4R5GA

Crystal structure of the dnak c-terminus with the inhibitor pet-16
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
218
Chain Sequence
b'MHHHHHHIEGRLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/chaperone inhibitor
total genus 40
structure length 218
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5gA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5gA01
4EZPA 5TKYA 4EZUA 1DG4A 4EZNA 1CKRA 4JWEA 4JNEA 1DKYA 4EZSA 4EZWA 4JN4A 3T48A 2OP6A 3OHXM 5E84A 4EZTA 4FL9A 4JWIA 3T49A 4PO2A 3D2EA 3N8EA 2QXLA 4R5GA 3T47A 1Q5LA 4HY9A 1BPRA 4EZOA 4JWCA 7HSCA 4EZQA 3D2FA 1DKXA 4EZXA 3C7NA 4HYBA 4H6HA 3DPQA 4EZVA 2BPRA 1DKZA 4EZYA 3DQGA 4R5KA 4F01A 2V7YA 4JNFA 1U00A 3DOBA 4R5IA 4WV7A 4EZZA 4JWDA 3QNJA 3L3OM 3T4AG 4E81A 4B9QA 4F00A 4R5LA 1YUWA 4EZRA 3T46A 3C7NB 2WINM 4R5JA 2KHOA 3H0XA 4H6IA 2QFFA 3DPPA 4WV5A 3DPOA
chains in the Genus database with same CATH superfamily
4IM2A 2YL8A 2F7QA 5E84A 1E1DA 4JWIA 3EJPA 2YKTA 3C7NA 3LVTA 2FICA 4ATMA 1SUFA 2RAIA 1URUA 3ERCC 3B53X 3I39X 3T46A 1TQUA 4EZUA 3CZNA 1CKRA 4KIKB 4MQDA 4AZHA 2ALWA 1TQTA 1SU7A 2F1AA 4AZ5A 4E3CA 1E2UA 1HTYA 4EZXA 1Y2OA 4HYBA 2X3WA 2OBLA 3VEBA 4ILHB 4WV5A 3SBSA 2F7RA 4EZNA 2YIBA 3BUIA 3BVXA 3DX3A 4JNEA 3I2WA 3T48A 4EZTA 3EJSA 3T49A 4I1QA 2Q13A 3HAIA 3T47A 1QX1A 1W9MA 4EZQA 2LXYA 1U00A 3T4AG 3L3OM 3G9GA 2QFFA 1DG4A 2O0I1 3B51X 2OZNB 4G6QA 2JNKA 3Q84A 4FZSA 4WPCA 2N3KA 4ILGA 3BLBA 3DDFA 4UDXX 3SBTB 2MI7A 4E81A 1YWMA 1QWUA 4WV7A 2KHOA 3CV5A 1HWWA 4AZIA 2Z8YA 3LMFA 4NQIA 4JWCA 4FM3A 2WYIA 4AZCA 2Z0OA 1O7DC 1SU8A 3DDGA 3Q0KA 4JL9A 3DOBA 2RAKA 4F00A 4B9QA 2JNSA 3C7NB 3HAHA 4H6IA 3DPOA 5TKYA 3O3NB 1WDZA 4JWEA 2QKWA 3PLTA 3D2EA 4HY9A 3KAWA 4ILIA 3ZEFA 2OW6A 3OWGA 4JWDA 2GA9D 4EZRA 3CVRA 2F1BA 5KBPA 4JN4A 2YL5A 2YL6A 3EJTA 2ZXQA 3D4ZA 4R5GA 1BPRA 4EZOA 5FIGA 1X03A 2Q12A 3QNJA 4BNEA 1QWNA 2OW7A 4UDYX 2D1LA 4I43A 3OK8A 4AZ7A 3RPMA 1HXKA 4M0MA 3ER9B 1GNTA 1DKXA 4D8JA 4EZVA 3QNIA 4EZYA 4JNFA 3CKDA 3DX1A 