4R5GA

Crystal structure of the dnak c-terminus with the inhibitor pet-16
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
218
Chain Sequence
MHHHHHHIEGRLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/chaperone inhibitor
molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 218
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5gA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5gA01
5TKYA 3D2FA 4B9QA 4EZWA 4JNEA 3L3OM 3QNJA 4JNFA 3T48A 1DG4A 3OHXM 1Q5LA 1U00A 2QXLA 1YUWA 4R5KA 4JWCA 4EZZA 4HYBA 4EZOA 4F01A 5E84A 3DPQA 4R5LA 4F00A 3DOBA 4EZXA 4FL9A 2WINM 1DKXA 4R5JA 4JWEA 7HSCA 4H6HA 3T46A 4EZNA 4EZRA 3T47A 1DKZA 2KHOA 3DPPA 4R5GA 4EZUA 1BPRA 2BPRA 3N8EA 4PO2A 2OP6A 4H6IA 4EZQA 4JWIA 4EZVA 4WV5A 3C7NA 2V7YA 4EZSA 4JWDA 4R5IA 3H0XA 3DQGA 3T4AG 1DKYA 4E81A 4EZPA 3D2EA 4WV7A 4EZTA 3T49A 3C7NB 1CKRA 4EZYA 4HY9A 4JN4A 3DPOA 2QFFA
chains in the Genus database with same CATH superfamily
2FICA 3OK8A 1DG4A 3T48A 2Z0OA 1R5EA 2WYHA 1OA1A 1LQ7A 3D4YA 3BVVA 1DKXA 3CAZA 3GI7A 4EZQA 3BUDA 4R5IA 5KBPA 1SU8A 1URUA 5C5BA 1GNLA 3QNJA 2X3VA 4I43A 4IM3A 3L3PA 4E3CA 3DX3A 3D4ZA 4H6HA 1QX1A 2F7PA 4EZUA 4WV5A 1OAOA 3I04A 3H0XA 3DX1A 2F1AA 3DX4A 2QFFA 3ERCC 4BNEA 4ILHB 3KDRA 3DPQA 4R5LA 3ER8C 3B53X 4R5JA 2ALWA 4EZNA 1TQWA 3I2WA 2WYIA 3I01A 3DPPA 2YL8A 1GNTA 3ZEDA 2OZNB 2YL5A 4KIKA 1WDZA 3LLLA 2Q13A 2X3XA 1BPRA 5TKYA 4UDYX 3BUQA 4DCNC 2YI8A 4M0MA 2OW6A 4JWCA 1R33A 3O3NB 4UDXX 3DX0A 3CZSA 2O0I1 2YIAA 4WV7A 4ILIA 1PS3A 1TQTA 2F1BA 4IWQA 2D4CA 4F01A 3LMFA 2ELBA 4H8SA 4JWEA 3HAJA 2X3WA 3PLTA 2FYVA 2EWFA 4IM2A 4AZCA 3EJSA 4AZ5A 4E81A 4EZTA 4AZIA 4AZ7A 4AZHA 3BUBA 4IM0A 3O3OB 2C08A 1ZWWA 2RAJA 1GN9A 3UITA 4IW0A 2GA9D 3BVXA 5E84A 4EZXA 2WINM 1HWWA 5FLEX 3EJTA 3G9GA 4AZBA 3DDFA 4JWIA 4EZVA 2QKWA 4JWDA 4FZOA 3DDGA 3B51X 4HYBA 3DOBA 3CKDA 3B52X 2F7OA 2Z0NA 3EJPA 2Z0VA 4AKVA 2GF4A 4HR1A 3T4AG 3SBTB 2YLLA 1R34A 4JNEA 1E2UA 3N8EA 4B9QA 2YI9A 3L3OM 3KAWA 2RT6A 3VEAA 3QWEA 4F00A 3BUIA 