4EZYA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrliltg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 71
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezyA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezyA01
7HSCA 4R5JA 3DPOA 3T48A 3D2EA 3QNJA 3T49A 2BPRA 3OHXM 2QFFA 2KHOA 2OP6A 1DG4A 3L3OM 4F00A 1BPRA 4JWCA 4R5IA 3T46A 4EZOA 4PO2A 3DQGA 3C7NA 4JWEA 3T4AG 4H6HA 1Q5LA 4H6IA 5TKYA 4EZWA 4JWDA 4EZNA 5E84A 4EZRA 3DOBA 4WV7A 4EZTA 4E81A 1CKRA 4B9QA 4EZVA 4F01A 2V7YA 4JNFA 4R5KA 4EZYA 4EZQA 2QXLA 4EZZA 3H0XA 3T47A 3DPPA 1U00A 1DKZA 4JNEA 1DKXA 4EZUA 4HY9A 4EZPA 4FL9A 4R5GA 4WV5A 3D2FA 3DPQA 4JWIA 1DKYA 4HYBA 2WINM 4EZXA 3N8EA 4R5LA 3C7NB 4JN4A 4EZSA 1YUWA
chains in the Genus database with same CATH superfamily
2OW6A 3CAZA 2GF4A 3OWGA 1I4TA 4JWDA 3VEBA 1E1DA 1HWWA 1ZWWA 3EJPA 2C08A 3DX4A 2ZXQA 3C7NB 4JN4A 1YUWA 2YLAA 3D2EA 1HTYA 4AZ6A 2D4CA 2KHOA 3D50A 5C5BA 4JWCA 4EZOA 3CV5A 2D1LA 4H8SA 2V0OA 4R5KA 4IWPA 3BVXA 1R34A 1X04A 1MJGA 3EJQA 2JNSA 4IM0A 4EZSA 3A98A 4G6QA 4FM3A 3D4YA 3ER9B 2RT6A 4FZPA 5TKYA 2YLLA 4WV7A 4EZTA 1URUA 3EJRA 4E3CA 3RV1A 1TQTA 3ABHA 3DDGA 4ATMA 3BUIA 2FYVA 2RAJA 4AZBA 4IW0A 2YIBA 3GI7A 2OZNB 2YL8A 3T49A 2NCZA 4JWEA 2ALWA 1CKRA 4EZVA 3EJSA 1DKXA 4EZUA 2EWFA 2X5CA 2YL6A 3CKDA 1OAOA 4ILIA 2EX3B 2F1BA 3EJTA 3QNJA 3CVRA 1HXKA 2QFFA 1GNTA 2F7QA 4D8JA 1R5EA 1Q5LA 3BUBA 2LM0A 2QKWA 4I1QA 1WDZA 4AKVA 1DKZA 4JNEA 4EZPA 5FIGA 2LXYA 3DX3A 3B53X 3BUQA 2ND1A 4DYLA 3D52A 4IWOA 2YIAA 2RAKA 3ZEFA 4AZCB 2OO2A 2ELBA 3KAVA 3HAJA 3DPPA 3QWEA 2WYIA 4MQDA 3T48A 4I43A 3OK8A 4AZGA 1GN9A 2Z0OA 3LVTA 1SU7A 3ER8C 2F7OA 2YL5A 1U00A 2F18A 5C5BB 3BVUA 3DPQA 1TQWA 4NSWA 3O3NB 1QWUA 2GAFD 3I39X 4AZHA 2JNKA 1BPRA 4R5IA 3FD9A 3L3PA 4EZWA 2ND0A 2OW7A 3HAHA 4HR1A 2F7RA 2QXLA 4ILHB 4AZ5A 3B51X 1I4LA 3KDRA 4KIKA 1TQUA 2EFKA 4NPHA 1SUFA 3CZNA 4HR1B 3F7WA 2X3VA 3LLLA 1OA0A 3VEAA 4KIKB 1SU6A 2V7YA 2F7PA 3SBSA 3SYVA 1DKYA 4HYBA 4AVMA 