4EZYA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrliltg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezyA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezyA01
4R5JA 4EZUA 3OHXM 3D2EA 4JWCA 4JWIA 4H6IA 4FL9A 1YUWA 3C7NA 4PO2A 4EZVA 2OP6A 1CKRA 4R5KA 4EZPA 4R5IA 5TKYA 4EZTA 2V7YA 3DPPA 4HY9A 4EZQA 4JWDA 4EZWA 1DKYA 3L3OM 3H0XA 4EZYA 4EZZA 3QNJA 1DKXA 3T47A 4JNFA 4EZRA 1DKZA 1BPRA 4JN4A 2KHOA 4R5LA 2WINM 2QFFA 3T4AG 4EZOA 1U00A 4EZXA 3DQGA 3T46A 4EZSA 3T48A 3DOBA 4JWEA 4H6HA 4JNEA 4WV7A 3DPOA 4R5GA 3C7NB 5E84A 3N8EA 4EZNA 2BPRA 4WV5A 4B9QA 1Q5LA 3DPQA 4HYBA 3D2FA 2QXLA 4F01A 4F00A 7HSCA 3T49A 1DG4A 4E81A
chains in the Genus database with same CATH superfamily
3D2EA 2OO2A 1Y2OA 1I4TA 3RPMA 4EZPA 4EZWA 1TQWA 1E2UA 3EJPA 3DYTA 2RT6A 3DOBA 3UITA 2D4CA 3Q0KA 4B9QA 3BVWA 1QWUA 4HYBA 4F00A 3SYVA 1E1DA 1GNTA 2RAKA 3RV0A 1DKYA 4JL9A 3BLBA 2N3KA 3SBTB 2ND1A 2EFKA 2WYHA 4JNEA 3ACOA 2OBLA 3EJTA 3VEAA 2C08A 3ZEDA 4E81A 4H8SA 1PS3A 4NSWA 2O0I1 4AZHA 1I49A 3QA8A 1OA0A 1HXKA 3QNJA 4EZRA 1MJGA 2YKTA 1TQUA 4R5LA 3VEBA 3A98A 4I1QA 3OWGA 3CZSA 2RAJA 2NCZA 3D4ZA 2Q12A 2GF4A 1TQVA 4H6IA 4AZ5A 4EZVA 3ERCC 2X3XA 2ELBA 5TKYA 4EZTA 2V7YA 3Q84A 4WPEA 4HR1B 3BUPA 3DX0A 4HR1A 2OW6A 2WYIA 3RV1A 2YIAA 2LM0A 4AVMA 2F1AA 3D2FA 4UDYX 4JWCA 4NQIA 2MI7A 2Z8YA 2EX3B 3BUQA 3DDFA 3L3OM 4G6QA 1LQ7A 3T46A 3KAWA 4H6HA 2BPRA 4KIKB 1URUA 3BUBA 1OAOA 1SU8A 4R5KA 4FZSA 1R5EA 2F1BA 4FZOA 2F7RA 4EZYA 4EZZA 4UDXX 2X3WA 2QFFA 1U00A 1W9MA 3N8EA 1R33A 3ER9B 2QXLA 2F7PA 2ZXQA 3DX2A 1R34A 3HAIA 4I43A 2EWFA 3BVUA 4IWQA 2OP6A 2FYVA 1TQTA 3LMFA 4AZIA 4JNFA 5C5BA 2X5CA 4EZSA 3T48A 4R5GA 3CV5A 1ZWWA 5E84A 2YIBA 3KAVA 3DPQA 3KDRA 3HAJA 3B52X 4FZPA 3O3OB 3I2WA 2PMRA 4JWIA 3PLTA 4FL9A 3DDGA 4NPHA 1GNLA 4AZ6A 3HAHA 3QE6A 3LLLA 2ND0A 2V0OA 2KHOA 4IM3A 4WPCA 1O7DC 3CZNA 1I4DA 4AKVA 3EJUA 2Z0OA 1O7DB 3DX3A 3VKHA 4IWOA 1QX1A 3M3WA 4ILGA 4M0MA 2YIVX 3C7NB 4EZUA 3B53X 2RAIA 