4WPCA 4D8JA 3ZEFA 3ABHA 1W9MA 3ACOA 3F7WA 1DKYA 2YLAA 3D50A 2YL9A 4NSWA 3M3WA 2EFKA 4FL9A 4JLCA 2F18A 1I49A 4DYLA 4EZRA 3RV1A 2YIBA 3VKHA 3C7NA 2RAIA 1I4LA 3DYTA 4HY9A 2OP6A 4AZCB 3EJRA 2JNSA 3CVRA 1HXKA 1SU6A 1YUWA 2OW7A 1DKZA 4I1QA 3BLBA 1O7DB 2Q12A 1MJGA 3I39X 1HTYA 3Q0KA 3QNIA 5C5BB 2MI7A 3A98A 3BVTA 2YL6A 4NPHA 3FD9A 2KHOA 2OBMA 2ZXQA 2BPRA 1E9VA 2LM0A 2YKTA 2D1LA 4AVMA 3KAVA 4HR1B 4EZWA 1QWNA 4EZZA 1I4DA 5FIGA 4FM3A 4IWPA 1SUFA 2GAFD 2F7RA 1QWUA 1YWMA 3DX2A 3D2EA 3T49A 3CZNA 1CKRA 3EJQA 3ER9B 1I4TA 3D2FA 3Q84A 2OO2A 1TQVA 4KIKB 3OHXM 3HAIA 2YIVX 1ZYLA 2PY6A 2X5CA 4WPEA 1X04A 2EFLA 3T46A 1O7DC 4R5GA 3RPMA 3C7NB 2NCZA 1OA0A 4IWOA 3LVTA 2LXYA 3SBSA 3BVUA 1E1DA 4FZPA 2ND1A 3VEBA 1X03A 3T47A 4ATMA 3D52A 4PO2A 4H6IA 2V7YA 2ND0A 1Y2OA 3D51A 2EX3B 4AZ6A 4JNFA 2N3KA 3HAHA 3BUPA 2JNKA 4EZOA 3OWGA 3SYVA 3EJUA 2Z8YA 4G6QA 2F7QA 2V0OA 2OBLA 3QE6A 3BVWA 4AZGA 3QA8A 4EZPA 4JL9A 3CV5A 1TQUA 4EZYA 4JN4A 3DPOA 1JQKA 3SOGA 3DQGA 4ILGA 4FZSA 1Q5LA 1U00A 2QXLA 4NQIA 4R5KA 1UPXA 7HSCA 4MQDA 2RAKA 1SU7A 4EZSA 1TQSA 2PMRA 3O3MB 3RV0A
chains in the Genus database with same CATH topology
3D2FA 4ILIA 4KIKB 3T48A 1DG4A 3OHXM 4IWQA 1OA1A 4F01A 3LMFA 2YIVX 1ZYLA 2PY6A 2X5CA 4FL9A 4JLCA 1DKXA 4JWEA 3GI7A 3T46A 4EZRA 4R5GA 2EWFA 4EZQA 3RV1A 2YIBA 3VKHA 3C7NA 4IM2A 4R5IA 4E81A 4EZTA 1SU8A 3C7NB 4HY9A 2NCZA 1BPRA 2OP6A 1OA0A 4IWOA 1GNLA 2JNSA 4IM0A 3QNJA 3O3OB 3SBSA 1GN9A 3UITA 1YUWA 1SU6A 4IW0A 2GA9D 4I43A 4IM3A 5E84A 4E3CA 1E1DA 4EZXA 2WINM 2ND1A 5FLEX 3VEBA 4H6HA 3T47A 1DKZA 4EZUA 4PO2A 4WV5A 4H6IA 4JWIA 4EZVA 1OAOA 2V7YA 3I04A 4JWDA 3H0XA 1MJGA 2ND0A 2QFFA 3ERCC 3I39X 2EX3B 4JNFA 2N3KA 4ILHB 3KDRA 3B51X 4HYBA 4EZOA 3OWGA 3DPQA 4R5LA 3ER8C 3DOBA 3A98A 3B53X 3B52X 2Z8YA 4NPHA 4R5JA 4G6QA 4EZNA 3FD9A 3I01A 2KHOA 3DPPA 2OBMA 2BPRA 3N8EA 1E9VA 1GNTA 2OBLA 3ZEDA 4HR1A 2LM0A 3T4AG 4KIKA 3QA8A 3SBTB 4EZPA 4JL9A 4EZYA 4JN4A 3DPOA 1E2UA 3KAVA 1JQKA 4JNEA 5TKYA 4B9QA 2YI9A 4HR1B 4UDYX 4EZWA 4ILGA 3L3OM 