4R5GA

Crystal structure of the dnak c-terminus with the inhibitor pet-16
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
218
Chain Sequence
MHHHHHHIEGRLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/chaperone inhibitor
molecule keywords Chaperone protein DnaK
total genus 40
structure length 218
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5gA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5gA01
4EZWA 3T46A 3DPQA 4F01A 1BPRA 3C7NB 4H6HA 3T47A 4EZXA 2V7YA 4R5IA 4H6IA 1YUWA 1DKZA 3D2FA 7HSCA 2OP6A 3DQGA 2QFFA 4JNFA 4EZTA 4B9QA 4EZYA 3T4AG 4EZZA 4EZSA 1DKYA 3H0XA 3DOBA 3QNJA 4R5JA 4R5LA 2WINM 2BPRA 1DKXA 4R5KA 3OHXM 4F00A 4JNEA 4EZRA 1CKRA 5TKYA 3DPPA 3D2EA 4WV5A 4HYBA 5E84A 2KHOA 4EZUA 2QXLA 4HY9A 4JN4A 1U00A 4JWCA 3T49A 3C7NA 4EZPA 4PO2A 3DPOA 4JWDA 4R5GA 4E81A 4EZOA 4EZQA 1Q5LA 3N8EA 1DG4A 4EZVA 4JWEA 4JWIA 3T48A 3L3OM 4WV7A 4EZNA 4FL9A
chains in the Genus database with same CATH superfamily
3T46A 3C7NB 3CZSA 1BPRA 4H6HA 3SOGA 4WPCA 4AKVA 4H6IA 4IWPA 3D2FA 2WYIA 3BUPA 3EJPA 2NCZA 3HAJA 2Q12A 3QE6A 4JNFA 3CZNA 3I2WA 4NSWA 3T4AG 2YL8A 1QWUA 2PMRA 4HR1A 4B9QA 4EZYA 3H0XA 4FL9A 2OZNB 4R5JA 4AZ6A 4FZSA 3F7WA 4R5LA 4R5KA 1O7DB 2RAJA 3OHXM 2YIVX 4DYLA 1CKRA 5TKYA 4AZGA 5C5BB 1I4TA 2QKWA 3O3NB 3CV5A 3VKHA 1TQTA 2YL5A 4JN4A 3T49A 3Q84A 2RAKA 3C7NA 1I4LA 3DPOA 4AVMA 3RV0A 3O3MB 4DCNC 4EZQA 3B52X 4KIKB 4EZVA 3A98A 1E2UA 3OWGA 4IM2A 5C5BA 1SUFA 3EJRA 2YI8A 3Q0KA 1MJGA 4AZ7A 2LXYA 3OK8A 3CAZA 2F7RA 4ATMA 3DPQA 2F7OA 2RAIA 3BVUA 3KAVA 4UDXX 4R5IA 1E9VA 1URUA 1I4DA 2JNSA 3BUDA 3HAHA 4IM0A 3ER9B 4UDYX 1YUWA 3BVVA 7HSCA 1GNLA 1OA1A 3D50A 2F7QA 3DX1A 4EZSA 2F1BA 3EJUA 3PLTA 1DKXA 4AZBA 4ILGA 4H8SA 3EJQA 4I1QA 3BVWA 2V0OA 3FD9A 4FM3A 3LVTA 1TQWA 1X04A 1Y2OA 2GA9D 3EJTA 1HXKA 2KHOA 4WPEA 4ILHB 2QXLA 4JLCA 2D1LA 3G9GA 3I04A 3ABHA 4IW0A 3CVRA 3KAWA 3I39X 4PO2A 2ND0A 3ZEFA 4M0MA 3DX0A 1ZWWA 4G6QA 2ALWA 2N3KA 4JWIA 2OW6A 1QX1A 3DDFA 3T48A 1JQKA 2ELBA 3B51X 2PY6A 4WV7A 