3C7NA 3EJQA 2GAFD 3LVTA 3H0XA 2OBMA 2YL8A 3T4AG 2Q13A 2F18A 2OZNB 3DPOA 2QKWA 4IW0A 4IWPA 4AZCB 3BVTA 4AZCA 4F01A 4ILIA 1OA1A 2YL5A 3BVVA 3DX4A 1JQKA 7HSCA 4AZBA 4R5JA 1YUWA 1TQSA 2YLLA 5FLEX 5KBPA 3ER8C 3F7WA 2ALWA 1QWNA 2FICA 3DPPA 3L3PA 4WV7A 2F7OA 2F7QA 3G9GA 3OHXM 3D50A 1UPXA 3ABHA 2LXYA 1SU6A 4AZ7A 3EJSA 2JNSA 3I04A 5C5BB 1DKZA 1BPRA 2WINM 4EZOA 4EZXA 3SOGA 2YL6A 4BNEA 3I39X 1HTYA 2OW7A 4EZNA 2EFLA 3O3NB 4DCNC 3T49A 3QNIA 3B51X 1WDZA 3D4YA 4DYLA 4ILHB 1E9VA 5FIGA 1CKRA 1DKXA 3BUDA 3BVXA 1ZYLA 2YI9A 2YI8A 3SBSA 1SU7A 2X3VA 2D1LA 1GN9A 4FM3A 4E3CA 4EZQA 3BUIA 1X03A 3DX1A 3CVRA 4IM2A 4JN4A 1X04A 4JWEA 3O3MB 3GI7A 3OK8A 3QWEA 2GA9D 4IM0A 3D51A 4PO2A 1HWWA 2PY6A 3T47A 3CKDA 2Z0NA 3CAZA 2JNKA 1YWMA 3DQGA 3EJRA 4D8JA 3FD9A 1DG4A 3ZEFA 2YLAA 2Z0VA 1I4LA 4R5IA 4HY9A 4JWDA 2YL9A 1SUFA 4JLCA 4ATMA 4AZGA 3I01A 4WV5A 1Q5LA 4MQDA 4KIKA 3D52A
chains in the Genus database with same CATH topology
4UDYX 4EZUA 3D2EA 4JWCA 3B53X 4ILHB 1E9VA 2Z8YA 3C7NA 2EX3B 5FIGA 1CKRA 4EZPA 4EZWA 3L3OM 2GAFD 3H0XA 1E2UA 1DKXA 2OBMA 4G6QA 3T4AG 3T46A 1ZYLA 2RT6A 3DOBA 3KAWA 4H6HA 3UITA 3DPOA 4IW0A 4IWPA 2YI9A 2BPRA 2YI8A 4B9QA 4KIKB 4HYBA 3SBSA 4F01A 4F00A 4ILIA 1OA1A 1SU7A 7HSCA 1JQKA 1OAOA 4R5JA 1YUWA 1E1DA 1GNTA 1SU8A 1GN9A 4FM3A 4R5KA 4E3CA 3RV0A 4EZQA 1DKYA 4EZYA 4JL9A 4EZZA 4IM2A 4JN4A 4UDXX 2N3KA 3SBTB 2QFFA 1U00A 2ND1A 5FLEX 1W9MA 4JWEA 4JNEA 3O3MB 3GI7A 3N8EA 2OBLA 3ER9B 3ER8C 2QXLA 2GA9D 3F7WA 4IM0A 3VEAA 3ZEDA 4E81A 4I43A 2EWFA 4PO2A 4IWQA 2OP6A 3DPPA 2PY6A 3LMFA 3QA8A 1OA0A 3QNJA 4EZRA 3T47A 4JNFA 1MJGA 3VEBA 2X5CA 4R5LA 3A98A 3OWGA 3DQGA 4EZSA 3T48A 4WV7A 4R5GA 5E84A 2YIBA 2NCZA 3KAVA 3DPQA 3KDRA 3B52X 4D8JA 3FD9A 1DG4A 3O3OB 3OHXM 4FL9A 4JWIA 3ZEFA 4H6IA 1UPXA 4NPHA 1GNLA 1SU6A 4EZVA 3ERCC 4R5IA 2JNSA 5TKYA 4EZTA 2V7YA 4HY9A 4JWDA 3I04A 1SUFA 4HR1B 2ND0A 1DKZA 4JLCA 1BPRA 2KHOA 4IM3A 4HR1A 2WINM 4EZOA 4EZXA 3I39X 3RV1A 3VKHA 4IWOA 3I01A 