4EZYA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrliltg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 71
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezyA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezyA01
4EZRA 3OHXM 4EZTA 1CKRA 4EZWA 1YUWA 2BPRA 1DKXA 4HYBA 3DPPA 4JWEA 1Q5LA 4FL9A 3D2FA 3C7NA 3T46A 4EZNA 3H0XA 1U00A 4EZXA 4WV5A 3L3OM 4JNEA 2KHOA 4EZQA 4HY9A 4R5JA 2QFFA 3D2EA 3N8EA 7HSCA 1DG4A 4R5KA 4F01A 3T49A 4EZPA 4EZYA 3QNJA 4EZOA 2OP6A 4JWCA 4JN4A 4F00A 3C7NB 4WV7A 4JWDA 4R5LA 4EZSA 2WINM 4H6HA 3T4AG 5E84A 5TKYA 4EZVA 4B9QA 4R5GA 4PO2A 2QXLA 4JWIA 4H6IA 3DQGA 4R5IA 3T48A 1BPRA 4EZUA 4EZZA 2V7YA 3DPOA 3DOBA 1DKZA 4E81A 4JNFA 3T47A 1DKYA 3DPQA
chains in the Genus database with same CATH superfamily
2GAFD 3I01A 1Y2OA 1U00A 2Z8YA 3EJSA 3BLBA 2OW6A 3CZNA 4R5KA 4JN4A 3DX1A 4AZBA 3D52A 2FYVA 1W9MA 4B9QA 1QX1A 2YLAA 3HAIA 1R34A 3OWGA 4M0MA 3B52X 3QE6A 2X3WA 3GI7A 3D2EA 3KDRA 4IM2A 4AKVA 4JWCA 3T4AG 3O3OB 2QXLA 4AZ6A 4I1QA 4H6IA 2OBLA 3ZEDA 4EZUA 4NPHA 4AZIA 4ILHB 4AVMA 4JNFA 4AZGA 1Q5LA 2OBMA 4IM0A 3QA8A 4AZ7A 3CKDA 4F00A 3D50A 4FZSA 1OAOA 4IWOA 2ND0A 3VEAA 3Q84A 5C5BB 3N8EA 4EZWA 3I2WA 2Q12A 2YL6A 1SU8A 2X5CA 2F7PA 3LLLA 3B53X 2D1LA 3D4YA 4NQIA 2ND1A 1PS3A 2GF4A 4DCNC 3RV1A 1YWMA 3DYTA 3DPOA 3KAWA 3SBTB 4ILIA 2EFLA 3EJPA 1X03A 3ERCC 4JL9A 4EZQA 4HY9A 1OA1A 2N3KA 3D4ZA 2RAIA 1ZYLA 3O3NB 2RAJA 4DYLA 2OO2A 2YL9A 2LM0A 2MI7A 3SOGA 5KBPA 4EZTA 4WPCA 2ALWA 1YUWA 3C7NA 2F7RA 4EZXA 1X04A 2YL5A 1JQKA 1TQSA 3BVWA 4FZPA 4MQDA 2Z0OA 2Q13A 3QNIA 4AZ5A 4EZVA 3EJUA 4EZZA 3Q0KA 3DOBA 1HWWA 3OHXM 4NSWA 3M3WA 3G9GA 2NCZA 3D2FA 3T46A 2PMRA 3BUIA 2YLLA 3PLTA 4JWDA 4HR1B 3EJQA 4IWPA 3T48A 4IM3A 1R5EA 2X3VA 1GNTA 2QFFA 2YI9A 3T49A 4EZPA 5FIGA 4H6HA 4R5GA 2D4CA 4D8JA 3DX4A 4E81A 3T47A 2F7QA 1GNLA 4UDXX 4AZHA 4BNEA 3L3OM 1I4TA 1MJGA 2LXYA 4IW0A 2OW7A 2RT6A 2EFKA 5C5BA 1O7DC 3KAVA 2PY6A 3HAHA 4JWIA 2O0I1 2X3XA 3LVTA 2JNSA 1DKYA 