3KAWA 1Q5LA 2YI8A 1U00A 2QXLA 4M0MA 4R5KA 4JWCA 2RT6A 4EZZA 3VEAA 3O3NB 5FIGA 4F00A 4FM3A 1UPXA 4UDXX 7HSCA 4IWPA 4D8JA 4MQDA 3ZEFA 1W9MA 1SUFA 2GAFD 1SU7A 4EZSA 3DQGA 3F7WA 1DKYA 3D2EA 3T49A 1CKRA 2YIAA 4WV7A 3O3MB 3RV0A 3ER9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKY A;  3D2F A;  4B9Q A;  4EZW A;  4JNE A;  3L3O M;  3QNJ A;  4JNF A;  3T48 A;  1DG4 A;  3OHX M;  1Q5L A;  1U00 A;  2QXL A;  1YUW A;  4R5K A;  4JWC A;  4EZZ A;  4HYB A;  4EZO A;  4F01 A;  5E84 A;  3DPQ A;  4R5L A;  4F00 A;  3DOB A;  4EZX A;  4FL9 A;  2WIN M;  1DKX A;  4R5J A;  4JWE A;  7HSC A;  4H6H A;  3T46 A;  4EZN A;  4EZR A;  3T47 A;  1DKZ A;  2KHO A;  3DPP A;  4R5G A;  4EZU A;  1BPR A;  2BPR A;  3N8E A;  4PO2 A;  2OP6 A;  4H6I A;  4EZQ A;  4JWI A;  4EZV A;  4WV5 A;  3C7N A;  2V7Y A;  4EZS A;  4JWD A;  4R5I A;  3H0X A;  3DQG A;  3T4A G;  1DKY A;  4E81 A;  4EZP A;  3D2E A;  4WV7 A;  4EZT A;  3T49 A;  3C7N B;  1CKR A;  4EZY A;  4HY9 A;  4JN4 A;  3DPO A;  2QFF A; 
#chains in the Genus database with same CATH topology
 2FIC A;  3OK8 A;  1DG4 A;  3T48 A;  2Z0O A;  1R5E A;  2WYH A;  1OA1 A;  1LQ7 A;  3D4Y A;  3BVV A;  1DKX A;  3CAZ A;  3GI7 A;  4EZQ A;  3BUD A;  4R5I A;  5KBP A;  1SU8 A;  1URU A;  5C5B A;  1GNL A;  3QNJ A;  2X3V A;  4I43 A;  4IM3 A;  3L3P A;  4E3C A;  3DX3 A;  3D4Z A;  4H6H A;  1QX1 A;  2F7P A;  4EZU A;  4WV5 A;  1OAO A;  3I04 A;  3H0X A;  3DX1 A;  2F1A A;  3DX4 A;  2QFF A;  3ERC C;  4BNE A;  4ILH B;  3KDR A;  3DPQ A;  4R5L A;  3ER8 C;  3B53 X;  4R5J A;  2ALW A;  4EZN A;  1TQW A;  3I2W A;  2WYI A;  3I01 A;  3DPP A;  2YL8 A;  1GNT A;  3ZED A;  2OZN B;  2YL5 A;  4KIK A;  1WDZ A;  3LLL A;  2Q13 A;  2X3X A;  1BPR A;  5TKY A;  4UDY X;  3BUQ A;  4DCN C;  2YI8 A;  4M0M A;  2OW6 A;  4JWC A;  1R33 A;  3O3N B;  4UDX X;  3DX0 A;  3CZS A;  2O0I 1;  2YIA A;  4WV7 A;  4ILI A;  1PS3 A;  1TQT A;  2F1B A;  4IWQ A;  2D4C A;  4F01 A;  3LMF A;  2ELB A;  4H8S A;  4JWE A;  3HAJ A;  2X3W A;  3PLT A;  2FYV