4EZNA 4ILGA 2YIAA 4M0MA 2LM0A 1Q5LA 4WV5A 3O3NB 3D2FA 4MQDA 4KIKA 3T49A 2YIVX 3B51X 3C7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5J A;  4EZU A;  3OHX M;  3D2E A;  4JWC A;  4JWI A;  4H6I A;  4FL9 A;  1YUW A;  3C7N A;  4PO2 A;  4EZV A;  2OP6 A;  1CKR A;  4R5K A;  4EZP A;  4R5I A;  5TKY A;  4EZT A;  2V7Y A;  3DPP A;  4HY9 A;  4EZQ A;  4JWD A;  4EZW A;  1DKY A;  3L3O M;  3H0X A;  4EZY A;  4EZZ A;  3QNJ A;  1DKX A;  3T47 A;  4JNF A;  4EZR A;  1DKZ A;  1BPR A;  4JN4 A;  2KHO A;  4R5L A;  2WIN M;  2QFF A;  3T4A G;  4EZO A;  1U00 A;  4EZX A;  3DQG A;  3T46 A;  4EZS A;  3T48 A;  3DOB A;  4JWE A;  4H6H A;  4JNE A;  4WV7 A;  3DPO A;  4R5G A;  3C7N B;  5E84 A;  3N8E A;  4EZN A;  2BPR A;  4WV5 A;  4B9Q A;  1Q5L A;  3DPQ A;  4HYB A;  3D2F A;  2QXL A;  4F01 A;  4F00 A;  7HSC A;  3T49 A;  1DG4 A;  4E81 A; 
#chains in the Genus database with same CATH topology
 3D2E A;  2OO2 A;  1Y2O A;  1I4T A;  3RPM A;  4EZP A;  4EZW A;  1TQW A;  1E2U A;  3EJP A;  3DYT A;  2RT6 A;  3DOB A;  3UIT A;  2D4C A;  3Q0K A;  4B9Q A;  3BVW A;  1QWU A;  4HYB A;  4F00 A;  3SYV A;  1E1D A;  1GNT A;  2RAK A;  3RV0 A;  1DKY A;  4JL9 A;  3BLB A;  2N3K A;  3SBT B;  2ND1 A;  2EFK A;  2WYH A;  4JNE A;  3ACO A;  2OBL A;  3EJT A;  3VEA A;  2C08 A;  3ZED A;  4E81 A;  4H8S A;  1PS3 A;  4NSW A;  2O0I 1;  4AZH A;  1I49 A;  3QA8 A;  1OA0 A;  1HXK A;  3QNJ A;  4EZR A;  1MJG A;  2YKT A;  1TQU A;  4R5L A;  3VEB A;  3A98 A;  4I1Q A;  3OWG A;  3CZS A;  2RAJ A;  2NCZ A;  3D4Z A;  2Q12 A;  2GF4 A;  1TQV A;  4H6I A;  4AZ5 A;  4EZV A;  3ERC C;  2X3X A;  2ELB A;  5TKY A;  4EZT A;  2V7Y A;  3Q84 A;  4WPE A;  4HR1 B;  3BUP A;  3DX0 A;  4HR1 A;  2OW6 A;  2WYI A;  3RV1 A;  2YIA A;  2LM0 A;  4AVM A;  2F1A A;  3D2F A;  4UDY X;  4JWC A;  4NQI A;  2MI7 A;  2Z8Y A;  2EX3 B;  3BUQ A;  3DDF A;  3L3O M;  4G6Q A;  1LQ7 A;  3T46 A;  3KAW A;  4H6H A;  2BPR A;  4KIK B;  1URU A;  3BUB A;  1OAO