2ELBA 1LQ7A 3LMFA 3EJTA 3FD9A 2F7OA 4E3CA 2BPRA 3UITA 1URUA 2F18A 2KHOA 4R5JA 1SU7A 2RAKA 4EZYA 3ABHA 2Z0NA 2WYIA 4KIKB 4EZSA 3ER9B 3CV5A 2FICA 3DPQA 2C08A 1CKRA 1E1DA 3BUQA 1HXKA 3DX2A 1DKXA 4EZNA 4ILGA 3D51A 3B51X 3BUBA 1I49A 2JNKA 3DX0A 1TQVA 3OK8A 4FL9A 3DPPA 2YIAA 3F7WA 3DDFA 1TQTA 2OP6A 3QNJA 4EZOA 4FM3A 1SUFA 5FLEX 3ZEFA 2YIVX 3I04A 2F1BA 3I39X 2V7YA 3O3MB 2GA9D 3L3PA 4EZRA 4ATMA 3DX3A 4JWEA 1TQUA 4HR1A 1I4LA 1SU6A 3EJRA 7HSCA 1DG4A 4F01A 2EX3B 3CZSA 1E9VA 3BUPA 1QWNA 4G6QA 5TKYA 1ZWWA 3SYVA 4PO2A 1GN9A 2V0OA 4UDYX 2OZNB 3QWEA 1O7DB 2YIBA 1OA0A 1QWUA 1TQWA 3DDGA 4WV7A 5E84A 3BVUA 2QKWA 3CAZA 1UPXA 4JLCA 3A98A 1I4DA 2WYHA 4WPEA 2YL8A 4HYBA 1HTYA 4FZOA 3H0XA 2YKTA 4WV5A 4JNEA 2F1AA 3RV0A 2YI8A 3ER8C 4R5LA 3HAJA 2WINM 1WDZA 2Z0VA 3BVVA 4R5IA 1BPRA 2EWFA 4H8SA 3SBSA 4AZCB 1E2UA 4IWQA 1R33A 4KIKA 3VKHA 3C7NB 3VEBA 3RPMA 4I43A 3BVXA 2ZXQA 4AZCA 3BVTA 3DQGA 3CVRA 3ACOA 1DKZA 3BUDA
chains in the Genus database with same CATH topology
4EZRA 4ILIA 2GAFD 3SBTB 1GNLA 3I01A 4UDXX 4JWEA 3ERCC 1U00A 4JL9A 3L3OM 2Z8YA 4EZQA 4HY9A 1OA1A 2N3KA 4HR1A 1SU6A 7HSCA 4R5KA 1DG4A 1MJGA 4F01A 1ZYLA 2EX3B 4JN4A 3O3NB 4IW0A 1E9VA 2RT6A 4G6QA 5TKYA 3KAVA 2PY6A 4PO2A 1GN9A 4JWIA 1W9MA 2LM0A 4UDYX 4B9QA 2JNSA 1DKYA 2YIBA 3LMFA 4EZTA 3FD9A 4E3CA 1YUWA 1OA0A 2BPRA 3UITA 3C7NA 3OWGA 4M0MA 4EZXA 3B52X 2KHOA 3GI7A 4R5JA 1JQKA 3D2EA 3KDRA 1SU7A 4IM2A 4EZYA 4JWCA 4WV7A 4MQDA 4KIKB 4EZSA 3T4AG 3ER9B 5E84A 4EZVA 3O3OB 2QXLA 1UPXA 4H6IA 2OBLA 3ZEDA 4EZUA 4NPHA 4EZZA 4JLCA 3DOBA 4ILHB 4JNFA 3DPQA 3A98A 3OHXM 1CKRA 1E1DA 1DKXA 4HYBA 2NCZA 1Q5LA 3D2FA 3T46A 4EZNA 3H0XA 4WV5A 2OBMA 4ILGA 4JNEA 4IM0A 3B51X 3QA8A 4F00A 3RV0A 2YI8A 4JWDA 1OAOA 3ER8C 4R5LA 2WINM 4HR1B 4IWOA 4IWPA 2ND0A 3VEAA 4R5IA 3T48A 1BPRA 2EWFA 4IM3A 3N8EA 4EZWA 3SBSA 1E2UA 4FL9A 3DPPA 2YIAA 1SU8A 4IWQA 2X5CA 1GNTA 4KIKA 3VKHA 2QFFA 3B53X 3F7WA 2YI9A 3T49A 4EZPA 2OP6A 3QNJA 4EZOA 2ND1A 3C7NB 3VEBA 5FIGA 