4R5GA

Crystal structure of the dnak c-terminus with the inhibitor pet-16
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
218
Chain Sequence
MHHHHHHIEGRLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/chaperone inhibitor
total genus 40
structure length 218
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5gA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5gA01
2V7YA 4H6IA 3OHXM 4B9QA 3T48A 4JNEA 2OP6A 1DG4A 2QFFA 4R5KA 3DPOA 4JWEA 4JNFA 4WV7A 4JN4A 4R5JA 4E81A 3T46A 4JWIA 4EZVA 4EZOA 3DQGA 4HYBA 4R5IA 4EZWA 4H6HA 1DKXA 2QXLA 4R5LA 4EZNA 4EZPA 3D2EA 4EZQA 3N8EA 1U00A 5TKYA 1BPRA 2WINM 4JWDA 1DKYA 2BPRA 4WV5A 1CKRA 3C7NA 3D2FA 3T49A 4EZSA 3H0XA 4F01A 4PO2A 3L3OM 7HSCA 4EZRA 3DPQA 4EZXA 4FL9A 3DOBA 4EZYA 2KHOA 1YUWA 3QNJA 3C7NB 1DKZA 4JWCA 3T47A 4HY9A 4EZTA 3DPPA 4EZZA 3T4AG 4F00A 1Q5LA 4EZUA 4R5GA 5E84A
chains in the Genus database with same CATH superfamily
2ELBA 2ND1A 1YWMA 3D52A 5FIGA 4JWEA 2YL9A 1TQTA 1SUFA 2YI8A 4HR1B 1SU7A 4JN4A 2RT6A 1W9MA 2EFLA 2BPRA 1WDZA 3D2FA 2YKTA 4ATMA 4ILIA 3DX3A 3C7NB 1SU6A 3DPPA 2WYIA 5E84A 2V7YA 3B53X 3T48A 2OBMA 4IM2A 4AZCA 2OBLA 4JNFA 1OA1A 4HYBA 2JNKA 1BPRA 2PMRA 3EJRA 3D50A 2PY6A 4JLCA 2EFKA 3BVVA 4EZZA 3CZNA 4AZBA 3A98A 2LXYA 4FZSA 2RAIA 3Q84A 1U00A 4IW0A 2EX3B 2FYVA 1GNTA 2Q12A 1DKZA 2YI9A 1MJGA 2GAFD 2YL5A 4WV7A 3VEBA 3BUQA 3UITA 2F7RA 2QXLA 2YLLA 4IWPA 3VEAA 3F7WA 3BVWA 4UDXX 2YIVX 3HAIA 2RAJA 4H6IA 4B9QA 3DX4A 1DG4A 2QFFA 4NQIA 2C08A 3EJTA 3VKHA 2RAKA 3M3WA 1E9VA 1TQVA 2WINM 3D4ZA 3OK8A 1X04A 4WPEA 4FL9A 2D4CA 3T47A 3Q0KA 3RV1A 1QWUA 2V0OA 4R5KA 2JNSA 3DX2A 4R5JA 4EZOA 1QX1A 3BVXA 5FLEX 3O3MB 2F7PA 4EZRA 1TQSA 2YLAA 4H8SA 3KDRA 2Z0OA 3QNJA 4JWCA 4HY9A 3RPMA 4R5GA 3ERCC 3SOGA 4DCNC 4EZPA 3CKDA 3LMFA 4JWDA 1UPXA 4AZIA 3T49A 3BVTA 2OW6A 4PO2A 7HSCA 1X03A 2X3VA 3QE6A 2NCZA 4EZTA 3DDFA 3O3NB 4HR1A 1TQUA 4JL9A 2ZXQA 3ZEFA 1R33A 2ALWA 4IM0A 3KAWA 4AKVA 3T46A 1I49A 3C7NA 3H0XA 1ZWWA 3DPQA 2YL6A 1R34A 3OWGA 4IWQA 