3BVTA 3ERCC 3B52X 2Q12A 3OHXM 4BNEA 1W9MA 1DG4A 3UITA 3KAWA 3DQGA 1R33A 3M3WA 3I01A 3DDFA 3DYTA 4EZYA 3BUDA 3QE6A 1E9VA 4AZ7A 4HY9A 4R5GA 1YWMA 4EZXA 4R5JA 3DPOA 1I49A 4IWQA 2FICA 2RAIA 3CZSA 4IM2A 3SBTB 3BVWA 3T4AG 3ZEDA 5KBPA 4EZNA 4DCNC 4B9QA 4JNFA 1I4DA 3T47A 3D51A 4JWIA 2OBLA 4R5LA 1ZYLA 1SU8A 3HAIA 2GA9D 1TQSA 1QWNA 3I04A 2BPRA 2OP6A 1PS3A 4FZOA 2YI8A 2MI7A 3C7NA 4NQIA 2YIVX 2PY6A 1O7DC 2EFLA 2O0I1 3H0XA 3RV0A 3QA8A 4M0MA 3DX0A 3LMFA 3G9GA 1O7DB 4PO2A 4H6HA 1QX1A 4H6IA 3BLBA 2X3WA 1GNLA 4UDYX 4EZZA 4WV5A 3D2FA 2WINM 3VKHA 4ILGA 1OA1A 3PLTA 7HSCA 3Q84A 3BUPA 4WPEA 3L3OM 2X3XA 3O3MB 2Z0NA 3RPMA 1X03A 2Z8YA 3O3OB 1JQKA 4AZIA 4EZQA 3D4ZA 4IM3A 4FL9A 2PMRA 1E2UA 4JLCA 3EJUA 4WPCA 1LQ7A 2OBMA 3DX2A 2YL9A 3DOBA 5E84A 2N3KA 2YKTA 3ACOA 2Q13A 3BVVA 5FLEX 3DX1A 2F1AA 3N8EA 2WYHA 4UDXX 2Z0VA 4JL9A 1UPXA 4F00A 3T46A 4EZRA 4AZCA 4E81A 3SOGA 3Q0KA 4F01A 4FZSA 3I2WA 2YI9A 3QNIA 1Y2OA 1TQVA
chains in the Genus database with same CATH topology
2EX3B 4HR1B 3QNJA 3F7WA 3VEAA 3LMFA 1OA0A 2QFFA 1GNTA 3OWGA 4KIKB 4D8JA 4PO2A 1SU6A 4H6HA 1Q5LA 4H6IA 4JWDA 2LM0A 3VEBA 1E1DA 1GNLA 2V7YA 4UDYX 4EZZA 1DKZA 3SBSA 4JNEA 4WV5A 4EZPA 5FIGA 3D2FA 1DKYA 4HYBA 2WINM 3B53X 2ND1A 3VKHA 3C7NB 4ILGA 3ERCC 3B52X 1OA1A 4IWOA 4JN4A 1YUWA 7HSCA 2YIAA 3ZEFA 3D2EA 3OHXM 1W9MA 2KHOA 1DG4A 3L3OM 3UITA 3O3MB 4JWCA 4EZOA 3KAWA 3DQGA 3KAVA 3I01A 2Z8YA 3O3OB 1JQKA 4R5KA 4EZYA 4EZQA 1E9VA 3DPPA 4IM3A 4IWPA 4HY9A 4FL9A 4R5GA 1MJGA 4EZXA 2JNSA 4MQDA 4IM0A 1E2UA 3T48A 4EZSA 3A98A 4R5JA 4JLCA 4I43A 3DPOA 4G6QA 4FM3A 2OBMA 4IWQA 4IM2A 1GN9A 3ER9B 3SBTB 2RT6A 3ZEDA 1SU7A 3T4AG 5TKYA 4EZNA 3DOBA 5E84A 4WV7A 4EZTA 2N3KA 4B9QA 4E3CA 3ER8C 4JNFA 3RV1A 3T47A 1U00A 5FLEX 3DPQA 4JWIA 2OBLA 3N8EA 4R5LA 1ZYLA 1SU8A 4UDXX 2GA9D 3O3NB 2GAFD 3I39X 4IW0A 2YIBA 3GI7A 3I04A 4JL9A 3T49A 2BPRA 2OP6A 1UPXA 2NCZA 4F00A 1BPRA 3T46A 4R5IA 2YI8A 3C7NA 4JWEA 2YIVX 3FD9A 4EZWA 2PY6A 2ND0A 4EZRA 1CKRA 4E81A 