4I43A 4FM3A 4H6HA 1SUFA 5FLEX 4R5GA 3ZEFA 3RV1A 3DQGA 2YIVX 3I04A 4D8JA 3I39X 2V7YA 3DPOA 3O3MB 1DKZA 4E81A 3T47A 2GA9D 3KAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZR A;  3OHX M;  4EZT A;  1CKR A;  4EZW A;  1YUW A;  2BPR A;  1DKX A;  4HYB A;  3DPP A;  4JWE A;  1Q5L A;  4FL9 A;  3D2F A;  3C7N A;  3T46 A;  4EZN A;  3H0X A;  1U00 A;  4EZX A;  4WV5 A;  3L3O M;  4JNE A;  2KHO A;  4EZQ A;  4HY9 A;  4R5J A;  2QFF A;  3D2E A;  3N8E A;  7HSC A;  1DG4 A;  4R5K A;  4F01 A;  3T49 A;  4EZP A;  4EZY A;  3QNJ A;  4EZO A;  2OP6 A;  4JWC A;  4JN4 A;  4F00 A;  3C7N B;  4WV7 A;  4JWD A;  4R5L A;  4EZS A;  2WIN M;  4H6H A;  3T4A G;  5E84 A;  5TKY A;  4EZV A;  4B9Q A;  4R5G A;  4PO2 A;  2QXL A;  4JWI A;  4H6I A;  3DQG A;  4R5I A;  3T48 A;  1BPR A;  4EZU A;  4EZZ A;  2V7Y A;  3DPO A;  3DOB A;  1DKZ A;  4E81 A;  4JNF A;  3T47 A;  1DKY A;  3DPQ A; 
#chains in the Genus database with same CATH topology
 2GAF D;  3I01 A;  1Y2O A;  1U00 A;  2Z8Y A;  3EJS A;  3BLB A;  2OW6 A;  3CZN A;  4R5K A;  4JN4 A;  3DX1 A;  4AZB A;  3D52 A;  2FYV A;  1W9M A;  4B9Q A;  1QX1 A;  2YLA A;  3HAI A;  1R34 A;  3OWG A;  4M0M A;  3B52 X;  3QE6 A;  2X3W A;  3GI7 A;  3D2E A;  3KDR A;  4IM2 A;  4AKV A;  4JWC A;  3T4A G;  3O3O B;  2QXL A;  4AZ6 A;  4I1Q A;  4H6I A;  2OBL A;  3ZED A;  4EZU A;  4NPH A;  4AZI A;  4ILH B;  4AVM A;  4JNF A;  4AZG A;  1Q5L A;  2OBM A;  4IM0 A;  3QA8 A;  4AZ7 A;  3CKD A;  4F00 A;  3D50 A;  4FZS A;  1OAO A;  4IWO A;  2ND0 A;  3VEA A;  3Q84 A;  5C5B B;  3N8E A;  4EZW A;  3I2W A;  2Q12 A;  2YL6 A;  1SU8 A;  2X5C A;  2F7P A;  3LLL A;  3B53 X;  2D1L A;  3D4Y A;  4NQI A;  2ND1 A;  1PS3 A;  2GF4 A;  4DCN C;  3RV1 A;  1YWM A;  3DYT A;  3DPO A;  3KAW A;  3SBT B;  4ILI A;  2EFL A;  3EJP A;  1X03 A;  3ERC C;  4JL9 A;  4EZQ A;  4HY9 A;  1OA1 A;  2N3K A;  3D4Z A;  2RAI A;  1ZYL A;  3O3N B;  2RAJ A;  4DYL A;  2OO2 A;  2YL9 A;  2LM0 A;  2MI7 A;  3SOG A;  5KBP A;  