2W40 A;  4H6H A;  3B8A X;  4PL8 A;  1HKB A;  3SK3 A;  4IO8 A;  1KAX A;  3C7N A;  1HJO A;  3ZEU A;  2PBD A;  1ESV A;  3A5N C;  5BRE A;  5LJW A;  5FPN A;  3VER A;  5JIC A;  4BRE A;  3VEZ A;  1U2V B;  3CJ9 A;  2P9L B;  1HX1 A;  3EZW A;  4FO0 A;  2CGJ A;  2HOE A;  1X3M A;  4H03 B;  4BR7 A;  4YDU C;  1GLJ O;  4EZU A; 
#chains in the Genus database with same CATH topology
 5CR4 A;  4M3R A;  4A2B A;  4YOY A;  3VEO A;  2WFB A;  2A1R A;  3DYT A;  3QBW A;  2F1B A;  2UUC K;  4IFV A;  1RBV A;  3KD1 E;  1ZBS A;  3KKS A;  1Q8I A;  3EO3 A;  2MI7 A;  1DKX A;  4K43 A;  3DM2 A;  3I8D A;  3C7N B;  1T44 A;  4LF4 K;  2Z1J A;  1S1T A;  2FF6 A;  2QWR A;  4LY7 A;  4CJP A;  4QAG A;  4AM7 A;  4HYB A;  4JYA K;  4OKK A;  4YOW A;  5KRS A;  4AZG A;  4JI2 K;  2IOC A;  3HAI A;  4YOV A;  4JAX A;  4M7X A;  4F9O A;  4OX9 K;  3BGR A;  1HNV A;  1K9M O;  3A0I X;  1QWU A;  1VSH A;  4UQG A;  4CZE A;  3MED A;  3KAW A;  4CF0 A;  1A5W A;  1DTQ A;  4CJ4 A;  1R5E A;  3VQQ A;  4AIL C;  3CKD A;  3S3N A;  4HVJ A;  4WPE A;  4M63 C;  1QZ6 A;  4CZL A;  3SJH A;  3VF4 A;  3ZSQ A;  4LFC K;  5I42 A;  3ZET A;  1RBR A;  4JD2 B;  5DK5 A;  3V9W A;  1C1C A;  4NLC A;  2GTD A;  3NVM A;  4JWI A;  2P9K A;  1HYV A;  3SAF A;  5KGW A;  1REV A;  4FL9 A;  5HRN A;  1JXE A;  1OA1 A;  1JLF A;  1CZA N;  1QSS A;  1N36 K;  4I9Q A;  5JLH A;  1JJ2 M;  3O3M B;  2YNF A;  2Y1I A;  1XHZ A;  3B52 X;  2KZM A;  4CEQ A;  3MN6 A;  4FLU A;  4A62 A;  4E81 A;  3QA8 A;  1E9V A;  3G10 A;  4R5P A;  1D5A A;  4PUO A;  2O8B A;  4EZS A;  5AQU A;  5FRM A;  1JLB A;  2ASO A;  3THY A;  1RIL A;  4R5G A;  2HBK A;  3U6F A;  1HQE A;  1QQC A;  2UXD K;  1WSF A;  3LWL A;  3CQX A;  2QW9 A;  2XO7 A;  4ZTF A;  2F9T A;  4DV3 K;  4DTS A;  4WFN L;  1M1K O;  3KLE A;  1XNQ K;  4BRI A;  3Q7B A;  3WNG A;  2ZJR L;  3AO5 A;  1S6Q A;  4JI3 K;  1VQ9 N;  3R3L A;  3NGI A;  1WSE A;  1P8Z A;  4OJR A;  4RW8 A;  1BO5 O;  2B4J A;  5AFU H;  4FLW A;  2IAJ A;  1YVU A;  5AZJ A;  4O8U A;  4BRN A;  4DS4 A;  3SMS A;  4CHP A;  4ATM A;  3L2W A;  1JLC A;  3CQY A;  4HUE A;  4CJ7 A;  4AH9 A;  4CHQ A;  2UXB K;  2FBX A;  2RE2 A;  5SZT A;  4O0I A;  2F8S A;  4NCA A;  1VK0 A;  1FXX A;  3T49 A;  4ISE A;  3SCX A;  4FLY A;  4JL9 A;  4B9S A;  1NGJ A;  2FBV A;  4JI6 K;  3NHG A;  1I49 A;  4WYB A;  1K8K B;  3RSE A;  3WEE A;  1WSH A;  4B3S K;  4N47 A;  2G8I A;  4IG0 A;  4D8J A;  1JLE A;  1MU2 A;  3DJC A;  4FJ7 A;  3GBT A;  4K42 A;  5JVH L;  3QEP A;  4YY3 K;  4Y0W A;  3V1Q A;  2HNZ A;  3FFK B;  4E72 A;  1NMD A;  4BAC A;  3I8B A;  4FJI A;  3FZH A;  1JXB A;  5ADX A;  4CGH A;  1IKY A;  3R1X A;  3CER A;  5CY4 A;  1OAO A;  4I2P A;  3O4Q A;  3OK8 A;  4CCH A;  3O3O B;  2WYH A;  3O9Q A;  2W6K A;  1XC3 A;  2W6L A;  4B9Q A;  2O4I A;  2KFN A;  4JKB A;  2Z1H A;  3KAV A;  1BHL A;  3ZEU B;  3LPT A;  4BR2 A;  3CET A;  4CBW A;  3GI7 A;  1RT6 A;  4CZM A;  3G9G A;  2IGI A;  3MXM A;  1FKO A;  4M3W A;  5C25 A;  4FZY A;  1QVF M;  5J2Q A;  3S41 A;  3LZJ A;  4EP5 A;  2PYL A;  3MDQ A;  3DXK A;  2LXY A;  3P83 D;  2I5J A;  1S1V A;  5AQO A;  4FCY A;  2QI2 A;  4A57 A;  3AO2 A;  4IDK A;  4CD1 A;  4FWQ A;  5EX5 A;  2QXF A;  4R79 A;  1RDA A;  2Q36 A;  1VQ6 N;  1JLG A;  4OKE A;  4PL7 A;  1TGO A;  3ZYY X;  4JV5 K;  2Y1J A;  2G8W A;  2WC9 A;  3ER8 C;  4IBN A;  2JLE A;  3HAH A;  3ULE A;  1D4X A;  4CEO A;  2J4R A;  3O9S A;  1JQK A;  3ERC C;  4DF8 A;  2PMR A;  3L2U A;  3LPU A;  3RR8 A;  5AQQ A;  4B9V A;  4DKW A;  5M1Q A;  3OBW A;  3PV8 A;  4DV0 K;  2NRR A;  3KHY A;  4W5T A;  3NH1 A;  1HNX K;  3ENH A;  3E9O A;  4OPJ A;  3U3G A;  2JNS A;  4KO0 A;  3Q84 A;  4H5T A;  2WYI A;  2ZF5 O;  1XUP O;  1ATR A;  2P9K B;  4FM0 A;  1UOC A;  1UPX A;  5B8H A;  4QS8 A;  5AR0 A;  5AQJ A;  4CEC A;  3DDF A;  4TSX A;  3M8P A;  1XWL A;  2CH5 A;  5BR8 K;  3R9P A;  4DTR A;  2YHB A;  1WSI A;  3EKU A;  2PZS A;  4IO9 L;  3ATV A;  3WXM B;  2RAK A;  4FJM A;  3T1Y K;  4QCL A;  3O8M A;  2A6A A;  2HST A;  4CJQ A;  4MO5 A;  4DWI A;  3D4Z A;  4G1Q A;  1F21 A;  3RMA A;  4CGI A;  4ZHR A;  3SBT A;  1EKE A;  3CJ1 A;  4AHS A;  4V19 S;  2XRI A;  3DOK A;  2ND1 A;  1N32 K;  4LF8 K;  2IS3 A;  4CES A;  2ND0 A;  4O4G A;  3AVK A;  1EWR A;  3KLI A;  4DTP A;  2XHB A;  2HND A;  5KI6 A;  3UKR A;  5J2N A;  1LCU A;  5AZI B;  3NFA A;  1W0H A;  2ELB A;  4PKH A;  3RV0 A;  5HRO A;  3MMV A;  1NGG A;  3PX0 A;  4FZX C;  4DQQ A;  2NCZ A;  4K41 A;  1TYQ B;  5AZJ B;  1OH8 A;  4IM2 A;  