1ZYLA 4EZZA 3O3MB 2ELBA 3CZSA 3D50A 3QA8A 4FZOA 1SU6A 5FLEX 2OP6A 3HAJA 3SYVA 1I4LA 1TQWA 2YLAA 2V0OA 4AZBA 4WPEA 3GI7A 3UITA 4R5IA 2X5CA 3BVTA 1R34A 4AZCB 1YUWA 3D51A 1JQKA 3B52X 3DX2A 3EJRA 4EZWA 3SOGA 4FZPA 1GN9A 2LM0A 1ZWWA 7HSCA 4DCNC 3ZEDA 4H6HA 3DPQA 3D4YA 3KDRA 2WINM 1TQSA 3QE6A 3ABHA 3F7WA 2GAFD 1OA0A 1GNLA 3L3PA 2YL9A 3VEAA 4FL9A 4HR1A 2YLLA 1R33A 3BVWA 2OO2A 4DYLA 3BUQA 5C5BB 4AZGA 1O7DB 2BPRA 1DKZA 1X04A 2V7YA 2X3XA 3CAZA 4AVMA 2GF4A 3D52A 2PMRA 5C5BA 2F7OA 3M3WA 2YIAA 2ND1A 3FD9A 3DYTA 3EJUA 1R5EA 3RV0A 4AZ6A 4R5LA 2F7PA 4JLCA 1DKYA 3OHXM 1I4TA 1MJGA 4PO2A 3VKHA 2C08A 3QWEA 3ACOA 4IWQA 4IWOA 2OBMA 1PS3A 4NPHA 3ER8C 3DQGA 2YIVX 4KIKA 2RT6A 2Z0NA 4IW0A 3H0XA 2YI8A 2RAJA 2EFKA 1Q5LA 3D2FA 3BUBA 3BUDA 4IM0A 2NCZA 4R5KA 4F01A 4AKVA 3O3OB 2YI9A 3DPPA 1OAOA 2WYHA 2EX3B 4H8SA 2EFLA 3BUPA 2Z0VA 3I01A 1TQVA 3DX0A 3BVUA 3DX4A 4IWPA 2X3VA 1I4DA 4HR1B 1I49A 4R5JA 4EZPA 3A98A 4EZSA 2ND0A 1LQ7A 2D4CA 3EJQA 3I04A 3N8EA 2QXLA 2PY6A 2F18A 1UPXA 3KAVA 1E9VA 4IM3A 3RV1A 2EWFA 2FYVA 3BVVA 4NSWA 3LLLA 1OA1A
chains in the Genus database with same CATH topology
4IM2A 3QA8A 4JLCA 1SU6A 1DKYA 5FLEX 2OP6A 3OHXM 5E84A 1E1DA 1MJGA 2Z8YA 2KHOA 4JWIA 4PO2A 3VKHA 3LMFA 4JWCA 4FM3A 4IWOA 4IWQA 2OBMA 3C7NA 3GI7A 4NPHA 3ER8C 1SU8A 3DQGA 2YIVX 4JL9A 4KIKA 1SUFA 3UITA 2RT6A 4R5IA 2X5CA 3DOBA 4F00A 3B53X 4B9QA 2JNSA 3ERCC 3I39X 1YUWA 4IW0A 3T46A 3C7NB 3H0XA 4H6IA 3DPOA 2YI8A 5TKYA 4EZUA 3O3NB 1CKRA 1JQKA 4KIKB 4MQDA 3B52X 4JWEA 4EZWA 1SU7A 1GN9A 3D2EA 4E3CA 2LM0A 1Q5LA 1E2UA 4HY9A 7HSCA 3KAWA 4ILIA 3D2FA 3ZEDA 4EZXA 3ZEFA 4HYBA 4H6HA 4IM0A 3DPQA 2NCZA 3OWGA 4R5KA 4F01A 3KDRA 2OBLA 4JWDA 2GA9D 3O3OB 3VEBA 4ILHB 4EZRA 2YI9A 4WV5A 2WINM 3DPPA 1OAOA 3SBSA 4EZNA 2EX3B 2YIBA 4JNEA 3F7WA 4JN4A 3T48A 2GAFD 1OA0A 4EZTA 1GNLA 3VEAA 4FL9A 3I01A 3T49A 4R5GA 3T47A 1BPRA 4EZOA 1W9MA 4HR1A 4EZQA 5FIGA 4IWPA 2BPRA 1DKZA 2V7YA 1U00A 4HR1B 3QNJA 3L3OM 3T4AG 4R5JA 2QFFA 4EZPA 1DG4A 4UDYX 3B51X 3A98A 4G6QA 