4EZT A;  4WPC A;  2ALW A;  1YUW A;  3C7N A;  2F7R A;  4EZX A;  1X04 A;  2YL5 A;  1JQK A;  1TQS A;  3BVW A;  4FZP A;  4MQD A;  2Z0O A;  2Q13 A;  3QNI A;  4AZ5 A;  4EZV A;  3EJU A;  4EZZ A;  3Q0K A;  3DOB A;  1HWW A;  3OHX M;  4NSW A;  3M3W A;  3G9G A;  2NCZ A;  3D2F A;  3T46 A;  2PMR A;  3BUI A;  2YLL A;  3PLT A;  4JWD A;  4HR1 B;  3EJQ A;  4IWP A;  3T48 A;  4IM3 A;  1R5E A;  2X3V A;  1GNT A;  2QFF A;  2YI9 A;  3T49 A;  4EZP A;  5FIG A;  4H6H A;  4R5G A;  2D4C A;  4D8J A;  3DX4 A;  4E81 A;  3T47 A;  2F7Q A;  1GNL A;  4UDX X;  4AZH A;  4BNE A;  3L3O M;  1I4T A;  1MJG A;  2LXY A;  4IW0 A;  2OW7 A;  2RT6 A;  2EFK A;  5C5B A;  1O7D C;  3KAV A;  2PY6 A;  3HAH A;  4JWI A;  2O0I 1;  2X3X A;  3LVT A;  2JNS A;  1DKY A;  2ELB A;  1LQ7 A;  3LMF A;  3EJT A;  3FD9 A;  2F7O A;  4E3C A;  2BPR A;  3UIT A;  1URU A;  2F18 A;  2KHO A;  4R5J A;  1SU7 A;  2RAK A;  4EZY A;  3ABH A;  2Z0N A;  2WYI A;  4KIK B;  4EZS A;  3ER9 B;  3CV5 A;  2FIC A;  3DPQ A;  2C08 A;  1CKR A;  1E1D A;  3BUQ A;  1HXK A;  3DX2 A;  1DKX A;  4EZN A;  4ILG A;  3D51 A;  3B51 X;  3BUB A;  1I49 A;  2JNK A;  3DX0 A;  1TQV A;  3OK8 A;  4FL9 A;  3DPP A;  2YIA A;  3F7W A;  3DDF A;  1TQT A;  2OP6 A;  3QNJ A;  4EZO A;  4FM3 A;  1SUF A;  5FLE X;  3ZEF A;  2YIV X;  3I04 A;  2F1B A;  3I39 X;  2V7Y A;  3O3M B;  2GA9 D;  3L3P A;  4EZR A;  4ATM A;  3DX3 A;  4JWE A;  1TQU A;  4HR1 A;  1I4L A;  1SU6 A;  3EJR A;  7HSC A;  1DG4 A;  4F01 A;  2EX3 B;  3CZS A;  1E9V A;  3BUP A;  1QWN A;  4G6Q A;  5TKY A;  1ZWW A;  3SYV A;  4PO2 A;  1GN9 A;  2V0O A;  4UDY X;  2OZN B;  3QWE A;  1O7D B;  2YIB A;  1OA0 A;  1QWU A;  1TQW A;  3DDG A;  4WV7 A;  5E84 A;  3BVU A;  2QKW A;  3CAZ A;  1UPX A;  4JLC A;  3A98 A;  1I4D A;  2WYH A;  4WPE A;  2YL8 A;  4HYB A;  1HTY A;  4FZO A;  3H0X A;  2YKT A;  4WV5 A;  4JNE A;  2F1A A;  3RV0 A;  2YI8 A;  3ER8 C;  4R5L A;  3HAJ A;  2WIN M;  1WDZ A;  2Z0V A;  3BVV A;  4R5I A;  1BPR A;  2EWF A;  4H8S A;  3SBS A;  4AZC B;  1E2U A;  4IWQ A;  1R33 A;  4KIK A;  3VKH A;  3C7N B;  3VEB A;  3RPM A;  4I43 A;  3BVX A;  2ZXQ A;  4AZC A;  3BVT A;  3DQG A;  3CVR A;  3ACO A;  1DKZ A;  3BUD A; 