5FLEX 4EZWA 3BUQA 4F01A 2YIAA 4EZXA 2V7YA 4MQDA 4NPHA 4FZOA 1DKZA 1R34A 2ZXQA 2OP6A 3DQGA 1OA0A 1ZYLA 1YWMA 2F1AA 2WYHA 4EZZA 1DKYA 2JNKA 4AZHA 2Q13A 2Z8YA 3ZEDA 5KBPA 2BPRA 2WINM 1TQVA 4NQIA 1W9MA 4F00A 4JNEA 1O7DC 2X5CA 4EZRA 1I49A 3DPPA 3D2EA 4IWQA 4BNEA 4WV5A 2YIBA 4HYBA 2C08A 2OBMA 4IWOA 5E84A 3QWEA 3L3PA 3RV1A 3N8EA 4JWCA 2LM0A 4EZPA 4JWDA 4R5GA 4E81A 2YI9A 1DG4A 4JWEA 3DX3A 4AZCA 4FZPA 4ILIA 3BVTA 3DX2A 4E3CA 3LMFA 4D8JA 1LQ7A 3L3OM 1E1DA 2OW7A 2X3WA 4JL9A 4EZNA 1WDZA 3BUIA 2EFKA 2YKTA 4KIKA 1TQSA 2Z0OA 2X3XA 3VEAA 3T47A 3D52A 3KDRA 3VEBA 3HAIA 3CKDA 3D4ZA 1R33A 4AZCB 2ND1A 3ACOA 3BVXA 3M3WA 3DYTA 3DX4A 3QA8A 1QWNA 1UPXA 2QFFA 1X03A 2F18A 3D51A 4EZTA 3ERCC 3I01A 1OAOA 2YL9A 2OBLA 3DDGA 1GNTA 3O3OB 3QNJA 3QNIA 3DOBA 3BLBA 4AZ5A 1R5EA 2O0I1 2YLAA 2D4CA 4HR1B 2GAFD 1SU7A 2F7PA 4IM3A 3SBSA 3SBTB 1TQUA 4EZUA 2YL6A 2FYVA 4HY9A 1U00A 2RT6A 2EFLA 3ER8C 1GN9A 3BUBA 3B53X 3RPMA 3UITA 3LLLA 4EZOA 4I43A 2Z0NA 1Q5LA 3EJSA 2EWFA 4AZIA 2X3VA 2EX3B 1HWWA 2FICA 1SU6A 2GF4A 2MI7A 3D4YA 5FIGA 2OO2A 2Z0VA 1SU8A 3SYVA 1PS3A 3GI7A 2YLLA 1HTYA
chains in the Genus database with same CATH topology
3T46A 3C7NB 1BPRA 4H6HA 4H6IA 4IWPA 3D2FA 2NCZA 4JNFA 4B9QA 4EZYA 3T4AG 3H0XA 4HR1A 4R5JA 4R5LA 3F7WA 4R5KA 3OHXM 2YIVX 1CKRA 5TKYA 3O3NB 3VKHA 4JN4A 3T49A 3C7NA 3DPOA 3RV0A 3O3MB 4EZQA 3B52X 4KIKB 4EZVA 3A98A 1E2UA 3OWGA 4IM2A 1SUFA 2YI8A 1MJGA 3DPQA 3KAVA 4UDXX 4R5IA 1E9VA 1YUWA 3ER9B 2JNSA 4IM0A 7HSCA 4UDYX 1GNLA 1OA1A 4EZSA 1DKXA 4ILGA 3FD9A 4FM3A 2GA9D 2KHOA 4ILHB 2QXLA 4JLCA 3I04A 4PO2A 4IW0A 3KAWA 3I39X 2ND0A 3ZEFA 4M0MA 4G6QA 2N3KA 4JWIA 3T48A 1JQKA 3B51X 2PY6A 4WV7A 5FLEX 4EZWA 4F01A 2YIAA 4EZXA 2V7YA 4MQDA 4NPHA 1DKZA 2OP6A 3DQGA 1OA0A 1ZYLA 4EZZA 1DKYA 2Z8YA 3ZEDA 2BPRA 2WINM 1W9MA 4F00A 4JNEA 2X5CA 4EZRA 4IWQA 3DPPA 3D2EA 4WV5A 2YIBA 4HYBA 2OBMA 4IWOA 5E84A 3RV1A 3N8EA 4JWCA 2LM0A 4EZPA 4JWDA 4R5GA 4E81A 2YI9A 1DG4A 4JWEA 4ILIA 4E3CA 3LMFA 4D8JA 3L3OM 1E1DA 4JL9A 4EZNA 4KIKA 3VEAA 