4EZVA 4F01A 4HR1A 2QXLA 3H0XA 4ILHB 3B51X 3KDRA 3RV0A 4KIKA 1DKXA 4EZUA 2EWFA 2X5CA 4NPHA 2YI9A 1SUFA 3QA8A 4M0MA 1OAOA 4ILIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7HSC A;  4R5J A;  3DPO A;  3T48 A;  3D2E A;  3QNJ A;  3T49 A;  2BPR A;  3OHX M;  2QFF A;  2KHO A;  2OP6 A;  1DG4 A;  3L3O M;  4F00 A;  1BPR A;  4JWC A;  4R5I A;  3T46 A;  4EZO A;  4PO2 A;  3DQG A;  3C7N A;  4JWE A;  3T4A G;  4H6H A;  1Q5L A;  4H6I A;  5TKY A;  4EZW A;  4JWD A;  4EZN A;  5E84 A;  4EZR A;  3DOB A;  4WV7 A;  4EZT A;  4E81 A;  1CKR A;  4B9Q A;  4EZV A;  4F01 A;  2V7Y A;  4JNF A;  4R5K A;  4EZY A;  4EZQ A;  2QXL A;  4EZZ A;  3H0X A;  3T47 A;  3DPP A;  1U00 A;  1DKZ A;  4JNE A;  1DKX A;  4EZU A;  4HY9 A;  4EZP A;  4FL9 A;  4R5G A;  4WV5 A;  3D2F A;  3DPQ A;  4JWI A;  1DKY A;  4HYB A;  2WIN M;  4EZX A;  3N8E A;  4R5L A;  3C7N B;  4JN4 A;  4EZS A;  1YUW A; 
#chains in the Genus database with same CATH topology
 2OW6 A;  3CAZ A;  2GF4 A;  3OWG A;  1I4T A;  4JWD A;  3VEB A;  1E1D A;  1HWW A;  1ZWW A;  3EJP A;  2C08 A;  3DX4 A;  2ZXQ A;  3C7N B;  4JN4 A;  1YUW A;  2YLA A;  3D2E A;  1HTY A;  4AZ6 A;  2D4C A;  2KHO A;  3D50 A;  5C5B A;  4JWC A;  4EZO A;  3CV5 A;  2D1L A;  4H8S A;  2V0O A;  4R5K A;  4IWP A;  3BVX A;  1R34 A;  1X04 A;  1MJG A;  3EJQ A;  2JNS A;  4IM0 A;  4EZS A;  3A98 A;  4G6Q A;  4FM3 A;  3D4Y A;  3ER9 B;  2RT6 A;  4FZP A;  5TKY A;  2YLL A;  4WV7 A;  4EZT A;  1URU A;  3EJR A;  4E3C A;  3RV1 A;  1TQT A;  3ABH A;  3DDG A;  4ATM A;  3BUI A;  2FYV A;  2RAJ A;  4AZB A;  4IW0 A;  2YIB A;  3GI7 A;  2OZN B;  2YL8 A;  3T49 A;  2NCZ A;  4JWE A;  2ALW A;  1CKR A;  4EZV A;  3EJS A;  1DKX A;  4EZU A;  2EWF A;  2X5C A;  2YL6 A;  3CKD A;  1OAO A;  4ILI A;  2EX3 B;  2F1B A;  3EJT A;  3QNJ A;  3CVR A;  1HXK A;  2QFF A;  1GNT A;  2F7Q A;  4D8J A;  1R5E A;  1Q5L A;  3BUB A;  2LM0 A;  2QKW A;  4I1Q A;  1WDZ A;  4AKV A;  1DKZ A;  4JNE A;  4EZP A;  5FIG A;  2LXY A;  