2OW7A 1O7DB 3B51X 2Z0VA 4UDYX 2X3XA 2O0I1 4FZOA 3CV5A 2KHOA 2OZNB 3EJSA 4AZGA 3I2WA 3ER8C 4F00A 3I04A 2OP6A 4AZ6A 3DX1A 1O7DC 4ILGA 4EZNA 4AZ5A 3EJPA 4EZQA 1E1DA 3SBTB 4G6QA 3SBSA 2EWFA 4D8JA 3QNIA 3CVRA 4I43A 3D4YA 3QA8A 5KBPA 4EZUA 3DDGA 2F18A 3DPOA 2N3KA 4E3CA 2FICA 4R5IA 4BNEA 3N8EA 1LQ7A 3ER9B 4WV5A 1R5EA 2QKWA 4EZSA 3DYTA 2F7QA 4FM3A 4IWOA 2ND0A 3LVTA 3BUBA 4FZPA 3CAZA 4H6HA 1DKXA 1HTYA 3D2EA 2GF4A 1DKYA 3EJQA 3GI7A 1GNLA 3I39X 4EZXA 4KIKB 1YUWA 2Z0NA 3LLLA 3ZEDA 3B52X 4MQDA 1SU8A 1Y2OA 3FD9A 4E81A 4EZVA 3DQGA 1TQWA 4R5LA 1I4TA 3L3PA 3PLTA 5TKYA 2D1LA 3ACOA 3D51A 4F01A 3HAJA 2X5CA 3L3OM 1ZYLA 1PS3A 5C5BB 1E2UA 3T4AG 3HAHA 2Z8YA 4IM3A 3EJUA 3SYVA 3G9GA 3OHXM 3CZSA 4AVMA 1OA0A 4NSWA 4JWIA 1JQKA 3O3OB 4KIKA 3DX0A 3ABHA 1CKRA 2GA9D 3BUPA 4WPCA 2WYHA 4NPHA 1HXKA 2OO2A 4EZYA 3BVUA 3BLBA 3BUIA 4M0MA 4ILHB 3KAVA 1I4LA 1URUA 4EZWA 1HWWA 5C5BA 2LM0A 2YIBA 3QWEA 3RV0A 2X3WA 2F1BA 1OAOA 4DYLA 4AZHA 1Q5LA 2F7OA 2YIAA 4JNEA 1I4DA 2Q13A 2YL8A 3I01A 4I1QA 4AZCB 2MI7A 3DOBA 1QWNA 3BUDA 4AZ7A 1GN9A 2F1AA
chains in the Genus database with same CATH topology
4H6IA 3ZEDA 3B52X 2ND1A 4B9QA 5FIGA 1DG4A 3B51X 2QFFA 4MQDA 1SU8A 4JWEA 4UDYX 2YI8A 1SUFA 4HR1B 3FD9A 1SU7A 4JN4A 4E81A 4EZVA 2RT6A 3DQGA 4R5LA 1W9MA 3VKHA 1E9VA 5TKYA 2BPRA 2WINM 3D2FA 4F01A 3L3OM 2X5CA 4FL9A 4ILIA 2KHOA 1ZYLA 3C7NB 3T47A 3ER8C 1SU6A 1E2UA 3DPPA 4F00A 3T4AG 2Z8YA 3RV1A 4IM3A 5E84A 3I04A 2V7YA 3B53X 3OHXM 2OP6A 3T48A 2OBMA 4IM2A 2OBLA 4R5KA 2JNSA 4JNFA 4ILGA 1OA1A 4R5JA 1OA0A 4JWIA 4EZOA 1JQKA 3O3OB 4HYBA 4EZNA 4KIKA 5FLEX 4EZQA 1E1DA 1BPRA 1CKRA 2GA9D 3SBTB 3O3MB 4G6QA 3SBSA 4NPHA 2EWFA 4EZRA 4D8JA 3KDRA 4EZYA 4I43A 2PY6A 3QNJA 4JWCA 4JLCA 3QA8A 4HY9A 4EZZA 4EZUA 4M0MA 4R5GA 4ILHB 3A98A 3ERCC 3KAVA 3DPOA 2N3KA 4E3CA 4R5IA 3N8EA 4EZWA 4EZPA 3ER9B 4WV5A 3LMFA 1U00A 4JWDA 4IW0A 1UPXA 2LM0A 2EX3B 2YIBA 3T49A 4EZSA 4PO2A 7HSCA 1GNTA 3RV0A 4FM3A 1OAOA 1DKZA 2NCZA 4IWOA 4EZTA 3O3NB 1Q5LA 2ND0A 2YI9A 4HR1A 1MJGA 