A;  2EWF A;  4IM2 A;  4AZC A;  3EJS A;  4AZ5 A;  4E81 A;  4EZT A;  4AZI A;  4AZ7 A;  4AZH A;  3BUB A;  4IM0 A;  3O3O B;  2C08 A;  1ZWW A;  2RAJ A;  1GN9 A;  3UIT A;  4IW0 A;  2GA9 D;  3BVX A;  5E84 A;  4EZX A;  2WIN M;  1HWW A;  5FLE X;  3EJT A;  3G9G A;  4AZB A;  3DDF A;  4JWI A;  4EZV A;  2QKW A;  4JWD A;  4FZO A;  3DDG A;  3B51 X;  4HYB A;  3DOB A;  3CKD A;  3B52 X;  2F7O A;  2Z0N A;  3EJP A;  2Z0V A;  4AKV A;  2GF4 A;  4HR1 A;  3T4A G;  3SBT B;  2YLL A;  1R34 A;  4JNE A;  1E2U A;  3N8E A;  4B9Q A;  2YI9 A;  3L3O M;  3KAW A;  2RT6 A;  3VEA A;  3QWE A;  4F00 A;  3BUI A;  4WPC A;  4D8J A;  3ZEF A;  3ABH A;  1W9M A;  3ACO A;  3F7W A;  1DKY A;  2YLA A;  3D50 A;  2YL9 A;  4NSW A;  3M3W A;  2EFK A;  4FL9 A;  4JLC A;  2F18 A;  1I49 A;  4DYL A;  4EZR A;  3RV1 A;  2YIB A;  3VKH A;  3C7N A;  2RAI A;  1I4L A;  3DYT A;  4HY9 A;  2OP6 A;  4AZC B;  3EJR A;  2JNS A;  3CVR A;  1HXK A;  1SU6 A;  1YUW A;  2OW7 A;  1DKZ A;  4I1Q A;  3BLB A;  1O7D B;  2Q12 A;  1MJG A;  3I39 X;  1HTY A;  3Q0K A;  3QNI A;  5C5B B;  2MI7 A;  3A98 A;  3BVT A;  2YL6 A;  4NPH A;  3FD9 A;  2KHO A;  2OBM A;  2ZXQ A;  2BPR A;  1E9V A;  2LM0 A;  2YKT A;  2D1L A;  4AVM A;  3KAV A;  4HR1 B;  4EZW A;  1QWN A;  4EZZ A;  1I4D A;  5FIG A;  4FM3 A;  4IWP A;  1SUF A;  2GAF D;  2F7R A;  1QWU A;  1YWM A;  3DX2 A;  3D2E A;  3T49 A;  3CZN A;  1CKR A;  3EJQ A;  3ER9 B;  1I4T A;  3D2F A;  3Q84 A;  2OO2 A;  1TQV A;  4KIK B;  3OHX M;  3HAI A;  2YIV X;  1ZYL A;  2PY6 A;  2X5C A;  4WPE A;  1X04 A;  2EFL A;  3T46 A;  1O7D C;  4R5G A;  3RPM A;  3C7N B;  2NCZ A;  1OA0 A;  4IWO A;  3LVT A;  2LXY A;  3SBS A;  3BVU A;  1E1D A;  4FZP A;  2ND1 A;  3VEB A;  1X03 A;  3T47 A;  4ATM A;  3D52 A;  4PO2 A;  4H6I A;  2V7Y A;  2ND0 A;  1Y2O A;  3D51 A;  2EX3 B;  4AZ6 A;  4JNF A;  2N3K A;  3HAH A;  3BUP A;  2JNK A;  4EZO A;  3OWG A;  3SYV A;  3EJU A;  2Z8Y A;  4G6Q A;  2F7Q A;  2V0O A;  2OBL A;  3QE6 A;  3BVW A;  4AZG A;  3QA8 A;  4EZP A;  4JL9 A;  3CV5 A;  1TQU A;  4EZY A;  4JN4 A;  3DPO A;  1JQK A;  3SOG A;  3DQG A;  4ILG A;  4FZS A;  1Q5L A;  1U00 A;  2QXL A;  4NQI A;  4R5K A;  1UPX A;  7HSC A;  4MQD A;  2RAK A;  1SU7 A;  4EZS A;  1TQS A;  2PMR A;  3O3M B;  3RV0 A; 