4EZSA 2ND0A 3I04A 4I43A 3N8EA 2QXLA 2N3KA 4ILGA 2PY6A 4M0MA 1UPXA 2YIAA 3ER9B 1GNTA 2ND1A 1DKXA 3FD9A 3KAVA 4D8JA 1E9VA 4EZVA 4IM3A 4UDXX 3SBTB 4EZYA 2EWFA 3RV0A 3RV1A 4JNFA 1ZYLA 4EZZA 4E81A 4R5LA 4WV7A 3O3MB 1OA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZP A;  5TKY A;  4EZU A;  1DG4 A;  4EZN A;  1CKR A;  4JWE A;  4JNE A;  1DKY A;  4EZS A;  4EZW A;  4JN4 A;  3T48 A;  2OP6 A;  3OHX M;  5E84 A;  4EZT A;  4FL9 A;  4JWI A;  3T49 A;  4PO2 A;  3D2E A;  3N8E A;  2QXL A;  4R5G A;  3T47 A;  1Q5L A;  4HY9 A;  1BPR A;  4EZO A;  4JWC A;  7HSC A;  4EZQ A;  3D2F A;  1DKX A;  4EZX A;  3C7N A;  4HYB A;  4H6H A;  3DPQ A;  4EZV A;  2BPR A;  1DKZ A;  4EZY A;  3DQG A;  4R5K A;  4F01 A;  2V7Y A;  4JNF A;  1U00 A;  3DOB A;  4R5I A;  4WV7 A;  4EZZ A;  4JWD A;  3QNJ A;  3L3O M;  3T4A G;  4E81 A;  4B9Q A;  4F00 A;  4R5L A;  1YUW A;  4EZR A;  3T46 A;  3C7N B;  2WIN M;  4R5J A;  2KHO A;  3H0X A;  4H6I A;  2QFF A;  3DPP A;  4WV5 A;  3DPO A; 
#chains in the Genus database with same CATH topology
 4IM2 A;  2YL8 A;  2F7Q A;  5E84 A;  1E1D A;  4JWI A;  3EJP A;  2YKT A;  3C7N A;  3LVT A;  2FIC A;  4ATM A;  1SUF A;  2RAI A;  1URU A;  3ERC C;  3B53 X;  3I39 X;  3T46 A;  1TQU A;  4EZU A;  3CZN A;  1CKR A;  4KIK B;  4MQD A;  4AZH A;  2ALW A;  1TQT A;  1SU7 A;  2F1A A;  4AZ5 A;  4E3C A;  1E2U A;  1HTY A;  4EZX A;  1Y2O A;  4HYB A;  2X3W A;  2OBL A;  3VEB A;  4ILH B;  4WV5 A;  3SBS A;  2F7R A;  4EZN A;  2YIB A;  3BUI A;  3BVX A;  3DX3 A;  4JNE A;  3I2W A;  3T48 A;  4EZT A;  3EJS A;  3T49 A;  4I1Q A;  2Q13 A;  3HAI A;  3T47 A;  1QX1 A;  1W9M A;  4EZQ A;  2LXY A;  1U00 A;  3T4A G;  3L3O M;  3G9G A;  2QFF A;  1DG4 A;  2O0I 1;  3B51 X;  2OZN B;  4G6Q A;  2JNK A;  3Q84 A;  4FZS A;  4WPC A;  2N3K A;  4ILG A;  3BLB A;  3DDF A;  4UDX X;  3SBT B;  2MI7 A;  4E81 A;  1YWM A;  1QWU A;  4WV7 A;  2KHO A;  3CV5 A;  1HWW A;  4AZI A;  2Z8Y A;  3LMF A;  4NQI A;  4JWC A;  4FM3 A;  2WYI A;  4AZC A;  2Z0O A;  1O7D