2UUA K;  3OYM A;  4FJX A;  2ZGY A;  3KWI A;  4CK2 A;  3ALY A;  1Y2O A;  1HYZ A;  1Z26 A;  1NGB A;  4Z4H A;  4DLG A;  5EOY A;  4KRE A;  2KHO A;  3DX2 A;  4KH4 A;  4ILG A;  4DTX A;  3D2E A;  1ZXO A;  5ELZ A;  1S1X A;  2ZJQ L;  3AO4 A;  5BRF A;  1QE1 A;  2WBN A;  3D52 A;  1L3V A;  4KTW A;  2G8H A;  4KHW A;  3HM8 A;  4BEB A;  1VSM A;  3OYE A;  2FBY A;  3BY5 A;  2NNW A;  1FJG K;  4BEC A;  3CFP A;  5AQT A;  4LC9 B;  1YJ9 N;  1NK8 A;  5BPN A;  1VQ5 N;  2F7O A;  3RPM A;  1TAU A;  5GAE P;  4O55 A;  3K5M A;  4BVO A;  1LW0 A;  4JK7 A;  3C6T A;  3SV3 A;  4NQI A;  4JS4 A;  1D9D A;  1NK4 A;  2YI8 A;  3QML A;  2NRT A;  1D8Y A;  4F01 A;  4DV7 K;  4DTM A;  4JWE A;  1RDW X;  3EN9 A;  2Q12 A;  4WFA L;  2ETJ A;  3QDK A;  3RRG A;  3H46 O;  4DU1 A;  4CF8 A;  2OBM A;  1C0M A;  3OS0 A;  3TAB A;  4EZW A;  2P9U A;  2V51 B;  1SAZ A;  4J2B A;  2DFE A;  2O0I 1;  5BRD A;  1RTD A;  5F1X A;  3I04 A;  3MXI A;  1NNE A;  3D0P A;  4BR9 A;  4NYF A;  3THW A;  1HWW A;  4DSK A;  5FRN A;  1QQM A;  4DR6 K;  3H1Q A;  3PIP L;  1KAZ A;  3EEQ A;  1WOQ A;  3H45 C;  4B8C A;  4CJW A;  3CPE A;  1VSK A;  4GNI A;  4H5W A;  3VTI A;  5LMN K;  1YHQ N;  5C24 A;  1RTH A;  2Z0O A;  1QQO A;  1KFS A;  3DMJ A;  5C5B A;  4FWL A;  1ITG A;  3O9U A;  1U2V A;  2Q31 A;  3BVV A;  1RDD A;  1SKW A;  1NKB A;  3MX2 A;  4HY9 A;  4WFB L;  2V0O A;  1KLN A;  1RGI A;  4CJ3 A;  2HHH K;  3TSQ A;  5GIN A;  1LQ7 A;  2KW4 A;  1R33 A;  3HP6 A;  3G71 N;  1ATS A;  1QZ5 A;  2OAN A;  4DR7 K;  4HTU A;  3MEC A;  3LP1 A;  3IMX A;  1ASW A;  3L4I A;  5BR9 A;  1HKG A;  3ZSR A;  4WPC A;  4KB0 A;  4BNE A;  4RG8 A;  1EX4 A;  1KAX A;  4C1N I;  3E9P A;  3C7N A;  4FK0 A;  2PY6 A;  3CMA N;  5BRE A;  3KLH A;  1VSJ A;  4BRE A;  1J5E K;  3VQD A;  2Z1G A;  2GA9 D;  3CJ9 A;  1TK5 A;  2E6M A;  3EZW A;  4FO0 A;  1ZBI A;  3CQ8 A;  3HYF A;  3DRR A;  2GEM A;  1GLB G;  4JI0 K;  3TI0 A;  4PHT X;  1LV5 A;  1BA0 A;  1RBS A;  2E4L A;  3HST B;  3FFI A;  3OYC A;  1YAG A;  2EFK A;  4JD2 A;  2QTD A;  3QNN A;  2E2P A;  4FK4 A;  2FSK A;  4AM6 A;  5CHI A;  4B9L A;  4KHS A;  1BWF O;  2IC3 A;  2NLX A;  4FWK A;  3UIT A;  4JKC A;  1J6Z A;  5AQW A;  4FJ5 A;  4FXD A;  3LDO A;  1T8E A;  2YCH A;  4B1Y B;  3JSM A;  2QWL A;  2ZQB A;  5HOO A;  4E3C A;  2DTU A;  1QHT A;  2HB5 A;  1HMV A;  3M6G A;  4O44 A;  4H8K A;  4R5J A;  4DS5 A;  4BRP A;  3A5M C;  4FJ9 A;  2O8C B;  1I3A A;  1WAJ A;  4JHD A;  4NLB A;  3CHW A;  4W5N A;  4FLT A;  2PAV A;  4IWO A;  1VQ8 N;  4E1N A;  2YX6 A;  2OCE A;  2VGN A;  3D2E B;  1VSD A;  3GOI A;  3H6E A;  4HHT A;  1U00 A;  1GLC G;  1L3S A;  4DV2 K;  1QWN A;  4G6Q A;  4BG8 A;  1HTY A;  3VES A;  3WXJ A;  1GLL O;  1NGA A;  4F4K A;  1BG3 A;  4ELU A;  2R7Y A;  3NF7 A;  4IXC A;  2V7Y A;  1GN9 A;  1TVR A;  1CZ9 A;  4X62 K;  1TQS A;  5JEN A;  2HF4 A;  3I55 N;  2DY4 A;  3EJU A;  3FLC O;  4KHN A;  3L2Q A;  2Q2R A;  3GG4 A;  4EZV A;  4BR4 A;  1IKX A;  3NAE A;  3CCL N;  3VQC A;  3PX4 A;  4GVE A;  2UYT A;  2WUS A;  3QEW A;  2YL8 A;  3DYA A;  1BA1 A;  2D1L A;  3DLK A;  1NM1 A;  4BC3 A;  3I2W A;  3H3O B;  2D0B A;  4B08 A;  1M90 O;  1JLQ A;  3S5T A;  1FK9 A;  3T69 A;  4CZH A;  4WE1 A;  5KQD A;  3LAL A;  5I3U A;  5HLF A;  4WQ4 C;  2BPR A;  1W9M A;  2OPS A;  4DMN A;  3QE6 A;  1DG4 A;  5M1N A;  1TAQ A;  4BRA A;  4E1M A;  3WNF A;  3H1V X;  4FZS A;  3TAQ A;  3N8E A;  4E7L A;  4UY8 O;  4JKD A;  4HCC A;  1T05 A;  4MQ3 A;  4AHV A;  1NGC A;  2VYP A;  2P9N B;  2A5X A;  2PFU A;  1R0A A;  3TSU A;  4B1W B;  3AO3 A;  3U9D A;  3I0S A;  2ZE2 A;  5JLF A;  4DV6 K;  4YFU A;  4HUF A;  3QIO A;  5JS1 A;  3B6P A;  3O80 A;  1IV0 A;  4ID5 A;  4DCH A;  1VQL N;  5C5B B;  2HBL A;  2E1Y A;  1U4B A;  3QBX A;  1HNW K;  4AHR A;  1T6C A;  1VRU A;  4F3T A;  1SQK A;  3K5O A;  3HPH A;  2YI9 A;  2D0A A;  2GV9 A;  5M1P A;  5BN9 A;  2HBJ A;  2E20 A;  4FM2 A;  3CCE N;  4CHY A;  3H08 A;  4FJ8 A;  3NDK A;  3LZI A;  2BUP A;  4A59 A;  5GAG P;  4BVP A;  4CER A;  3S3O A;  4KB1 A;  4NXN K;  2JWL A;  1BQM A;  1TUU A;  2V7Z A;  4CZJ A;  4F8R A;  4CIE A;  1FW6 A;  3HK2 A;  4EZT A;  1WBB A;  3QER A;  4YOR A;  3N4P A;  1OH7 A;  4NSW A;  3CAZ A;  3D2F A;  1LAV A;  2HVI A;  2XY7 A;  3ENB A;  4FWM A;  2OZS A;  1BU6 O;  1X03 A;  5JS2 A;  3JXU A;  4GY2 B;  3WT0 A;  4C1N K;  4H5N A;  5BN8 A;  1XMQ K;  1TKD A;  2NRZ A;  3OJU A;  3AVB A;  1SKS A;  3C6A A;  1DKZ A;  1ZBL A;  2ASP A;  4B1U B;  4Z0U A;  3RR7 A;  2YHW A;  