#chains in the Genus database with same CATH homology
 4EZR A;  4ILI A;  2GAF D;  3SBT B;  1GNL A;  3I01 A;  4UDX X;  4JWE A;  3ERC C;  1U00 A;  4JL9 A;  3L3O M;  2Z8Y A;  4EZQ A;  4HY9 A;  1OA1 A;  2N3K A;  4HR1 A;  1SU6 A;  7HSC A;  4R5K A;  1DG4 A;  1MJG A;  4F01 A;  1ZYL A;  2EX3 B;  4JN4 A;  3O3N B;  4IW0 A;  1E9V A;  2RT6 A;  4G6Q A;  5TKY A;  3KAV A;  2PY6 A;  4PO2 A;  1GN9 A;  4JWI A;  1W9M A;  2LM0 A;  4UDY X;  4B9Q A;  2JNS A;  1DKY A;  2YIB A;  3LMF A;  4EZT A;  3FD9 A;  4E3C A;  1YUW A;  1OA0 A;  2BPR A;  3UIT A;  3C7N A;  3OWG A;  4M0M A;  4EZX A;  3B52 X;  2KHO A;  3GI7 A;  4R5J A;  1JQK A;  3D2E A;  3KDR A;  1SU7 A;  4IM2 A;  4EZY A;  4JWC A;  4WV7 A;  4MQD A;  4KIK B;  4EZS A;  3T4A G;  3ER9 B;  5E84 A;  4EZV A;  3O3O B;  2QXL A;  1UPX A;  4H6I A;  2OBL A;  3ZED A;  4EZU A;  4NPH A;  4EZZ A;  4JLC A;  3DOB A;  4ILH B;  4JNF A;  3DPQ A;  3A98 A;  3OHX M;  1CKR A;  1E1D A;  1DKX A;  4HYB A;  2NCZ A;  1Q5L A;  3D2F A;  3T46 A;  4EZN A;  3H0X A;  4WV5 A;  2OBM A;  4ILG A;  4JNE A;  4IM0 A;  3B51 X;  3QA8 A;  4F00 A;  3RV0 A;  2YI8 A;  4JWD A;  1OAO A;  3ER8 C;  4R5L A;  2WIN M;  4HR1 B;  4IWO A;  4IWP A;  2ND0 A;  3VEA A;  4R5I A;  3T48 A;  1BPR A;  2EWF A;  4IM3 A;  3N8E A;  4EZW A;  3SBS A;  1E2U A;  4FL9 A;  3DPP A;  2YIA A;  1SU8 A;  4IWQ A;  2X5C A;  1GNT A;  4KIK A;  3VKH A;  2QFF A;  3B53 X;  3F7W A;  2YI9 A;  3T49 A;  4EZP A;  2OP6 A;  3QNJ A;  4EZO A;  2ND1 A;  3C7N B;  3VEB A;  5FIG A;  4I43 A;  4FM3 A;  4H6H A;  1SUF A;  5FLE X;  4R5G A;  3ZEF A;  3RV1 A;  3DQG A;  2YIV X;  3I04 A;  4D8J A;  3I39 X;  2V7Y A;  3DPO A;  3O3M B;  1DKZ A;  4E81 A;  3T47 A;  2GA9 D;  3KAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...