A;  1SU8 A;  4R5K A;  4FZS A;  1R5E A;  2F1B A;  4FZO A;  2F7R A;  4EZY A;  4EZZ A;  4UDX X;  2X3W A;  2QFF A;  1U00 A;  1W9M A;  3N8E A;  1R33 A;  3ER9 B;  2QXL A;  2F7P A;  2ZXQ A;  3DX2 A;  1R34 A;  3HAI A;  4I43 A;  2EWF A;  3BVU A;  4IWQ A;  2OP6 A;  2FYV A;  1TQT A;  3LMF A;  4AZI A;  4JNF A;  5C5B A;  2X5C A;  4EZS A;  3T48 A;  4R5G A;  3CV5 A;  1ZWW A;  5E84 A;  2YIB A;  3KAV A;  3DPQ A;  3KDR A;  3HAJ A;  3B52 X;  4FZP A;  3O3O B;  3I2W A;  2PMR A;  4JWI A;  3PLT A;  4FL9 A;  3DDG A;  4NPH A;  1GNL A;  4AZ6 A;  3HAH A;  3QE6 A;  3LLL A;  2ND0 A;  2V0O A;  2KHO A;  4IM3 A;  4WPC A;  1O7D C;  3CZN A;  1I4D A;  4AKV A;  3EJU A;  2Z0O A;  1O7D B;  3DX3 A;  3VKH A;  4IWO A;  1QX1 A;  3M3W A;  4ILG A;  4M0M A;  2YIV X;  3C7N B;  4EZU A;  3B53 X;  2RAI A;  3C7N A;  3EJQ A;  2GAF D;  3LVT A;  3H0X A;  2OBM A;  2YL8 A;  3T4A G;  2Q13 A;  2F18 A;  2OZN B;  3DPO A;  2QKW A;  4IW0 A;  4IWP A;  4AZC B;  3BVT A;  4AZC A;  4F01 A;  4ILI A;  1OA1 A;  2YL5 A;  3BVV A;  3DX4 A;  1JQK A;  7HSC A;  4AZB A;  4R5J A;  1YUW A;  1TQS A;  2YLL A;  5FLE X;  5KBP A;  3ER8 C;  3F7W A;  2ALW A;  1QWN A;  2FIC A;  3DPP A;  3L3P A;  4WV7 A;  2F7O A;  2F7Q A;  3G9G A;  3OHX M;  3D50 A;  1UPX A;  3ABH A;  2LXY A;  1SU6 A;  4AZ7 A;  3EJS A;  2JNS A;  3I04 A;  5C5B B;  1DKZ A;  1BPR A;  2WIN M;  4EZO A;  4EZX A;  3SOG A;  2YL6 A;  4BNE A;  3I39 X;  1HTY A;  2OW7 A;  4EZN A;  2EFL A;  3O3N B;  4DCN C;  3T49 A;  3QNI A;  3B51 X;  1WDZ A;  3D4Y A;  4DYL A;  4ILH B;  1E9V A;  5FIG A;  1CKR A;  1DKX A;  3BUD A;  3BVX A;  1ZYL A;  2YI9 A;  2YI8 A;  3SBS A;  1SU7 A;  2X3V A;  2D1L A;  1GN9 A;  4FM3 A;  4E3C A;  4EZQ A;  3BUI A;  1X03 A;  3DX1 A;  3CVR A;  4IM2 A;  4JN4 A;  1X04 A;  4JWE A;  3O3M B;  3GI7 A;  3OK8 A;  3QWE A;  2GA9 D;  4IM0 A;  3D51 A;  4PO2 A;  1HWW A;  2PY6 A;  3T47 A;  3CKD A;  2Z0N A;  3CAZ A;  2JNK A;  1YWM A;  3DQG A;  3EJR A;  4D8J A;  3FD9 A;  1DG4 A;  3ZEF A;  2YLA A;  2Z0V A;  1I4L A;  4R5I A;  4HY9 A;  4JWD A;  2YL9 A;  1SUF A;  4JLC A;  4ATM A;  4AZG A;  3I01 A;  4WV5 A;  1Q5L A;  4MQD A;  4KIK A;  3D52 A; 