1J9A A;  4L8R B;  1RBU A;  3AO1 A;  2RN2 A;  1KTQ A;  3MWT A;  3D7E O;  1TV6 A;  3C6U A;  2P9P A;  3KLG A;  4K8Z A;  3CJA A;  1NGD A;  3J7A P;  2EWF A;  2LSN A;  1RTJ A;  3CM5 A;  4NCB A;  4CFB A;  1NK5 A;  4ILJ A;  4IJA A;  3CCS N;  4IM0 A;  3BVX A;  3EY1 A;  2HBM A;  4J2D A;  3BVW A;  4B9T A;  4LF6 K;  2YIB A;  1W7A A;  1SV5 A;  1I39 A;  4EZP A;  5AQF A;  2Q97 A;  3HSC A;  4KBO A;  2HHT A;  1E4G T;  3VQB A;  2W00 A;  3IS9 A;  4KI4 A;  3VQ6 A;  5KBP A;  1IBM K;  3HOS A;  3RRH A;  4EIA A;  3OYA A;  1Y64 A;  4B3R K;  4JHD B;  4FZZ A;  3QLH A;  4IZ9 A;  3BDP A;  3CV5 A;  4BC5 A;  4N41 A;  1N6Q A;  3HRG A;  3WXL A;  3CJ7 A;  4DG1 A;  3AGR A;  4DR4 K;  3V9S A;  1Z25 A;  1YF5 L;  1YTA A;  3NVK A;  1T03 A;  4OPH A;  4AVM A;  1WUA A;  3OBY A;  1R34 A;  1RT5 A;  1NK6 A;  4YDU A;  3U3Y A;  5AZI A;  1ASV A;  3G6E N;  1TL1 A;  4BR0 A;  1X9S A;  3QIP A;  1TQW A;  5GAH P;  2OYQ A;  1TYQ A;  1TQU A;  3JYT A;  1T7P A;  4C23 A;  1BIZ A;  2NUB A;  1K8A O;  3HBT A;  1TUY A;  3IDH A;  1IG9 A;  1ZC6 A;  4NCG A;  3DLR A;  1IG8 A;  3T1H K;  3MEG A;  4EZY A;  2GAF D;  5T7B A;  4AHT A;  2DPN A;  4WQ5 C;  3MN7 A;  3OTO K;  4W5O A;  3ZT4 A;  1MDU B;  1IJJ A;  1BQN A;  4AF1 A;  1H1V A;  3M1F A;  3V9X A;  1VQM N;  4WF9 L;  4CF2 A;  4DQR A;  1I4T A;  1Q7Y O;  4RWT A;  3DRS A;  1KVB A;  4EZX A;  1YIT N;  2OPR A;  3DXM A;  2YKN A;  1GNL A;  1BCO A;  4CD3 A;  3KLF A;  2RF2 A;  4B9U A;  1HR0 K;  2KZZ A;  4JK8 A;  4BWM A;  2N3K A;  1X3N A;  4BRC A;  5ADX H;  4I2Q A;  4K25 A;  3OS2 A;  2P9I B;  2X3W A;  1NJI O;  3K9J A;  4CED A;  1NK7 A;  5EXW A;  3F5T A;  4A61 A;  4U67 L;  3AAQ A;  1I94 K;  3EE9 A;  3O9T A;  3EJQ A;  3CIP A;  3ENO A;  1QSY A;  2ZD1 A;  3PUF A;  4X66 K;  3K5N A;  1S6P A;  4DU4 A;  2D1K A;  2O8D B;  4BDP A;  3AAR A;  3L2V A;  4H0Y B;  2OBL A;  2BE2 A;  4JEP A;  3BUZ B;  2W42 A;  3LLL A;  1NKE A;  3SPZ A;  3RMC A;  4DFM A;  4N56 A;  4BDY A;  5AQR A;  4KPY A;  3L3V A;  3GE1 A;  2O8F A;  3V9Z A;  5E84 A;  1X9J A;  1Z6R A;  2AP1 A;  4IOA L;  2VG7 A;  2PY5 A;  1KRP A;  4AZ5 A;  3OYL A;  4DSF A;  3HPG A;  4OVL A;  3TAN A;  3BEX A;  2RKI A;  4EZU A;  3PSI A;  4CZG A;  4FW2 A;  1VQP N;  1LW2 A;  4B3M K;  4DFJ A;  4GV3 A;  3SBS A;  2BDP A;  4DSE A;  3D2F B;  4HR1 B;  3QB0 A;  5AQH A;  3QO9 A;  3LM9 A;  1HPZ A;  1HNZ K;  2ITG A;  3BUD A;  3LAM A;  3CZN A;  2ITM A;  5C10 A;  4CJK A;  4LF7 K;  2GEL A;  3P5J A;  3TTF A;  1Q9X A;  3AVN A;  1HPM A;  2O4G A;  1CKR A;  1ZYQ A;  3I56 N;  2GWK A;  3OA9 A;  2JNK A;  2G8K A;  2V52 B;  4HTL A;  1NGH A;  3NMU A;  4BR5 A;  3OYG A;  1NOZ A;  1HLU A;  2P9P B;  4CZF A;  3RTV A;  1E3M A;  4B1V A;  3TTC A;  4BRF A;  3THX B;  2CH6 A;  4DQ8 A;  3PO4 A;  3I33 A;  3ISN C;  3N4Q A;  3OVN A;  3DOB A;  3VET A;  3QFP A;  2YHX A;  3VOV A;  4JNF A;  1VQO N;  4GMJ B;  2QK9 A;  3T1A A;  5FLX O;  4KTQ A;  2QWO A;  2FXU A;  3T47 A;  3E01 A;  5AQV A;  3OS1 A;  4Z4G A;  3TAG A;  4W5Q A;  3ATU A;  4B3O A;  3CFR A;  3SQ1 A;  2OO2 A;  2PYJ A;  3CVR A;  3TAM A;  5C2F A;  2O8E B;  3NF8 A;  2HMP A;  4E3S A;  1VSL A;  2BTF A;  2YKT A;  3DX3 A;  5J1E A;  4NXM K;  2ZGZ A;  3HTV A;  3OYJ A;  1S72 N;  3SQ4 A;  1QSL A;  2A3Z A;  3VA0 A;  2P51 A;  1U49 A;  2IIR A;  1YJW N;  2W40 A;  3CME N;  3SK3 A;  1HKB A;  2ATQ A;  4IO8 A;  4E7H A;  5FLE X;  3O3H A;  4CGJ A;  1ESV A;  2OZN B;  5LJW A;  1EO1 A;  4M3Y A;  2DFH A;  4CJS A;  3M8S A;  1K73 O;  2O8C A;  4FVM A;  1HX1 A;  3TAE A;  1OH5 A;  2OTL N;  2HOE A;  3P38 A;  1GNT A;  3M8Q A;  1EET A;  4YDU C;  1GOA A;  3QIN A;  2Z0V A;  7HSC A;  1DLO A;  1TL3 A;  3OYI A;  3FGU A;  4GVM A;  2YKM A;  1Q82 O;  3GL1 A;  5CYM A;  4IOC L;  3HP9 A;  2E1Z A;  2QWM A;  4AZH A;  1UWB A;  3BF1 A;  4CEA A;  5SWM A;  1MJG A;  3VGL A;  3QFU A;  1HJR A;  1UA1 A;  2OZM A;  3WNE A;  2OW6 A;  3DXM B;  4EZ6 A;  2FSJ A;  5HRR A;  4EZR A;  1SUQ A;  2AA4 A;  3C6H A;  3V6D A;  4WQ4 A;  5KQ8 A;  3P39 A;  4AZ6 A;  3S9H A;  4I1Q A;  3QET A;  2G8U A;  5J2M A;  3BZC A;  1HKC A;  1N33 K;  4LF9 K;  4Q5V A;  4KIK B;  3EJP A;  3WQT A;  3CC2 N;  3VF2 A;  1BL3 A;  3AVJ A;  3ZSV A;  4C8K A;  4N5S A;  3NBP A;  4BE0 A;  1YVN A;  4DV1 K;  1C6V A;  1XHX A;  4M3Z A;  3IFR A;  4MQD A;  3WUH A;  3RMB A;  1UA0 A;  3LP3 A;  4CBU A;  3SQ2 A;  1KXP A;  2WON A;  4H5R A;  4DQP A;  2IVP A;  1G15 A;  2O8F B;  4FJK A;  1UAX A;  4LFB K;  4HWI A;  3MWP A;  1NG9 A;  3F9M A;  