3VEBA 3T47A 3KDRA 2ND1A 3QA8A 1UPXA 2QFFA 4EZTA 3ERCC 3I01A 1OAOA 3O3OB 2OBLA 3DOBA 1GNTA 3QNJA 4HR1B 2GAFD 1SU7A 4IM3A 3SBSA 3SBTB 4EZUA 4HY9A 1U00A 2RT6A 3ER8C 1GN9A 3B53X 3UITA 4EZOA 4I43A 1Q5LA 2EWFA 5FIGA 2EX3B 1SU6A 1SU8A 3GI7A 4FL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZW A;  3T46 A;  3DPQ A;  4F01 A;  1BPR A;  3C7N B;  4H6H A;  3T47 A;  4EZX A;  2V7Y A;  4R5I A;  4H6I A;  1YUW A;  1DKZ A;  3D2F A;  7HSC A;  2OP6 A;  3DQG A;  2QFF A;  4JNF A;  4EZT A;  4B9Q A;  4EZY A;  3T4A G;  4EZZ A;  4EZS A;  1DKY A;  3H0X A;  3DOB A;  3QNJ A;  4R5J A;  4R5L A;  2WIN M;  2BPR A;  1DKX A;  4R5K A;  3OHX M;  4F00 A;  4JNE A;  4EZR A;  1CKR A;  5TKY A;  3DPP A;  3D2E A;  4WV5 A;  4HYB A;  5E84 A;  2KHO A;  4EZU A;  2QXL A;  4HY9 A;  4JN4 A;  1U00 A;  4JWC A;  3T49 A;  3C7N A;  4EZP A;  4PO2 A;  3DPO A;  4JWD A;  4R5G A;  4E81 A;  4EZO A;  4EZQ A;  1Q5L A;  3N8E A;  1DG4 A;  4EZV A;  4JWE A;  4JWI A;  3T48 A;  3L3O M;  4WV7 A;  4EZN A;  4FL9 A; 
#chains in the Genus database with same CATH topology
 3T46 A;  3C7N B;  3CZS A;  1BPR A;  4H6H A;  3SOG A;  4WPC A;  4AKV A;  4H6I A;  4IWP A;  3D2F A;  2WYI A;  3BUP A;  3EJP A;  2NCZ A;  3HAJ A;  2Q12 A;  3QE6 A;  4JNF A;  3CZN A;  3I2W A;  4NSW A;  3T4A G;  2YL8 A;  1QWU A;  2PMR A;  4HR1 A;  4B9Q A;  4EZY A;  3H0X A;  4FL9 A;  2OZN B;  4R5J A;  4AZ6 A;  4FZS A;  3F7W A;  4R5L A;  4R5K A;  1O7D B;  2RAJ A;  3OHX M;  2YIV X;  4DYL A;  1CKR A;  5TKY A;  4AZG A;  5C5B B;  1I4T A;  2QKW A;  3O3N B;  3CV5 A;  3VKH A;  1TQT A;  2YL5 A;  4JN4 A;  3T49 A;  3Q84 A;  2RAK A;  3C7N A;  1I4L A;  3DPO A;  4AVM A;  3RV0 A;  3O3M B;  4DCN C;  4EZQ A;  3B52 X;  4KIK B;  4EZV A;  3A98 A;  1E2U A;  3OWG A;  4IM2 A;  5C5B A;  1SUF A;  3EJR A;  2YI8 A;  3Q0K A;  1MJG A;  4AZ7 A;  2LXY A;  3OK8 A;  3CAZ A;  2F7R A;  4ATM A;  3DPQ A;  2F7O A;  2RAI A;  3BVU A;  3KAV A;  4UDX X;  4R5I A;  1E9V A;  1URU A;  1I4D A;  2JNS A;  3BUD A;  3HAH A;  4IM0 