#chains in the Genus database with same CATH homology
 4UDY X;  4EZU A;  3D2E A;  4JWC A;  3B53 X;  4ILH B;  1E9V A;  2Z8Y A;  3C7N A;  2EX3 B;  5FIG A;  1CKR A;  4EZP A;  4EZW A;  3L3O M;  2GAF D;  3H0X A;  1E2U A;  1DKX A;  2OBM A;  4G6Q A;  3T4A G;  3T46 A;  1ZYL A;  2RT6 A;  3DOB A;  3KAW A;  4H6H A;  3UIT A;  3DPO A;  4IW0 A;  4IWP A;  2YI9 A;  2BPR A;  2YI8 A;  4B9Q A;  4KIK B;  4HYB A;  3SBS A;  4F01 A;  4F00 A;  4ILI A;  1OA1 A;  1SU7 A;  7HSC A;  1JQK A;  1OAO A;  4R5J A;  1YUW A;  1E1D A;  1GNT A;  1SU8 A;  1GN9 A;  4FM3 A;  4R5K A;  4E3C A;  3RV0 A;  4EZQ A;  1DKY A;  4EZY A;  4JL9 A;  4EZZ A;  4IM2 A;  4JN4 A;  4UDX X;  2N3K A;  3SBT B;  2QFF A;  1U00 A;  2ND1 A;  5FLE X;  1W9M A;  4JWE A;  4JNE A;  3O3M B;  3GI7 A;  3N8E A;  2OBL A;  3ER9 B;  3ER8 C;  2QXL A;  2GA9 D;  3F7W A;  4IM0 A;  3VEA A;  3ZED A;  4E81 A;  4I43 A;  2EWF A;  4PO2 A;  4IWQ A;  2OP6 A;  3DPP A;  2PY6 A;  3LMF A;  3QA8 A;  1OA0 A;  3QNJ A;  4EZR A;  3T47 A;  4JNF A;  1MJG A;  3VEB A;  2X5C A;  4R5L A;  3A98 A;  3OWG A;  3DQG A;  4EZS A;  3T48 A;  4WV7 A;  4R5G A;  5E84 A;  2YIB A;  2NCZ A;  3KAV A;  3DPQ A;  3KDR A;  3B52 X;  4D8J A;  3FD9 A;  1DG4 A;  3O3O B;  3OHX M;  4FL9 A;  4JWI A;  3ZEF A;  4H6I A;  1UPX A;  4NPH A;  1GNL A;  1SU6 A;  4EZV A;  3ERC C;  4R5I A;  2JNS A;  5TKY A;  4EZT A;  2V7Y A;  4HY9 A;  4JWD A;  3I04 A;  1SUF A;  4HR1 B;  2ND0 A;  1DKZ A;  4JLC A;  1BPR A;  2KHO A;  4IM3 A;  4HR1 A;  2WIN M;  4EZO A;  4EZX A;  3I39 X;  3RV1 A;  3VKH A;  4IWO A;  3I01 A;  4EZN A;  4ILG A;  2YIA A;  4M0M A;  2LM0 A;  1Q5L A;  4WV5 A;  3O3N B;  3D2F A;  4MQD A;  4KIK A;  3T49 A;  2YIV X;  3B51 X;  3C7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...