4Y1C A;  1S1W A;  3CC4 N;  1OH6 A;  4M0M A;  4RW4 A;  4M3X A;  2P9N A;  3RVC A;  3EZ5 A;  3B51 X;  1X1P A;  2Q13 A;  4BWJ A;  1E4F T;  1SKR A;  3NH2 A;  3DX1 A;  3CXC M;  1V4S A;  3LAN A;  4JRQ A;  1RTI A;  5J2P A;  4LFA K;  2D0P A;  3S3M A;  4FLX A;  4MLE A;  1E2U A;  4AZI A;  2VG5 A;  3VPZ A;  4F00 A;  4CJF A;  2Z1I A;  3HVR A;  3CG7 A;  3FR0 A;  2GUP A;  3OYB A;  2D4C A;  5AQX A;  3CYM A;  2P5G A;  3O1B A;  4E7J A;  4CJ5 A;  3ZT3 A;  4FZP A;  1NU0 A;  4KFB A;  3BLB A;  4CFA A;  4PO2 A;  2GWJ A;  4C8L A;  4FSV A;  3ABH A;  1QVG M;  5F2R A;  2FC0 A;  2JGU A;  3KVG A;  3FD9 A;  3TU5 A;  3UB5 A;  3A98 A;  4UDY X;  3SPY A;  4LSL A;  2GUI A;  1NGE A;  1YXQ A;  2EX3 A;  3WXK A;  3CZS A;  3L6Q A;  4ISF A;  4J2E A;  4EHT A;  5FIG A;  2OPP A;  3GDQ A;  4CHZ A;  4CIG A;  4RCH A;  3AVC A;  2KFZ A;  4EZQ A;  4JI8 K;  5GAD P;  5A2Q O;  5E41 A;  1Q18 A;  3J8A A;  3O5B A;  3O08 A;  4IM3 A;  3MCA B;  4ZTJ A;  4EZ9 A;  4BQL A;  5H1S Q;  4R5K A;  1X9W A;  3EKS A;  3WQU A;  4XH5 A;  5C12 A;  3HI0 A;  4IWV A;  3CCR N;  5GIP A;  1J54 A;  3VEY A;  2OW7 A;  2P9S A;  1MA9 B;  1NMN A;  1X9M A;  1BDG A;  3OHR A;  3TSP A;  3M8R A;  3KIO A;  4A2A A;  2FYV A;  3EE8 A;  4GKJ K;  3C0B A;  2X74 A;  4KTZ A;  3JS6 A;  4PA1 A;  3G0Z A;  3ZEF A;  4QOZ B;  1S5J A;  2P1J A;  4I7F A;  4KRF A;  3KWG A;  2QA4 N;  1J5O A;  3AVF A;  4BQZ A;  3J7Y P;  1U48 A;  1GLF O;  1Q9Y A;  5I9E B;  3FZK A;  4DV5 K;  1DKG D;  4CJE A;  3WXI A;  2GX9 A;  2QEX N;  4C8O A;  1RT7 A;  4X65 K;  1KFD A;  3ZSY A;  4AQY K;  2UUB K;  2NRH A;  1WSG A;  3C94 A;  2C1G A;  3L2R A;  1CXU A;  3AGK A;  2X3V A;  4KH5 A;  3PO5 A;  4HUG A;  4O0J A;  4ISG A;  4WQ5 A;  2HMI A;  5TKY A;  1L3U A;  4ELT A;  2ZWH A;  3F73 A;  2ZJP L;  3HPO A;  2RAI A;  4BRQ A;  4DTU A;  4CHN A;  1U6Z A;  4AHU A;  3VEB A;  4F2R A;  1WN7 A;  4FOI A;  1SU7 A;  3TPQ A;  1NKC A;  4FJN A;  2ZM6 K;  2F96 A;  2IDO A;  1B9F A;  2QKK A;  2XY6 A;  1A5X A;  3ASM A;  4K8X A;  2HHU A;  5IT9 O;  1SZ2 A;  2Z0N A;  2HHS A;  2EHG A;  4OLB A;  2KQ2 A;  3AVA A;  4DF4 A;  4MLH A;  4BE1 A;  1SU8 A;  3L8B A;  3ZLJ A;  3ACO A;  1NK0 A;  2A42 A;  4AZ7 A;  3IAY A;  1RFQ A;  2GBZ A;  5HL7 L;  2F7T A;  3SZ2 A;  4KHQ A;  2QM1 A;  3ZT1 A;  5AQZ A;  1RBT A;  2D4W A;  2WTU A;  4PQU A;  3ULD A;  3D51 A;  1LWE A;  3VGK A;  3DPO A;  2A40 A;  2C08 A;  4OKJ A;  1C0G A;  5EY4 A;  1SUF A;  3MEE A;  2YI1 A;  3AV9 A;  5M1O A;  3O9R A;  2P9I A;  2P9L A;  5C15 A;  1BI4 A;  3MCP A;  3TWH A;  2LM0 A;  1EXQ A;  4FJJ A;  4BRD A;  1RCH A;  1O7D B;  1VAZ A;  3SUN A;  5LL6 Z;  4JKE A;  3NCI A;  5AQP A;  1VQ7 N;  3IUC A;  2QFF A;  4FW1 A;  2O8D A;  3HAJ A;  4B9N A;  3AVM A;  2HHX A;  1RDC A;  3V1R A;  3LDL A;  3QWE A;  4AZC B;  4YOX A;  5JMV A;  3P4I A;  4CI6 A;  4LF5 K;  2E2O A;  2E8A A;  1XI1 A;  3U4L A;  5C42 A;  3D6R A;  1N5Y A;  4Z4C A;  4FJG A;  4QS9 A;  4JLH A;  4CIF A;  3PY8 A;  1EWQ A;  1V4T A;  3B6O A;  1O7D C;  4FWR A;  4JN4 A;  3FZM A;  3O3N B;  1KLM A;  1JLA A;  4BRM A;  2F9W A;  2YJF A;  1XMO K;  4IWP A;  2P5O A;  5HRS A;  3T48 A;  1QQN A;  1QS4 A;  3LL3 A;  4J2A A;  2EX3 B;  2YLA A;  1JL1 A;  1NJX A;  1HUX A;  1HXK A;  2QKW A;  4HR1 A;  3ER9 B;  4KI6 A;  5AQY A;  4BG9 A;  4IW0 A;  4DR1 K;  5KPT A;  4H4O A;  4KAZ A;  3DDG A;  4LSN A;  4B1X B;  4AHC A;  4RTF D;  4FZO A;  3QIC A;  3M3W A;  4CZK A;  2YLL A;  5HBM A;  2X6N A;  1LWF A;  3QEV A;  3ZSO A;  4KHU A;  3B53 X;  1QX1 A;  3OY9 A;  1NJZ A;  4DFP A;  1L5U A;  4ILI A;  3SMP A;  1QTM A;  3E1Y A;  2F4V K;  3BZK A;  4FVU A;  4E19 A;  4MDB A;  1VQK N;  1DKY A;  2GF4 A;  5DM6 L;  2P9S B;  5KTQ A;  1HQU A;  3VQ7 A;  3E9L A;  4FJL A;  3FZL A;  3NH0 A;  5LJV A;  3THX A;  4CF1 A;  3EL2 A;  4JKG B;  4EZZ A;  3DLH A;  1ZBU A;  4O5F A;  3UKU B;  1RT1 A;  1S22 A;  1HYS A;  3AA4 A;  3QES A;  1NBW A;  4X64 K;  3HL8 A;  1OA0 A;  3NF6 A;  1C0U A;  3ZSW A;  2FBT A;  3SUO A;  4FOE A;  4G9Z A;  1IKV A;  1LWC A;  1W2B M;  1W9H A;  4IEE A;  3OYF A;  2O8E A;  5BRH A;  3I39 X;  3ZED A;  3NF9 A;  4DLE A;  3DPQ A;  3LM2 A;  2E88 A;  3O4N A;  4CGG A;  5KRT A;  5C2D A;  3AAP A;  3AA2 A;  3DQG A;  5D3G A;  2EWS A;  3ZX2 A;  3VQE A;  4OGE A;  4BY9 C;  3QNJ A;  5LMU K;  5FPM A;  3KJV A;  4CEE A;  3FE1 A;  1NK9 A;  1WLJ A;  4JKF A;  4BE7 B;  1XQS C;  4B1Z A;  3KK7 A;  4M7Y A;  1C0T A;  4M42 A;  4A5A A;  3H0X A;  1LOT B;  2QWN A;  3TAP A;  4CEB A;  