#chains in the Genus database with same CATH homology
 3D2F A;  4ILI A;  4KIK B;  3T48 A;  1DG4 A;  3OHX M;  4IWQ A;  1OA1 A;  4F01 A;  3LMF A;  2YIV X;  1ZYL A;  2PY6 A;  2X5C A;  4FL9 A;  4JLC A;  1DKX A;  4JWE A;  3GI7 A;  3T46 A;  4EZR A;  4R5G A;  2EWF A;  4EZQ A;  3RV1 A;  2YIB A;  3VKH A;  3C7N A;  4IM2 A;  4R5I A;  4E81 A;  4EZT A;  1SU8 A;  3C7N B;  4HY9 A;  2NCZ A;  1BPR A;  2OP6 A;  1OA0 A;  4IWO A;  1GNL A;  2JNS A;  4IM0 A;  3QNJ A;  3O3O B;  3SBS A;  1GN9 A;  3UIT A;  1YUW A;  1SU6 A;  4IW0 A;  2GA9 D;  4I43 A;  4IM3 A;  5E84 A;  4E3C A;  1E1D A;  4EZX A;  2WIN M;  2ND1 A;  5FLE X;  3VEB A;  4H6H A;  3T47 A;  1DKZ A;  4EZU A;  4PO2 A;  4WV5 A;  4H6I A;  4JWI A;  4EZV A;  1OAO A;  2V7Y A;  3I04 A;  4JWD A;  3H0X A;  1MJG A;  2ND0 A;  2QFF A;  3ERC C;  3I39 X;  2EX3 B;  4JNF A;  2N3K A;  4ILH B;  3KDR A;  3B51 X;  4HYB A;  4EZO A;  3OWG A;  3DPQ A;  4R5L A;  3ER8 C;  3DOB A;  3A98 A;  3B53 X;  3B52 X;  2Z8Y A;  4NPH A;  4R5J A;  4G6Q A;  4EZN A;  3FD9 A;  3I01 A;  2KHO A;  3DPP A;  2OBM A;  2BPR A;  3N8E A;  1E9V A;  1GNT A;  2OBL A;  3ZED A;  4HR1 A;  2LM0 A;  3T4A G;  4KIK A;  3QA8 A;  3SBT B;  4EZP A;  4JL9 A;  4EZY A;  4JN4 A;  3DPO A;  1E2U A;  3KAV A;  1JQK A;  4JNE A;  5TKY A;  4B9Q A;  2YI9 A;  4HR1 B;  4UDY X;  4EZW A;  4ILG A;  3L3O M;  3KAW A;  1Q5L A;  2YI8 A;  1U00 A;  2QXL A;  4M0M A;  4R5K A;  4JWC A;  2RT6 A;  4EZZ A;  3VEA A;  3O3N B;  5FIG A;  4F00 A;  4FM3 A;  1UPX A;  4UDX X;  7HSC A;  4IWP A;  4D8J A;  4MQD A;  3ZEF A;  1W9M A;  1SUF A;  2GAF D;  1SU7 A;  4EZS A;  3DQG A;  3F7W A;  1DKY A;  3D2E A;  3T49 A;  1CKR A;  2YIA A;  4WV7 A;  3O3M B;  3RV0 A;  3ER9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...