4JL9A 2GAFD 2YIAA 3ZEFA 4JNEA 4IM0A 4WV7A 3KAWA 3I01A 3T46A 3VEBA 3UITA 4H6HA 1DKXA 2QXLA 3D2EA 1DKYA 3C7NA 4IWPA 3VEAA 3H0XA 3GI7A 1GNLA 3F7WA 3I39X 3DPQA 4EZXA 4UDXX 2YIVX 3DOBA 4KIKB 1YUWA 3OWGA 4IWQA 1GN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7Y A;  4H6I A;  3OHX M;  4B9Q A;  3T48 A;  4JNE A;  2OP6 A;  1DG4 A;  2QFF A;  4R5K A;  3DPO A;  4JWE A;  4JNF A;  4WV7 A;  4JN4 A;  4R5J A;  4E81 A;  3T46 A;  4JWI A;  4EZV A;  4EZO A;  3DQG A;  4HYB A;  4R5I A;  4EZW A;  4H6H A;  1DKX A;  2QXL A;  4R5L A;  4EZN A;  4EZP A;  3D2E A;  4EZQ A;  3N8E A;  1U00 A;  5TKY A;  1BPR A;  2WIN M;  4JWD A;  1DKY A;  2BPR A;  4WV5 A;  1CKR A;  3C7N A;  3D2F A;  3T49 A;  4EZS A;  3H0X A;  4F01 A;  4PO2 A;  3L3O M;  7HSC A;  4EZR A;  3DPQ A;  4EZX A;  4FL9 A;  3DOB A;  4EZY A;  2KHO A;  1YUW A;  3QNJ A;  3C7N B;  1DKZ A;  4JWC A;  3T47 A;  4HY9 A;  4EZT A;  3DPP A;  4EZZ A;  3T4A G;  4F00 A;  1Q5L A;  4EZU A;  4R5G A;  5E84 A; 
#chains in the Genus database with same CATH topology
 2ELB A;  2ND1 A;  1YWM A;  3D52 A;  5FIG A;  4JWE A;  2YL9 A;  1TQT A;  1SUF A;  2YI8 A;  4HR1 B;  1SU7 A;  4JN4 A;  2RT6 A;  1W9M A;  2EFL A;  2BPR A;  1WDZ A;  3D2F A;  2YKT A;  4ATM A;  4ILI A;  3DX3 A;  3C7N B;  1SU6 A;  3DPP A;  2WYI A;  5E84 A;  2V7Y A;  3B53 X;  3T48 A;  2OBM A;  4IM2 A;  4AZC A;  2OBL A;  4JNF A;  1OA1 A;  4HYB A;  2JNK A;  1BPR A;  2PMR A;  3EJR A;  3D50 A;  2PY6 A;  4JLC A;  2EFK A;  3BVV A;  4EZZ A;  3CZN A;  4AZB A;  3A98 A;  2LXY A;  4FZS A;  2RAI A;  3Q84 A;  1U00 A;  4IW0 A;  2EX3 B;  2FYV A;  1GNT A;  2Q12 A;  1DKZ A;  2YI9 A;  1MJG A;  2GAF D;  2YL5 A;  4WV7 A;  3VEB A;  3BUQ A;  3UIT A;  2F7R A;  2QXL A;  2YLL A;  4IWP A;  3VEA A;  3F7W A;  3BVW A;  4UDX X;  2YIV X;  3HAI A;  2RAJ A;  4H6I A;  4B9Q A;  3DX4 A;  1DG4 A;  2QFF A;  4NQI A;  2C08 A;  3EJT A;  3VKH A;  2RAK A;  3M3W A;  1E9V A;  1TQV A;  2WIN M;  3D4Z A;  3OK8 A;  1X04 A;  4WPE A;  4FL9 A;  2D4C