5CE3 A;  1MWM A;  5KGX A;  2RT6 A;  5AQL A;  3SV4 A;  3DLE A;  1NWK A;  5FDL A;  4CE9 A;  3L0Q A;  3EYZ A;  2F18 A;  4YNQ A;  4PKI A;  3KKR A;  5AFU A;  4MO4 A;  4PWD A;  2QWP A;  4C8M A;  4R5L A;  3F9K A;  5JVG L;  3CD6 N;  3DRP A;  1SL1 A;  3K5L A;  5KPR A;  4EZN A;  3CF5 L;  2Q0R A;  2CGL A;  3RV1 A;  2IVO A;  1B92 A;  3K2P A;  4DQS A;  4OO1 J;  2XY5 A;  3AVH A;  5IWA K;  4WCE L;  2PBD A;  1W97 L;  3A5N C;  4JKH A;  2F8T A;  3ZT2 A;  1IBK K;  3DLB A;  3LWM A;  1LAW A;  3VTH A;  2P9L B;  5AJ3 K;  3SYZ A;  3MXJ A;  1BI4 B;  5DM7 L;  2HW3 A;  4LD0 A;  2VWK A;  3T7Z A;  4KIK A;  4ICL A;  2X3X A;  4BR7 A;  1GLJ O;  1KCF A;  3C65 A;  3K58 A;  2YNH A;  2IVN A;  4M3U A;  1TQT A;  3EJS A;  1Q86 O;  5BPM A;  2OA8 A;  3BUQ A;  3DLG A;  3LAK A;  1KD1 O;  4CJT A;  2E2N A;  4FWS A;  4CHO A;  4IG3 A;  1J53 A;  3HZ6 A;  2FIC A;  1EQY A;  4DU3 A;  3U9Z A;  2UXC K;  1WNS A;  5AQG A;  3ITH A;  2ALW A;  1IH7 A;  5EU7 A;  4B8A B;  2A41 A;  2NRV A;  4XH4 A;  4CBX A;  3R8E A;  4KHP K;  1ZYL A;  3CCV N;  4CK3 A;  1BPR A;  4FYD A;  3QNI A;  2VWJ A;  1YIJ N;  1IO2 A;  2YNG A;  1JL2 A;  4FLV A;  4CFC A;  3K59 A;  3ZSX A;  4DR2 K;  1YTU A;  3KZB A;  1ZBF A;  3OYK A;  1TKZ A;  5EVZ A;  2YL6 A;  1DEJ A;  1HNI A;  4DR3 K;  4E89 A;  1VQN N;  1CXQ A;  1G99 A;  4I43 A;  4H0T B;  1VRT A;  2BH1 A;  3EJT A;  3QEI A;  4DSI A;  3VQ9 A;  4KH6 A;  3BVU A;  3AA5 X;  3CC7 N;  5LY3 A;  4E7I A;  3O3G A;  4I9L A;  2JWK A;  2YL5 A;  3OYD A;  2WIN M;  3NGY A;  3F2K A;  4H0X B;  4IOX A;  1XC9 A;  3CCM N;  2X78 A;  4EFH A;  2BGG A;  4ILH A;  3BP8 A;  4XJX A;  3L4Q A;  3CFO A;  4YHH K;  3DAW A;  4DQI A;  3D45 A;  3L3U A;  4CJR A;  4FM3 A;  3C95 A;  3WNH A;  1NJW A;  4B9M A;  4M41 A;  2VCP A;  3A8Y A;  1YWM A;  4LH4 A;  2XY8 A;  3MAQ A;  1MWK A;  3VMF B;  1T6D A;  4Q0B A;  2HHW A;  2KTQ A;  4FM1 A;  4BGB A;  5FRO A;  2X6S A;  3IRX A;  4ID1 A;  2D5R A;  1S9E A;  1TK0 A;  2Q3S A;  3BF3 A;  4IEI A;  3G4S N;  3NGZ A;  4XH1 A;  1EP4 A;  4H6I A;  4W5R A;  4BGA A;  4DUZ K;  2YIV X;  1BUP A;  5C0Y A;  4WV5 A;  3ZET B;  1I4D A;  4GV6 A;  4E1J A;  3G25 A;  4FJH A;  4N76 A;  1E1D A;  2WOM A;  4U7B A;  1SS6 A;  3Q7C A;  5CZ1 A;  1DTT A;  1BGX T;  4DCN C;  3MN5 A;  3Q0K A;  3LDP A;  4L3Q A;  4NB4 A;  3MX5 A;  4AZB A;  1NJY A;  1JCG A;  4EAH D;  1Y97 A;  3OHX M;  3ID6 A;  3OWG A;  2YHA A;  4MDA A;  4A5B A;  3ZT0 A;  3E66 A;  2O8B B;  4DTJ A;  4FWP A;  3K9K A;  3KK3 A;  4FWO A;  2YV0 X;  5M1F A;  3THY B;  1S9G A;  3TAR A;  3H3N O;  5K14 A;  2G8F A;  1GOC A;  3SOG A;  2NRW A;  4RW9 A;  3NE6 A;  1NOY A;  4FPA A;  3VQ4 A;  4M3T A;  1O1W A;  3O4W A;  4GKK K;  3RWU A;  2RHK A;  3LMF A;  2HHQ A;  1GLA G;  4BC2 A;  4F3O A;  1IBL K;  4JRP A;  3DX4 A;  1BIU A;  1YUW A;  3T46 A;  1K6Y A;  4DB3 A;  3K0S A;  3V9U A;  3VEV A;  3PLT A;  3V81 A;  3LDS A;  4CFD A;  2D0C A;  3VN5 A;  4F2S A;  3PSF A;  4H0V B;  3LP2 A;  3UE5 A;  2Q0U A;  2AJQ A;  1WAF A;  4DSJ A;  4JI7 K;  3O3F A;  3D4Y A;  1BOT O;  1RDU A;  3QEX A;  2W41 A;  4ELV A;  3L3O M;  4BRL A;  3SUP A;  3T3F A;  4K0K K;  4H0O A;  3SNN A;  4UDX X;  4PKG A;  3RSE B;  3WEE B;  3ID8 A;  3A5L C;  3SJJ A;  3SQ0 A;  3PLA A;  4RW7 A;  3J80 O;  1WSJ A;  5HP1 A;  4CW7 B;  3OYH A;  4DUY K;  4IKF A;  4EZO A;  4XIU A;  2D0O A;  2QWQ A;  5HRP A;  3KK1 A;  1NLV A;  3LDN A;  2EFL A;  1R59 O;  5M1K A;  3DWL A;  2FLO A;  4XEI A;  3KD5 E;  4C8N A;  3CCQ N;  1SL2 A;  3CPW M;  3ZCM A;  3O6W A;  4DTN A;  4JI5 K;  3MK6 A;  4QS7 A;  4H8S A;  1T3V A;  2FF3 B;  4H5V A;  3OW2 M;  3VF6 A;  3DI6 A;  4CEF A;  1XNR K;  1ATN A;  4DTO A;  4LH5 A;  3CI5 A;  2E6L A;  3LVT A;  3O1W A;  4CEZ A;  2H3G X;  3TR8 A;  4CJL A;  1FKP A;  3A5O C;  3VKH A;  4CZI A;  2VG6 A;  1B9D A;  4IFE A;  1X04 A;  2VQE K;  1C1A A;  2OTJ N;  1I4L A;  3BUB A;  3RMD A;  3DXK B;  3PX6 A;  3THV A;  2F7R A;  4AZC A;  2B5J A;  3DLL L;  1RT2 A;  2I7P A;  3SI6 A;  4JI1 K;  4I6M A;  4JLC A;  1TKT A;  3EJR A;  4E0D A;  1PS3 A;  3OJS A;  1ZBH A;  3SUQ A;  2YIA A;  2RAJ A;  2OP6 A;  4NO7 A;  3JAM O;  3FZF A;  1WBD A;  2OPQ A;  4NPH A;  1C0F A;  4DR5 K;  3HVT A;  4ILH B;  3ULE B;  4BRG A;  4IDH A;  5CYQ A;  1KSP A;  1A5V A;  2ASM A;  2C1I A;  3VGM A;  2I7N A;  3CJC A;  3SYV A;  1URU A;  1OVQ A;  4R5I A;  4MFB A;  3VQ8 A;  3HXM A;  1IKW A;  5AQN A;  4IJN A;  5AQM A;  3CJB A;  4CJV A;  2B6A A;  3HOT A;  4OGC A;  3AY9 A;  3HT3 A;  1N34 