C;  1SU8 A;  3DDG A;  3Q0K A;  4JL9 A;  3DOB A;  2RAK A;  4F00 A;  4B9Q A;  2JNS A;  3C7N B;  3HAH A;  4H6I A;  3DPO A;  5TKY A;  3O3N B;  1WDZ A;  4JWE A;  2QKW A;  3PLT A;  3D2E A;  4HY9 A;  3KAW A;  4ILI A;  3ZEF A;  2OW6 A;  3OWG A;  4JWD A;  2GA9 D;  4EZR A;  3CVR A;  2F1B A;  5KBP A;  4JN4 A;  2YL5 A;  2YL6 A;  3EJT A;  2ZXQ A;  3D4Z A;  4R5G A;  1BPR A;  4EZO A;  5FIG A;  1X03 A;  2Q12 A;  3QNJ A;  4BNE A;  1QWN A;  2OW7 A;  4UDY X;  2D1L A;  4I43 A;  3OK8 A;  4AZ7 A;  3RPM A;  1HXK A;  4M0M A;  3ER9 B;  1GNT A;  1DKX A;  4D8J A;  4EZV A;  3QNI A;  4EZY A;  4JNF A;  3CKD A;  3DX1 A;  1ZYL A;  4EZZ A;  3O3M B;  2ELB A;  3CZS A;  3D50 A;  3QA8 A;  4FZO A;  1SU6 A;  5FLE X;  2OP6 A;  3HAJ A;  3SYV A;  1I4L A;  1TQW A;  2YLA A;  2V0O A;  4AZB A;  4WPE A;  3GI7 A;  3UIT A;  4R5I A;  2X5C A;  3BVT A;  1R34 A;  4AZC B;  1YUW A;  3D51 A;  1JQK A;  3B52 X;  3DX2 A;  3EJR A;  4EZW A;  3SOG A;  4FZP A;  1GN9 A;  2LM0 A;  1ZWW A;  7HSC A;  4DCN C;  3ZED A;  4H6H A;  3DPQ A;  3D4Y A;  3KDR A;  2WIN M;  1TQS A;  3QE6 A;  3ABH A;  3F7W A;  2GAF D;  1OA0 A;  1GNL A;  3L3P A;  2YL9 A;  3VEA A;  4FL9 A;  4HR1 A;  2YLL A;  1R33 A;  3BVW A;  2OO2 A;  4DYL A;  3BUQ A;  5C5B B;  4AZG A;  1O7D B;  2BPR A;  1DKZ A;  1X04 A;  2V7Y A;  2X3X A;  3CAZ A;  4AVM A;  2GF4 A;  3D52 A;  2PMR A;  5C5B A;  2F7O A;  3M3W A;  2YIA A;  2ND1 A;  3FD9 A;  3DYT A;  3EJU A;  1R5E A;  3RV0 A;  4AZ6 A;  4R5L A;  2F7P A;  4JLC A;  1DKY A;  3OHX M;  1I4T A;  1MJG A;  4PO2 A;  3VKH A;  2C08 A;  3QWE A;  3ACO A;  4IWQ A;  4IWO A;  2OBM A;  1PS3 A;  4NPH A;  3ER8 C;  3DQG A;  2YIV X;  4KIK A;  2RT6 A;  2Z0N A;  4IW0 A;  3H0X A;  2YI8 A;  2RAJ A;  2EFK A;  1Q5L A;  3D2F A;  3BUB A;  3BUD A;  4IM0 A;  2NCZ A;  4R5K A;  4F01 A;  4AKV A;  3O3O B;  2YI9 A;  3DPP A;  1OAO A;  2WYH A;  2EX3 B;  4H8S A;  2EFL A;  3BUP A;  2Z0V A;  3I01 A;  1TQV A;  3DX0 A;  3BVU A;  3DX4 A;  4IWP A;  2X3V A;  1I4D A;  4HR1 B;  1I49 A;  4R5J A;  4EZP A;  3A98 A;  4EZS A;  2ND0 A;  1LQ7 A;  2D4C A;  3EJQ A;  3I04 A;  3N8E A;  2QXL A;  2PY6 A;  2F18 A;  1UPX A;  3KAV A;  1E9V A;  4IM3 A;  3RV1 A;  2EWF A;  2FYV A;  3BVV A;  4NSW A;  3LLL A;  1OA1 A; 
