4WV7A

Heat shock protein 70 substrate binding domain with covalently linked novolactone
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
145
Chain Sequence
DVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDLSKEEIERMVQEAEKYKAEDEVQRERVSKNALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein 1A/1B
publication title The novolactone natural product disrupts the allosteric regulation of hsp70.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/chaperone inhibitor
total genus 37
structure length 145
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4wv7A00
4R5GA 2OP6A 3DPQA 3D2EA 2V7YA 4F01A 7HSCA 4F00A 3C7NB 3D2FA 4PO2A 3DPOA 4JWCA 4R5IA 4EZNA 4EZSA 4B9QA 1Q5LA 1BPRA 1DG4A 4R5LA 4WV5A 2QXLA 4EZUA 4EZVA 3H0XA 4HYBA 4JWDA 3C7NA 4EZWA 4EZZA 4EZOA 4E81A 4EZYA 4EZPA 1DKZA 3DQGA 1DKYA 4EZTA 2BPRA 4HY9A 3N8EA 4JNEA 4R5JA 3QNJA 5TKYA 4FL9A 4JWEA 1DKXA 4JNFA 3DPPA 1U00A 4JN4A 1YUWA 4EZXA 3DOBA 2KHOA 4WV7A 4EZRA 1CKRA 5E84A 4R5KA 4EZQA 4JWIA
chains in the Genus database with same CATH superfamily
4R5GA 2OP6A 3DPQA 3D2EA 2V7YA 4F01A 7HSCA 4F00A 3C7NB 3D2FA 4PO2A 3DPOA 4JWCA 4R5IA 4EZNA 4EZSA 4B9QA 1Q5LA 3ZEFA 1BPRA 4ILIA 4ILGA 1DG4A 4R5LA 4WV5A 2QXLA 4EZUA 4EZVA 3H0XA 4HYBA 4JWDA 3C7NA 4EZWA 4EZZA 4EZOA 4E81A 4MQDA 4ILHB 4EZPA 1DKZA 4EZYA 3DQGA 3SBSA 1DKYA 4EZTA 2BPRA 4HY9A 3N8EA 4JNEA 4R5JA 3QNJA 5TKYA 4FL9A 4JWEA 1DKXA 4JNFA 3SBTB 3DPPA 1U00A 4JN4A 1YUWA 4I43A 4EZXA 3DOBA 2KHOA 4WV7A 4EZRA 1CKRA 5E84A 4R5KA 4EZQA 4JWIA
chains in the Genus database with same CATH topology
4R5GA 2OP6A 3DPQA 3D2EA 2V7YA 4F01A 7HSCA 4F00A 3C7NB 3D2FA 4PO2A 3DPOA 4JWCA 4R5IA 4EZNA 4EZSA 4B9QA 1Q5LA 3ZEFA 1BPRA 4ILIA 4ILGA 1DG4A 4R5LA 4WV5A 2QXLA 4EZUA 4EZVA 3H0XA 4HYBA 4JWDA 3C7NA 4EZWA 4EZZA 4EZOA 4E81A 4MQDA 4ILHB 4EZPA 1DKZA 4EZYA 3DQGA 3SBSA 1DKYA 4EZTA 2BPRA 4HY9A 3N8EA 4JNEA 4R5JA 3QNJA 5TKYA 4FL9A 4JWEA 1DKXA 4JNFA 3SBTB 3DPPA 1U00A 4JN4A 1YUWA 4I43A 4EZXA 3DOBA 2KHOA 4WV7A 4EZRA 1CKRA 5E84A 4R5KA 4EZQA 4JWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5G A;  2OP6 A;  3DPQ A;  3D2E A;  2V7Y A;  4F01 A;  7HSC A;  4F00 A;  3C7N B;  3D2F A;  4PO2 A;  3DPO A;  4JWC A;  4R5I A;  4EZN A;  4EZS A;  4B9Q A;  1Q5L A;  1BPR A;  1DG4 A;  4R5L A;  4WV5 A;  2QXL A;  4EZU A;  4EZV A;  3H0X A;  4HYB A;  4JWD A;  3C7N A;  4EZW A;  4EZZ A;  4EZO A;  4E81 A;  4EZY A;  4EZP A;  1DKZ A;  3DQG A;  1DKY A;  4EZT A;  2BPR A;  4HY9 A;  3N8E A;  4JNE A;  4R5J A;  3QNJ A;  5TKY A;  4FL9 A;  4JWE A;  1DKX A;  4JNF A;  3DPP A;  1U00 A;  4JN4 A;  1YUW A;  4EZX A;  3DOB A;  2KHO A;  4WV7 A;  4EZR A;  1CKR A;  5E84 A;  4R5K A;  4EZQ A;  4JWI A; 
#chains in the Genus database with same CATH topology
 4R5G A;  2OP6 A;  3DPQ A;  3D2E A;  2V7Y A;  4F01 A;  7HSC A;  4F00 A;  3C7N B;  3D2F A;  4PO2 A;  3DPO A;  4JWC A;  4R5I A;  4EZN A;  4EZS A;  4B9Q A;  1Q5L A;  3ZEF A;  1BPR A;  4ILI A;  4ILG A;  1DG4 A;  4R5L A;  4WV5 A;  2QXL A;  4EZU A;  4EZV A;  3H0X A;  4HYB A;  4JWD A;  3C7N A;  4EZW A;  4EZZ A;  4EZO A;  4E81 A;  4MQD A;  4ILH B;  4EZP A;  1DKZ A;  4EZY A;  3DQG A;  3SBS A;  1DKY A;  4EZT A;  2BPR A;  4HY9 A;  3N8E A;  4JNE A;  4R5J A;  3QNJ A;  5TKY A;  4FL9 A;  4JWE A;  1DKX A;  4JNF A;  3SBT B;  3DPP A;  1U00 A;  4JN4 A;  1YUW A;  4I43 A;  4EZX A;  3DOB A;  2KHO A;  4WV7 A;  4EZR A;  1CKR A;  5E84 A;  4R5K A;  4EZQ A;  4JWI A; 
#chains in the Genus database with same CATH homology
 4R5G A;  2OP6 A;  3DPQ A;  3D2E A;  2V7Y A;  4F01 A;  7HSC A;  4F00 A;  3C7N B;  3D2F A;  4PO2 A;  3DPO A;  4JWC A;  4R5I A;  4EZN A;  4EZS A;  4B9Q A;  1Q5L A;  3ZEF A;  1BPR A;  4ILI A;  4ILG A;  1DG4 A;  4R5L A;  4WV5 A;  2QXL A;  4EZU A;  4EZV A;  3H0X A;  4HYB A;  4JWD A;  3C7N A;  4EZW A;  4EZZ A;  4EZO A;  4E81 A;  4MQD A;  4ILH B;  4EZP A;  1DKZ A;  4EZY A;  3DQG A;  3SBS A;  1DKY A;  4EZT A;  2BPR A;  4HY9 A;  3N8E A;  4JNE A;  4R5J A;  3QNJ A;  5TKY A;  4FL9 A;  4JWE A;  1DKX A;  4JNF A;  3SBT B;  3DPP A;  1U00 A;  4JN4 A;  1YUW A;  4I43 A;  4EZX A;  3DOB A;  2KHO A;  4WV7 A;  4EZR A;  1CKR A;  5E84 A;  4R5K A;  4EZQ A;  4JWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...