K;  3D50 A;  5AQI A;  1YT3 A;  3ZX3 A;  4AKV A;  1GLD G;  3KK2 A;  2HHI A;  3I0R A;  3T19 A;  3P1G A;  2DFF A;  3VEN A;  4O8K A;  2BAN A;  2RPI A;  2X5C A;  3VEA A;  1S3X A;  4CJU A;  1C1B A;  4J8F A;  5MLC Q;  4BC4 A;  4IWQ A;  5BPL A;  1OKJ A;  4Z94 A;  5TKW A;  2HVH A;  3A2F A;  1BCM A;  4OLA A;  4JKG A;  4JKA A;  3ZX0 A;  3AVG A;  4YOT A;  3UKU A;  1TK8 A;  2YNI A;  4KKO A;  1VSI A;  4OPA A;  4BE2 A;  3L3P A;  1TKX A;  4NYN A;  2QXL A;  1N8R O;  3VEW A;  2VQF K;  5KPZ A;  2F7Q A;  3V4I A;  1NGI A;  3IKM A;  5AQK A;  4BRO A;  1VSF A;  4CVN E;  2G8V A;  3SAH A;  2YL9 A;  1DT9 A;  4CGD A;  1RNH A;  1CLQ A;  1BIS A;  1P90 A;  4JNE A;  4YOU A;  3SBT B;  4FPB A;  1JCE A;  3UIQ A;  4JWC A;  3KTQ A;  3AVI A;  3VEX A;  4CF9 A;  4WV7 A;  2E2Q A;  4KHY A;  3SLC A;  3HM9 A;  4BDZ A;  1QHA A;  3UKR B;  1Q81 O;  4DFK A;  5GIO A;  3SBG A;  3J81 O;  1KAY A;  3CM6 A;  3M5R A;  4H0P A;  1RT4 A;  3PIO L;  3IG1 A;  1S1U A;  3DPP A;  3LDQ A;  5E26 A;  2CGK A;  5AQS A;  3TAF A;  1KQS M;  1ASU A;  4EHU A;  1U47 A;  3M3Z A;  4BRH A;  4E7K A;  3BVT A;  1JCF A;  3U8X A;  5FPE A;  1VSE A;  1KVA A;  3TTD A;  5CZ2 A;  4KV8 A;  1WDZ A;  2Z8Y A;  4ILG B;  5DMR A;  4DSL A;  2Q1N A;  1NGF A;  3BUP A;  3CYG A;  3BUI A;  1KC8 O;  3HO1 A;  2HHV A;  3F7W A;  1HRH A;  2HNY A;  4JK9 A;  3R6M A;  4IFY A;  1YI2 N;  1TQV A;  4PY5 A;  4DYL A;  1Q5L A;  1DGK N;  2F1A A;  1GOB A;  1D9F A;  4Y1D A;  4JI4 K;  3VQ5 A;  4FLZ A;  3QNO A;  4Z4F A;  4JS5 A;  1CZB A;  3VA3 A;  2NZT A;  1RDB A;  2UU9 K;  2VGM A;  1ZWW A;  4FK2 A;  3V1O A;  2QKB A;  3CCU N;  1GLE G;  4H4M A;  4JWD A;  2YHY A;  4HCB A;  5F0X A;  1L3T A;  2ZXQ A;  3W0L A;  1K8K A;  1JKH A;  3MN9 A;  1VQ4 N;  4BRK A;  3VQA A;  4GW6 A;  1O13 A;  4M45 A;  4Z4I A;  4EP4 A;  2P9U B;  3K57 A;  2FSN A;  3ZSZ A;  1SL0 A;  4GV9 A;  4DHY A;  3DX0 A;  3DOL A;  1Z05 A;  3T4A G;  2KKZ A;  3THW B;  3KDR A;  1SU6 A;  1U45 A;  2YJE A;  1U04 A;  2F7P A;  4FWN A;  2HF3 A;  1RT3 A;  3W3D A;  1WB9 A;  4I6M B;  2VWB A;  4H6H A;  4Z4E A;  3B8A X;  2KLA A;  4PL8 A;  1ILY A;  2NRX A;  4DV4 K;  4O5B A;  1HJO A;  3SAG A;  1VHX A;  3ZEU A;  3VQP A;  2E5L K;  5FPN A;  3VER A;  4B3T K;  5JIC A;  1OVY A;  3J7Z O;  1YJN N;  3AVL A;  3VEZ A;  3HJF A;  1U2V B;  4CK1 A;  4OPK A;  3OYN A;  4CGF A;  2CGJ A;  4RW6 A;  1X3M A;  2A1S A;  4H03 B;  3LP0 A;  3P31 A;  5FPD A;  1KVC A;  3I01 A;  3CCJ N;  3AA3 A; 
#chains in the Genus database with same CATH homology
 2GEM A;  1GLB G;  7HSC A;  3C65 A;  5CR4 A;  4PHT X;  3FGU A;  4A2B A;  2IVN A;  1BA0 A;  4YOY A;  3VEO A;  2WFB A;  1Q82 O;  1Q86 O;  1YAG A;  3QBW A;  4JD2 A;  5BPM A;  2QTD A;  3GL1 A;  4IOC L;  2E2P A;  2E1Z A;  2QWM A;  1KD1 O;  1ZBS A;  2FSK A;  3BF1 A;  4AM6 A;  5CHI A;  2E2N A;  1MJG A;  4FWS A;  1BWF O;  4JKC A;  2NLX A;  4FWK A;  3UIT A;  3EO3 A;  1J6Z A;  3HZ6 A;  3QFU A;  5AQW A;  3VGL A;  3LDO A;  1DKX A;  1EQY A;  2YCH A;  3U9Z A;  4B1Y B;  4K43 A;  2QWL A;  5AQG A;  3C7N B;  1T44 A;  3DXM B;  5HOO A;  2FSJ A;  2A41 A;  2FF6 A;  2QWR A;  2NRV A;  4E3C A;  4XH4 A;  4HYB A;  4AM7 A;  4CBX A;  4EZR A;  3R8E A;  3M6G A;  4YOW A;  2AA4 A;  3C6H A;  4R5J A;  1ZYL A;  4WQ4 A;  3CCV N;  5KQ8 A;  1BPR A;  1YIJ N;  4YOV A;  4JAX A;  4M7X A;  4BRP A;  4F9O A;  3P39 A;  3A5M C;  1K9M O;  3A0I X;  4JHD A;  1N8R O;  1HKC A;  3CHW A;  4NLB A;  3KZB A;  4CZE A;  3KAW A;  4KIK B;  2PAV A;  4IWO A;  1DEJ A;  5EVZ A;  3VF2 A;  2YX6 A;  3WQT A;  1VQ8 N;  3CC2 N;  1VQN N;  2VGN A;  3D2E B;  1G99 A;  4I43 A;  4H0T B;  4M63 C;  1QZ6 A;  2BH1 A;  4CZL A;  1YVN A;  3GOI A;  3H6E A;  3SJH A;  3VF4 A;  1U00 A;  1GLC G;  3IFR A;  4MQD A;  4KH6 A;  3ZET A;  3WUH A;  3CC7 N;  4G6Q A;  4JD2 B;  5LY3 A;  4NLC A;  4BG8 A;  2GTD A;  3VES A;  4CBU A;  3WXJ A;  3NVM A;  1KXP A;  4JWI A;  4H5R A;  2P9K A;  2IVP A;  2JWK A;  3SAF A;  2WIN M;  1GLL O;  1NGA A;  4FL9 A;  3F2K A;  1BG3 A;  4HWI A;  4H0X B;  4IOX A;  3MWP A;  3CCM N;  4EFH A;  3F9M A;  4ILH A;  3BP8 A;  1OA1 A;  4XJX A;  3L4Q A;  1CZA N;  3CC4 N;  4IXC A;  2V7Y A;  1GN9 A;  4M0M A;  5JLH A;  1JJ2 M;  3DAW A;  3O3M B;  2P9N A;  2HF4 A;  3RVC A;  3B51 X;  3FLC O;  4FM3 A;  3I55 N;  1E4F T;  3B52 X;  2VCP A;  3CXC M;  3MN6 A;  3A8Y A;  1V4S A;  2Q2R A;  4A62 A;  4E81 A;  3QA8 A;  1E9V A;  3GG4 A;  4EZV A;  1MWK A;  3VMF B;  1T6D A;  4BR4 A;  2D0P A;  3CCL N;  4GVE