#chains in the Genus database with same CATH homology
 4IM2 A;  3QA8 A;  4JLC A;  1SU6 A;  1DKY A;  5FLE X;  2OP6 A;  3OHX M;  5E84 A;  1E1D A;  1MJG A;  2Z8Y A;  2KHO A;  4JWI A;  4PO2 A;  3VKH A;  3LMF A;  4JWC A;  4FM3 A;  4IWO A;  4IWQ A;  2OBM A;  3C7N A;  3GI7 A;  4NPH A;  3ER8 C;  1SU8 A;  3DQG A;  2YIV X;  4JL9 A;  4KIK A;  1SUF A;  3UIT A;  2RT6 A;  4R5I A;  2X5C A;  3DOB A;  4F00 A;  3B53 X;  4B9Q A;  2JNS A;  3ERC C;  3I39 X;  1YUW A;  4IW0 A;  3T46 A;  3C7N B;  3H0X A;  4H6I A;  3DPO A;  2YI8 A;  5TKY A;  4EZU A;  3O3N B;  1CKR A;  1JQK A;  4KIK B;  4MQD A;  3B52 X;  4JWE A;  4EZW A;  1SU7 A;  1GN9 A;  3D2E A;  4E3C A;  2LM0 A;  1Q5L A;  1E2U A;  4HY9 A;  7HSC A;  3KAW A;  4ILI A;  3D2F A;  3ZED A;  4EZX A;  3ZEF A;  4HYB A;  4H6H A;  4IM0 A;  3DPQ A;  2NCZ A;  3OWG A;  4R5K A;  4F01 A;  3KDR A;  2OBL A;  4JWD A;  2GA9 D;  3O3O B;  3VEB A;  4ILH B;  4EZR A;  2YI9 A;  4WV5 A;  2WIN M;  3DPP A;  1OAO A;  3SBS A;  4EZN A;  2EX3 B;  2YIB A;  4JNE A;  3F7W A;  4JN4 A;  3T48 A;  2GAF D;  1OA0 A;  4EZT A;  1GNL A;  3VEA A;  4FL9 A;  3I01 A;  3T49 A;  4R5G A;  3T47 A;  1BPR A;  4EZO A;  1W9M A;  4HR1 A;  4EZQ A;  5FIG A;  4IWP A;  2BPR A;  1DKZ A;  2V7Y A;  1U00 A;  4HR1 B;  3QNJ A;  3L3O M;  3T4A G;  4R5J A;  2QFF A;  4EZP A;  1DG4 A;  4UDY X;  3B51 X;  3A98 A;  4G6Q A;  4EZS A;  2ND0 A;  3I04 A;  4I43 A;  3N8E A;  2QXL A;  2N3K A;  4ILG A;  2PY6 A;  4M0M A;  1UPX A;  2YIA A;  3ER9 B;  1GNT A;  2ND1 A;  1DKX A;  3FD9 A;  3KAV A;  4D8J A;  1E9V A;  4EZV A;  4IM3 A;  4UDX X;  3SBT B;  4EZY A;  2EWF A;  3RV0 A;  3RV1 A;  4JNF A;  1ZYL A;  4EZZ A;  4E81 A;  4R5L A;  4WV7 A;  3O3M B;  1OA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...