A;  3ER9 B;  4UDY X;  1YUW A;  3BVV A;  7HSC A;  1GNL A;  1OA1 A;  3D50 A;  2F7Q A;  3DX1 A;  4EZS A;  2F1B A;  3EJU A;  3PLT A;  1DKX A;  4AZB A;  4ILG A;  4H8S A;  3EJQ A;  4I1Q A;  3BVW A;  2V0O A;  3FD9 A;  4FM3 A;  3LVT A;  1TQW A;  1X04 A;  1Y2O A;  2GA9 D;  3EJT A;  1HXK A;  2KHO A;  4WPE A;  4ILH B;  2QXL A;  4JLC A;  2D1L A;  3G9G A;  3I04 A;  3ABH A;  4IW0 A;  3CVR A;  3KAW A;  3I39 X;  4PO2 A;  2ND0 A;  3ZEF A;  4M0M A;  3DX0 A;  1ZWW A;  4G6Q A;  2ALW A;  2N3K A;  4JWI A;  2OW6 A;  1QX1 A;  3DDF A;  3T48 A;  1JQK A;  2ELB A;  3B51 X;  2PY6 A;  4WV7 A;  5FLE X;  4EZW A;  3BUQ A;  4F01 A;  2YIA A;  4EZX A;  2V7Y A;  4MQD A;  4NPH A;  4FZO A;  1DKZ A;  1R34 A;  2ZXQ A;  2OP6 A;  3DQG A;  1OA0 A;  1ZYL A;  1YWM A;  2F1A A;  2WYH A;  4EZZ A;  1DKY A;  2JNK A;  4AZH A;  2Q13 A;  2Z8Y A;  3ZED A;  5KBP A;  2BPR A;  2WIN M;  1TQV A;  4NQI A;  1W9M A;  4F00 A;  4JNE A;  1O7D C;  2X5C A;  4EZR A;  1I49 A;  3DPP A;  3D2E A;  4IWQ A;  4BNE A;  4WV5 A;  2YIB A;  4HYB A;  2C08 A;  2OBM A;  4IWO A;  5E84 A;  3QWE A;  3L3P A;  3RV1 A;  3N8E A;  4JWC A;  2LM0 A;  4EZP A;  4JWD A;  4R5G A;  4E81 A;  2YI9 A;  1DG4 A;  4JWE A;  3DX3 A;  4AZC A;  4FZP A;  4ILI A;  3BVT A;  3DX2 A;  4E3C A;  3LMF A;  4D8J A;  1LQ7 A;  3L3O M;  1E1D A;  2OW7 A;  2X3W A;  4JL9 A;  4EZN A;  1WDZ A;  3BUI A;  2EFK A;  2YKT A;  4KIK A;  1TQS A;  2Z0O A;  2X3X A;  3VEA A;  3T47 A;  3D52 A;  3KDR A;  3VEB A;  3HAI A;  3CKD A;  3D4Z A;  1R33 A;  4AZC B;  2ND1 A;  3ACO A;  3BVX A;  3M3W A;  3DYT A;  3DX4 A;  3QA8 A;  1QWN A;  1UPX A;  2QFF A;  1X03 A;  2F18 A;  3D51 A;  4EZT A;  3ERC C;  3I01 A;  1OAO A;  2YL9 A;  2OBL A;  3DDG A;  1GNT A;  3O3O B;  3QNJ A;  3QNI A;  3DOB A;  3BLB A;  4AZ5 A;  1R5E A;  2O0I 1;  2YLA A;  2D4C A;  4HR1 B;  2GAF D;  1SU7 A;  2F7P A;  4IM3 A;  3SBS A;  3SBT B;  1TQU A;  4EZU A;  2YL6 A;  2FYV A;  4HY9 A;  1U00 A;  2RT6 A;  2EFL A;  3ER8 C;  1GN9 A;  3BUB A;  3B53 X;  3RPM A;  3UIT A;  3LLL A;  4EZO A;  4I43 A;  2Z0N A;  1Q5L A;  3EJS A;  2EWF A;  4AZI A;  2X3V A;  2EX3 B;  1HWW A;  2FIC A;  1SU6 A;  2GF4 A;  2MI7 A;  3D4Y A;  5FIG A;  2OO2 A;  2Z0V A;  1SU8 A;  3SYV A;  1PS3 A;  3GI7 A;  2YLL A;  1HTY A; 