A;  4BGB A;  2UYT A;  2WUS A;  4MLE A;  4EZS A;  1E2U A;  5AQU A;  1BA1 A;  2ASO A;  4BC3 A;  1NM1 A;  4F00 A;  3VPZ A;  4R5G A;  2HBK A;  3BF3 A;  4IEI A;  3G4S N;  3FR0 A;  4XH1 A;  4H6I A;  2GUP A;  3H3O B;  3CQX A;  2QW9 A;  4BGA A;  1M90 O;  2YIV X;  1BUP A;  5AQX A;  2F9T A;  5C0Y A;  3O1B A;  4WV5 A;  3ZET B;  3T69 A;  4CZH A;  4WFN L;  4GV6 A;  5KQD A;  1M1K O;  4E1J A;  4BRI A;  3G25 A;  3Q7B A;  4WQ4 C;  2BPR A;  1W9M A;  4PO2 A;  2GWJ A;  2ZJR L;  1E1D A;  4U7B A;  1VQ9 N;  1DG4 A;  4FSV A;  1SS6 A;  4BRA A;  3R3L A;  5M1N A;  3Q7C A;  1QVG M;  5F2R A;  3H1V X;  1P8Z A;  3N8E A;  1BO5 O;  3KVG A;  4JKD A;  5AFU H;  4UY8 O;  3MN5 A;  5AZJ A;  3FD9 A;  3TU5 A;  3UB5 A;  4O8U A;  3A98 A;  4BRN A;  4UDY X;  1NGC A;  2VYP A;  3SMS A;  3LDP A;  2P9N B;  4L3Q A;  2A5X A;  2PFU A;  1NGE A;  3TSU A;  1YXQ A;  3CQY A;  3WXK A;  4B1W B;  4CJ7 A;  4NB4 A;  3U9D A;  3MX5 A;  3L6Q A;  4ISF A;  1JCG A;  5JLF A;  2RE2 A;  4EAH D;  3ID6 A;  3OHX M;  3OWG A;  4EHT A;  5FIG A;  3T49 A;  4MDA A;  3O80 A;  4ISE A;  4A5B A;  4DCH A;  4JL9 A;  3E66 A;  3GDQ A;  1NGJ A;  1VQL N;  2HBL A;  2E1Y A;  3QBX A;  4FWP A;  1T6C A;  3K9K A;  4RCH A;  4WYB A;  4FWO A;  4EZQ A;  5M1F A;  1SQK A;  5GAD P;  1K8K B;  3RSE A;  3H3N O;  3WEE A;  2YI9 A;  1Q18 A;  3J8A A;  3O5B A;  3O08 A;  4IM3 A;  2NRW A;  3MCA B;  5M1P A;  5BN9 A;  4D8J A;  3DJC A;  4BQL A;  2HBJ A;  5H1S Q;  4R5K A;  2E20 A;  3EKS A;  4FPA A;  3CCE N;  3O4W A;  3WQU A;  3GBT A;  4XH5 A;  2RHK A;  3LMF A;  1GLA G;  4K42 A;  5JVH L;  4BC2 A;  5C12 A;  3HI0 A;  4IWV A;  3CCR N;  5GIP A;  2BUP A;  4Y0W A;  4A59 A;  3VEY A;  3FFK B;  1YUW A;  2P9S A;  4BVP A;  3T46 A;  5GAG P;  1NMD A;  1MA9 B;  2JWL A;  3I8B A;  3FZH A;  1TUU A;  5ADX A;  4DB3 A;  2V7Z A;  3R1X A;  3CER A;  1BDG A;  3OHR A;  4CZJ A;  1OAO A;  3TSP A;  3VEV A;  4EZT A;  3O3O B;  4A2A A;  4H0V B;  3EE8 A;  3N4P A;  4YOR A;  3O9Q A;  3UE5 A;  3C0B A;  2Q0U A;  3D2F A;  1XC3 A;  3ENB A;  5KPZ A;  4B9Q A;  1BOT O;  1RDU A;  3JS6 A;  4FWM A;  3ZEF A;  1BU6 O;  2W41 A;  4JKB A;  3KAV A;  3ZEU B;  3L3O M;  4BRL A;  4BR2 A;  3CET A;  3JXU A;  4CBW A;  4GY2 B;  3WT0 A;  3GI7 A;  4CZM A;  3KWG A;  4H0O A;  4C1N K;  4UDX X;  2QA4 N;  4PKG A;  3RSE B;  4H5N A;  3WEE B;  5BN8 A;  3ID8 A;  3A5L C;  2NRZ A;  4BQZ A;  1QVF M;  3C6A A;  1GLF O;  1DKZ A;  3PLA A;  2ASP A;  4B1U B;  5I9E B;  3FZK A;  3S41 A;  1DKG D;  2YHW A;  4EZO A;  3WXI A;  2D0O A;  2GX9 A;  2QWQ A;  3MDQ A;  2QEX N;  3MWT A;  3D7E O;  1NLV A;  3DXK A;  2NRH A;  3LDN A;  1R59 O;  5M1K A;  2C1G A;  2P9P A;  3DWL A;  2QI2 A;  2FLO A;  1NGD A;  3CJA A;  4XEI A;  5AQO A;  4A57 A;  2EWF A;  4FWQ A;  5EX5 A;  4CD1 A;  3CCQ N;  3AGK A;  4KH5 A;  4R79 A;  3CPW M;  4ILJ A;  4ISG A;  3O6W A;  4IJA A;  2Q36 A;  3CCS N;  1VQ6 N;  4IM0 A;  4WQ5 A;  3MK6 A;  4PL7 A;  2HBM A;  3ZYY X;  5TKY A;  4QS7 A;  2YIB A;  2ZWH A;  1T3V A;  2FF3 B;  4H5V A;  2WC9 A;  3ER8 C;  2ZJP L;  3VF6 A;  3OW2 M;  3ULE A;  4BRQ A;  4EZP A;  1D4X A;  1U6Z A;  5AQF A;  2J4R A;  3O9S A;  2Q97 A;  1JQK A;  3HSC A;  4KBO A;  3VEB A;  3ERC C;  1ATN A;  1E4G T;  2W00 A;  4FOI A;  1SU7 A;  3CI5 A;  3TPQ A;  3O1W A;  3HOS A;  2H3G X;  5AQQ A;  4EIA A;  3A5O C;  3VKH A;  4CZI A;  4DKW A;  5M1Q A;  1Y64 A;  3OBW A;  4IFE A;  4JHD B;  2OTJ N;  2NRR A;  3KHY A;  1SZ2 A;  4IZ9 A;  3ENH A;  3E9O A;  3DXK B;  4BC5 A;  2JNS A;  3HRG A;  3DLL L;  3WXL A;  3CJ7 A;  2I7P A;  3AGR A;  4MLH A;  1SU8 A;  4H5T A;  1YF5 L;  3NVK A;  4I6M A;  2A42 A;  2ZF5 O;  4JLC A;  4OPH A;  1RFQ A;  1WUA A;  1XUP O;  3OBY A;  4YDU A;  1ATR A;  2F7T A;  5HL7 L;  2QM1 A;  5AZI A;  5AQZ A;  2YIA A;  2D4W A;  2P9K B;  2OP6 A;  4NO7 A;  3VGK A;  3DPO A;  3G6E N;  2A40 A;  3FZF A;  4BR0 A;  1UPX A;  5B8H A;  4NPH A;  1C0F A;  1C0G A;  4QS8 A;  5AQJ A;  1SUF A;  4ILH B;  5AR0 A;  5EY4 A;  2YI1 A;  3ULE B;  1TYQ A;  4IDH A;  4BRG A;  5GAH P;  2ASM A;  2CH5 A;  2C1I A;  3R9P A;  3VGM A;  2I7N A;  3CJC A;  5M1O A;  3O9R A;  2P9I A;  3EKU A;  2P9L A;  5C15 A;  4R5I A;  4IO9 L;  4C23 A;  3MCP A;  3ATV A;  1K8A O;  3WXM B;  2LM0 A;  3HBT A;  1TUY A;  3IDH A;  1ZC6 A;  5AQN A;  1IG8 A;  4BRD A;  3O8M A;  2A6A A;  2HST A;  4EZY A;  3CJB A;  4IJN A;  1VAZ A;  2GAF D;  4MO5 A;  5AQM A;  4JKE A;  5AQP A;  2DPN A;  3HOT A;  3IUC A;  2QFF A;  3AY9 A;  3MN7 A;  4WQ5 C;  1VQ7 