3DX3 A;  3B53 X;  3BUQ A;  2ND1 A;  4DYL A;  3D52 A;  4IWO A;  2YIA A;  2RAK A;  3ZEF A;  4AZC B;  2OO2 A;  2ELB A;  3KAV A;  3HAJ A;  3DPP A;  3QWE A;  2WYI A;  4MQD A;  3T48 A;  4I43 A;  3OK8 A;  4AZG A;  1GN9 A;  2Z0O A;  3LVT A;  1SU7 A;  3ER8 C;  2F7O A;  2YL5 A;  1U00 A;  2F18 A;  5C5B B;  3BVU A;  3DPQ A;  1TQW A;  4NSW A;  3O3N B;  1QWU A;  2GAF D;  3I39 X;  4AZH A;  2JNK A;  1BPR A;  4R5I A;  3FD9 A;  3L3P A;  4EZW A;  2ND0 A;  2OW7 A;  3HAH A;  4HR1 A;  2F7R A;  2QXL A;  4ILH B;  4AZ5 A;  3B51 X;  1I4L A;  3KDR A;  4KIK A;  1TQU A;  2EFK A;  4NPH A;  1SUF A;  3CZN A;  4HR1 B;  3F7W A;  2X3V A;  3LLL A;  1OA0 A;  3VEA A;  4KIK B;  1SU6 A;  2V7Y A;  2F7P A;  3SBS A;  3SYV A;  1DKY A;  4HYB A;  4AVM A;  3BVT A;  3ERC C;  3B52 X;  2Q12 A;  3OHX M;  4BNE A;  1W9M A;  1DG4 A;  3UIT A;  3KAW A;  3DQG A;  1R33 A;  3M3W A;  3I01 A;  3DDF A;  3DYT A;  4EZY A;  3BUD A;  3QE6 A;  1E9V A;  4AZ7 A;  4HY9 A;  4R5G A;  1YWM A;  4EZX A;  4R5J A;  3DPO A;  1I49 A;  4IWQ A;  2FIC A;  2RAI A;  3CZS A;  4IM2 A;  3SBT B;  3BVW A;  3T4A G;  3ZED A;  5KBP A;  4EZN A;  4DCN C;  4B9Q A;  4JNF A;  1I4D A;  3T47 A;  3D51 A;  4JWI A;  2OBL A;  4R5L A;  1ZYL A;  1SU8 A;  3HAI A;  2GA9 D;  1TQS A;  1QWN A;  3I04 A;  2BPR A;  2OP6 A;  1PS3 A;  4FZO A;  2YI8 A;  2MI7 A;  3C7N A;  4NQI A;  2YIV X;  2PY6 A;  1O7D C;  2EFL A;  2O0I 1;  3H0X A;  3RV0 A;  3QA8 A;  4M0M A;  3DX0 A;  3LMF A;  3G9G A;  1O7D B;  4PO2 A;  4H6H A;  1QX1 A;  4H6I A;  3BLB A;  2X3W A;  1GNL A;  4UDY X;  4EZZ A;  4WV5 A;  3D2F A;  2WIN M;  3VKH A;  4ILG A;  1OA1 A;  3PLT A;  7HSC A;  3Q84 A;  3BUP A;  4WPE A;  3L3O M;  2X3X A;  3O3M B;  2Z0N A;  3RPM A;  1X03 A;  2Z8Y A;  3O3O B;  1JQK A;  4AZI A;  4EZQ A;  3D4Z A;  4IM3 A;  4FL9 A;  2PMR A;  1E2U A;  4JLC A;  3EJU A;  4WPC A;  1LQ7 A;  2OBM A;  3DX2 A;  2YL9 A;  3DOB A;  5E84 A;  2N3K A;  2YKT A;  3ACO A;  2Q13 A;  3BVV A;  5FLE X;  3DX1 A;  2F1A A;  3N8E A;  2WYH A;  4UDX X;  2Z0V A;  4JL9 A;  1UPX A;  4F00 A;  3T46 A;  4EZR A;  4AZC A;  4E81 A;  3SOG A;  3Q0K A;  4F01 A;  4FZS A;  3I2W A;  2YI9 A;  3QNI A;  1Y2O A;  1TQV A; 