A;  3T47 A;  3Q0K A;  3RV1 A;  1QWU A;  2V0O A;  4R5K A;  2JNS A;  3DX2 A;  4R5J A;  4EZO A;  1QX1 A;  3BVX A;  5FLE X;  3O3M B;  2F7P A;  4EZR A;  1TQS A;  2YLA A;  4H8S A;  3KDR A;  2Z0O A;  3QNJ A;  4JWC A;  4HY9 A;  3RPM A;  4R5G A;  3ERC C;  3SOG A;  4DCN C;  4EZP A;  3CKD A;  3LMF A;  4JWD A;  1UPX A;  4AZI A;  3T49 A;  3BVT A;  2OW6 A;  4PO2 A;  7HSC A;  1X03 A;  2X3V A;  3QE6 A;  2NCZ A;  4EZT A;  3DDF A;  3O3N B;  4HR1 A;  1TQU A;  4JL9 A;  2ZXQ A;  3ZEF A;  1R33 A;  2ALW A;  4IM0 A;  3KAW A;  4AKV A;  3T46 A;  1I49 A;  3C7N A;  3H0X A;  1ZWW A;  3DPQ A;  2YL6 A;  1R34 A;  3OWG A;  4IWQ A;  2OW7 A;  1O7D B;  3B51 X;  2Z0V A;  4UDY X;  2X3X A;  2O0I 1;  4FZO A;  3CV5 A;  2KHO A;  2OZN B;  3EJS A;  4AZG A;  3I2W A;  3ER8 C;  4F00 A;  3I04 A;  2OP6 A;  4AZ6 A;  3DX1 A;  1O7D C;  4ILG A;  4EZN A;  4AZ5 A;  3EJP A;  4EZQ A;  1E1D A;  3SBT B;  4G6Q A;  3SBS A;  2EWF A;  4D8J A;  3QNI A;  3CVR A;  4I43 A;  3D4Y A;  3QA8 A;  5KBP A;  4EZU A;  3DDG A;  2F18 A;  3DPO A;  2N3K A;  4E3C A;  2FIC A;  4R5I A;  4BNE A;  3N8E A;  1LQ7 A;  3ER9 B;  4WV5 A;  1R5E A;  2QKW A;  4EZS A;  3DYT A;  2F7Q A;  4FM3 A;  4IWO A;  2ND0 A;  3LVT A;  3BUB A;  4FZP A;  3CAZ A;  4H6H A;  1DKX A;  1HTY A;  3D2E A;  2GF4 A;  1DKY A;  3EJQ A;  3GI7 A;  1GNL A;  3I39 X;  4EZX A;  4KIK B;  1YUW A;  2Z0N A;  3LLL A;  3ZED A;  3B52 X;  4MQD A;  1SU8 A;  1Y2O A;  3FD9 A;  4E81 A;  4EZV A;  3DQG A;  1TQW A;  4R5L A;  1I4T A;  3L3P A;  3PLT A;  5TKY A;  2D1L A;  3ACO A;  3D51 A;  4F01 A;  3HAJ A;  2X5C A;  3L3O M;  1ZYL A;  1PS3 A;  5C5B B;  1E2U A;  3T4A G;  3HAH A;  2Z8Y A;  4IM3 A;  3EJU A;  3SYV A;  3G9G A;  3OHX M;  3CZS A;  4AVM A;  1OA0 A;  4NSW A;  4JWI A;  1JQK A;  3O3O B;  4KIK A;  3DX0 A;  3ABH A;  1CKR A;  2GA9 D;  3BUP A;  4WPC A;  2WYH A;  4NPH A;  1HXK A;  2OO2 A;  4EZY A;  3BVU A;  3BLB A;  3BUI A;  4M0M A;  4ILH B;  3KAV A;  1I4L A;  1URU A;  4EZW A;  1HWW A;  5C5B A;  2LM0 A;  2YIB A;  3QWE A;  3RV0 A;  2X3W A;  2F1B A;  1OAO A;  4DYL A;  4AZH A;  1Q5L A;  2F7O A;  2YIA A;  4JNE A;  1I4D A;  2Q13 A;  2YL8 A;  3I01 A;  4I1Q A;  4AZC B;  2MI7 A;  3DOB A;  1QWN A;  3BUD A;  4AZ7 A;  1GN9 A;  2F1A A; 