#chains in the Genus database with same CATH homology
 3T46 A;  3C7N B;  1BPR A;  4H6H A;  4H6I A;  4IWP A;  3D2F A;  2NCZ A;  4JNF A;  4B9Q A;  4EZY A;  3T4A G;  3H0X A;  4HR1 A;  4R5J A;  4R5L A;  3F7W A;  4R5K A;  3OHX M;  2YIV X;  1CKR A;  5TKY A;  3O3N B;  3VKH A;  4JN4 A;  3T49 A;  3C7N A;  3DPO A;  3RV0 A;  3O3M B;  4EZQ A;  3B52 X;  4KIK B;  4EZV A;  3A98 A;  1E2U A;  3OWG A;  4IM2 A;  1SUF A;  2YI8 A;  1MJG A;  3DPQ A;  3KAV A;  4UDX X;  4R5I A;  1E9V A;  1YUW A;  3ER9 B;  2JNS A;  4IM0 A;  7HSC A;  4UDY X;  1GNL A;  1OA1 A;  4EZS A;  1DKX A;  4ILG A;  3FD9 A;  4FM3 A;  2GA9 D;  2KHO A;  4ILH B;  2QXL A;  4JLC A;  3I04 A;  4PO2 A;  4IW0 A;  3KAW A;  3I39 X;  2ND0 A;  3ZEF A;  4M0M A;  4G6Q A;  2N3K A;  4JWI A;  3T48 A;  1JQK A;  3B51 X;  2PY6 A;  4WV7 A;  5FLE X;  4EZW A;  4F01 A;  2YIA A;  4EZX A;  2V7Y A;  4MQD A;  4NPH A;  1DKZ A;  2OP6 A;  3DQG A;  1OA0 A;  1ZYL A;  4EZZ A;  1DKY A;  2Z8Y A;  3ZED A;  2BPR A;  2WIN M;  1W9M A;  4F00 A;  4JNE A;  2X5C A;  4EZR A;  4IWQ A;  3DPP A;  3D2E A;  4WV5 A;  2YIB A;  4HYB A;  2OBM A;  4IWO A;  5E84 A;  3RV1 A;  3N8E A;  4JWC A;  2LM0 A;  4EZP A;  4JWD A;  4R5G A;  4E81 A;  2YI9 A;  1DG4 A;  4JWE A;  4ILI A;  4E3C A;  3LMF A;  4D8J A;  3L3O M;  1E1D A;  4JL9 A;  4EZN A;  4KIK A;  3VEA A;  3VEB A;  3T47 A;  3KDR A;  2ND1 A;  3QA8 A;  1UPX A;  2QFF A;  4EZT A;  3ERC C;  3I01 A;  1OAO A;  3O3O B;  2OBL A;  3DOB A;  1GNT A;  3QNJ A;  4HR1 B;  2GAF D;  1SU7 A;  4IM3 A;  3SBS A;  3SBT B;  4EZU A;  4HY9 A;  1U00 A;  2RT6 A;  3ER8 C;  1GN9 A;  3B53 X;  3UIT A;  4EZO A;  4I43 A;  1Q5L A;  2EWF A;  5FIG A;  2EX3 B;  1SU6 A;  1SU8 A;  3GI7 A;  4FL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...