#chains in the Genus database with same CATH homology
 2EX3 B;  4HR1 B;  3QNJ A;  3F7W A;  3VEA A;  3LMF A;  1OA0 A;  2QFF A;  1GNT A;  3OWG A;  4KIK B;  4D8J A;  4PO2 A;  1SU6 A;  4H6H A;  1Q5L A;  4H6I A;  4JWD A;  2LM0 A;  3VEB A;  1E1D A;  1GNL A;  2V7Y A;  4UDY X;  4EZZ A;  1DKZ A;  3SBS A;  4JNE A;  4WV5 A;  4EZP A;  5FIG A;  3D2F A;  1DKY A;  4HYB A;  2WIN M;  3B53 X;  2ND1 A;  3VKH A;  3C7N B;  4ILG A;  3ERC C;  3B52 X;  1OA1 A;  4IWO A;  4JN4 A;  1YUW A;  7HSC A;  2YIA A;  3ZEF A;  3D2E A;  3OHX M;  1W9M A;  2KHO A;  1DG4 A;  3L3O M;  3UIT A;  3O3M B;  4JWC A;  4EZO A;  3KAW A;  3DQG A;  3KAV A;  3I01 A;  2Z8Y A;  3O3O B;  1JQK A;  4R5K A;  4EZY A;  4EZQ A;  1E9V A;  3DPP A;  4IM3 A;  4IWP A;  4HY9 A;  4FL9 A;  4R5G A;  1MJG A;  4EZX A;  2JNS A;  4MQD A;  4IM0 A;  1E2U A;  3T48 A;  4EZS A;  3A98 A;  4R5J A;  4JLC A;  4I43 A;  3DPO A;  4G6Q A;  4FM3 A;  2OBM A;  4IWQ A;  4IM2 A;  1GN9 A;  3ER9 B;  3SBT B;  2RT6 A;  3ZED A;  1SU7 A;  3T4A G;  5TKY A;  4EZN A;  3DOB A;  5E84 A;  4WV7 A;  4EZT A;  2N3K A;  4B9Q A;  4E3C A;  3ER8 C;  4JNF A;  3RV1 A;  3T47 A;  1U00 A;  5FLE X;  3DPQ A;  4JWI A;  2OBL A;  3N8E A;  4R5L A;  1ZYL A;  1SU8 A;  4UDX X;  2GA9 D;  3O3N B;  2GAF D;  3I39 X;  4IW0 A;  2YIB A;  3GI7 A;  3I04 A;  4JL9 A;  3T49 A;  2BPR A;  2OP6 A;  1UPX A;  2NCZ A;  4F00 A;  1BPR A;  3T46 A;  4R5I A;  2YI8 A;  3C7N A;  4JWE A;  2YIV X;  3FD9 A;  4EZW A;  2PY6 A;  2ND0 A;  4EZR A;  1CKR A;  4E81 A;  4EZV A;  4F01 A;  4HR1 A;  2QXL A;  3H0X A;  4ILH B;  3B51 X;  3KDR A;  3RV0 A;  4KIK A;  1DKX A;  4EZU A;  2EWF A;  2X5C A;  4NPH A;  2YI9 A;  1SUF A;  3QA8 A;  4M0M A;  1OAO A;  4ILI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...