#chains in the Genus database with same CATH homology
 4H6I A;  3ZED A;  3B52 X;  2ND1 A;  4B9Q A;  5FIG A;  1DG4 A;  3B51 X;  2QFF A;  4MQD A;  1SU8 A;  4JWE A;  4UDY X;  2YI8 A;  1SUF A;  4HR1 B;  3FD9 A;  1SU7 A;  4JN4 A;  4E81 A;  4EZV A;  2RT6 A;  3DQG A;  4R5L A;  1W9M A;  3VKH A;  1E9V A;  5TKY A;  2BPR A;  2WIN M;  3D2F A;  4F01 A;  3L3O M;  2X5C A;  4FL9 A;  4ILI A;  2KHO A;  1ZYL A;  3C7N B;  3T47 A;  3ER8 C;  1SU6 A;  1E2U A;  3DPP A;  4F00 A;  3T4A G;  2Z8Y A;  3RV1 A;  4IM3 A;  5E84 A;  3I04 A;  2V7Y A;  3B53 X;  3OHX M;  2OP6 A;  3T48 A;  2OBM A;  4IM2 A;  2OBL A;  4R5K A;  2JNS A;  4JNF A;  4ILG A;  1OA1 A;  4R5J A;  1OA0 A;  4JWI A;  4EZO A;  1JQK A;  3O3O B;  4HYB A;  4EZN A;  4KIK A;  5FLE X;  4EZQ A;  1E1D A;  1BPR A;  1CKR A;  2GA9 D;  3SBT B;  3O3M B;  4G6Q A;  3SBS A;  4NPH A;  2EWF A;  4EZR A;  4D8J A;  3KDR A;  4EZY A;  4I43 A;  2PY6 A;  3QNJ A;  4JWC A;  4JLC A;  3QA8 A;  4HY9 A;  4EZZ A;  4EZU A;  4M0M A;  4R5G A;  4ILH B;  3A98 A;  3ERC C;  3KAV A;  3DPO A;  2N3K A;  4E3C A;  4R5I A;  3N8E A;  4EZW A;  4EZP A;  3ER9 B;  4WV5 A;  3LMF A;  1U00 A;  4JWD A;  4IW0 A;  1UPX A;  2LM0 A;  2EX3 B;  2YIB A;  3T49 A;  4EZS A;  4PO2 A;  7HSC A;  1GNT A;  3RV0 A;  4FM3 A;  1OAO A;  1DKZ A;  2NCZ A;  4IWO A;  4EZT A;  3O3N B;  1Q5L A;  2ND0 A;  2YI9 A;  4HR1 A;  1MJG A;  4JL9 A;  2GAF D;  2YIA A;  3ZEF A;  4JNE A;  4IM0 A;  4WV7 A;  3KAW A;  3I01 A;  3T46 A;  3VEB A;  3UIT A;  4H6H A;  1DKX A;  2QXL A;  3D2E A;  1DKY A;  3C7N A;  4IWP A;  3VEA A;  3H0X A;  3GI7 A;  1GNL A;  3F7W A;  3I39 X;  3DPQ A;  4EZX A;  4UDX X;  2YIV X;  3DOB A;  4KIK B;  1YUW A;  3OWG A;  4IWQ A;  1GN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...