N;  5AQI A;  3ZX3 A;  1GLD G;  1MDU B;  1IJJ A;  3LDL A;  4AF1 A;  1H1V A;  3M1F A;  3SBT A;  4YOX A;  1VQM N;  3CJ1 A;  5JMV A;  3P4I A;  4CI6 A;  3VEN A;  4O8K A;  2E2O A;  4WF9 L;  2E8A A;  2ND1 A;  2X5C A;  1Q7Y O;  3VEA A;  3U4L A;  1S3X A;  4RWT A;  2ND0 A;  3D6R A;  4QS9 A;  3UKR A;  4EZX A;  4J8F A;  1LCU A;  5AZI B;  5MLC Q;  1YIT N;  3DXM A;  1V4T A;  4PKH A;  4BC4 A;  1GNL A;  4IWQ A;  3RV0 A;  1OKJ A;  3MMV A;  4CD3 A;  4FWR A;  4Z94 A;  4JN4 A;  5TKW A;  3FZM A;  1NGG A;  3O3N B;  2NCZ A;  4K41 A;  1TYQ B;  4JKG A;  4JKA A;  4IM2 A;  5AZJ B;  3ZX0 A;  4YOT A;  2F9W A;  4JK8 A;  3UKU A;  2YJF A;  4BRM A;  2N3K A;  4IWP A;  1X3N A;  2ZGY A;  3KWI A;  4BRC A;  4K25 A;  5ADX H;  2P9I B;  3T48 A;  1QQN A;  3LL3 A;  1NGB A;  1NJI O;  4OPA A;  3K9J A;  2EX3 B;  2QXL A;  5EXW A;  3F5T A;  4A61 A;  1HUX A;  3AAQ A;  5EOY A;  4HR1 A;  3ER9 B;  3EE9 A;  3VEW A;  2KHO A;  5AQY A;  3O9T A;  4IW0 A;  3CIP A;  3ENO A;  1NGI A;  4BG9 A;  3IKM A;  5KPT A;  4KH4 A;  4ILG A;  5AQK A;  4BRO A;  3D2E A;  1ZXO A;  2D1K A;  5ELZ A;  4B1X B;  4RTF D;  3QIC A;  3SAH A;  4CZK A;  3AAR A;  2ZJQ L;  5BRF A;  1DT9 A;  4H0Y B;  2OBL A;  2WBN A;  1P90 A;  4JEP A;  3BUZ B;  4JNE A;  4YOU A;  3SBT B;  3B53 X;  4FPB A;  1JCE A;  3HM8 A;  4BEB A;  5AQR A;  4JWC A;  4ILI A;  3SMP A;  3VEX A;  2NNW A;  4BEC A;  3E1Y A;  3GE1 A;  4WV7 A;  5E84 A;  2E2Q A;  3SLC A;  5AQT A;  4LC9 B;  1QHA A;  1X9J A;  3UKR B;  1YJ9 N;  4MDB A;  1Q81 O;  1VQK N;  5BPN A;  1Z6R A;  2AP1 A;  1DKY A;  5FPD A;  5GIO A;  5DM6 L;  3SBG A;  2P9S B;  4IOA L;  1VQ5 N;  1KAY A;  3I01 A;  3E9L A;  3M5R A;  4H0P A;  5GAE P;  3FZL A;  3PIO L;  5LJV A;  4BVO A;  4JK7 A;  3BEX A;  3DPP A;  3EL2 A;  3LDQ A;  4JKG B;  4EZZ A;  2CGK A;  5E26 A;  5AQS A;  4O5F A;  4CZG A;  1KQS M;  3UKU B;  1S22 A;  1VQP N;  4EHU A;  4GV3 A;  3SBS A;  3M3Z A;  2YI8 A;  3QML A;  1NBW A;  2NRT A;  4BRH A;  4F01 A;  3D2F B;  1JCF A;  3U8X A;  1OA0 A;  4HR1 B;  5FPE A;  3QB0 A;  5AQH A;  3TTD A;  4U67 L;  4JWE A;  1RDW X;  3EN9 A;  3LM9 A;  4FOE A;  2Z8Y A;  4ILG B;  3QDK A;  4WFA L;  2Q1N A;  3H46 O;  4G9Z A;  2OBM A;  1NGF A;  1W2B M;  2ITM A;  4EZW A;  5C10 A;  2P9U A;  1KC8 O;  2V51 B;  3F7W A;  1SAZ A;  2GEL A;  5BPL A;  4IEE A;  3TTF A;  1HPM A;  4JK9 A;  3R6M A;  1CKR A;  5BRD A;  5BRH A;  5F1X A;  3I04 A;  3I39 X;  1YI2 N;  3ZED A;  3DPQ A;  3LM2 A;  2E88 A;  3I56 N;  4BR9 A;  5C2D A;  2GWK A;  3AAP A;  3OA9 A;  1Q5L A;  3DQG A;  1DGK N;  2V52 B;  1QQM A;  1NGH A;  4HTL A;  4BR5 A;  3NMU A;  2EWS A;  1HLU A;  2P9P B;  3H1Q A;  4CZF A;  3PIP L;  1KAZ A;  3ZX2 A;  1WOQ A;  4BY9 C;  4B1V A;  3QNJ A;  3H45 C;  3TTC A;  4BRF A;  2NZT A;  2CH6 A;  2VGM A;  4DQ8 A;  3CPE A;  3I33 A;  3N4Q A;  5FPM A;  3FE1 A;  4GNI A;  4H5W A;  3VTI A;  3DOB A;  3VET A;  3QFP A;  1YHQ N;  2YHX A;  4JKF A;  3VOV A;  4JNF A;  1VQO N;  4BE7 B;  3CCU N;  1XQS C;  1GLE G;  1QQO A;  3KK7 A;  4M7Y A;  4B1Z A;  4JWD A;  2YHY A;  4A5A A;  4FWL A;  5F0X A;  3H0X A;  3O9U A;  1LOT B;  2QWO A;  2QWN A;  2FXU A;  3T47 A;  1K8K A;  3MN9 A;  3W0L A;  1U2V A;  2Q31 A;  1VQ4 N;  4BRK A;  5AQV A;  5CE3 A;  3ATU A;  1O13 A;  4HY9 A;  3MX2 A;  4WFB L;  1RGI A;  2P9U B;  1MWM A;  2RT6 A;  5AQL A;  2FSN A;  1NWK A;  3TSQ A;  4GV9 A;  4DHY A;  3L0Q A;  5GIN A;  5C2F A;  2HMP A;  1Z05 A;  4PKI A;  5AFU A;  2BTF A;  4MO4 A;  3G71 N;  1ATS A;  1QZ5 A;  2QWP A;  4R5L A;  3T4A G;  2KKZ A;  2OAN A;  2ZGZ A;  5JVG L;  3KDR A;  3CD6 N;  1SU6 A;  3HTV A;  2YJE A;  3IMX A;  5KPR A;  4EZN A;  1S72 N;  3CF5 L;  3L4I A;  2A3Z A;  2Q0R A;  2HF3 A;  4FWN A;  3W3D A;  2CGL A;  5BR9 A;  1HKG A;  3RV1 A;  4I6M B;  2IIR A;  2IVO A;  2VWB A;  2W40 A;  4H6H A;  1YJW N;  3CME N;  3B8A X;  2KLA A;  1HKB A;  4PL8 A;  3SK3 A;  4IO8 A;  4OO1 J;  1ILY A;  2NRX A;  1KAX A;  4C1N I;  3E9P A;  3C7N A;  1HJO A;  4FVU A;  5FLE X;  4WCE L;  2PY6 A;  3ZEU A;  3SAG A;  2PBD A;  3CMA N;  1ESV A;  1W97 L;  3A5N C;  4JKH A;  5BRE A;  5LJW A;  5FPN A;  3VER A;  1EO1 A;  5JIC A;  1OVY A;  3J7Z O;  1YJN N;  4BRE A;  3VEZ A;  1U2V B;  2GA9 D;  3CJ9 A;  1K73 O;  3VTH A;  2P9L B;  1HX1 A;  3EZW A;  5DM7 L;  4FO0 A;  2CGJ A;  2OTL N;  2HOE A;  3T7Z A;  1X3M A;  4H03 B;  3P38 A;  4KIK A;  1GNT A;  3P31 A;  4BR7 A;  4YDU C;  1GLJ O;  3CCJ N;  4EZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...