4EZUA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-bombesin in space group i222
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
216
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
total genus 69
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezuA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezuA01
3DPOA 3T4AG 3DPPA 1DKYA 3T48A 4R5GA 3T47A 3T49A 4FL9A 2WINM 2V7YA 4JN4A 1U00A 4EZTA 1Q5LA 2KHOA 4EZZA 5E84A 4EZPA 4H6HA 4EZYA 3H0XA 3N8EA 4EZSA 1DKXA 3D2EA 3C7NB 4R5LA 3QNJA 1DKZA 4EZUA 4EZXA 1YUWA 3DPQA 4JNFA 4F01A 3L3OM 4HYBA 4JWIA 4EZWA 4EZRA 4WV5A 1CKRA 3D2FA 4E81A 2BPRA 4JWCA 7HSCA 4EZNA 4EZQA 4R5JA 2OP6A 4EZVA 4H6IA 4R5KA 3DQGA 2QXLA 3OHXM 4R5IA 3T46A 3DOBA 4HY9A 4WV7A 1DG4A 4B9QA 5TKYA 3C7NA 4JWEA 4JWDA 4JNEA 4PO2A 1BPRA 2QFFA 4EZOA 4F00A
chains in the Genus database with same CATH superfamily
3T4AG 3HAJA 3M3WA 3LVTA 3PLTA 3HAIA 1DKXA 3DYTA 1I49A 2WYHA 4FZOA 2OZNB 1E2UA 1TQVA 2BPRA 1X04A 4R5IA 4UDYX 1PS3A 1ZWWA 3B53X 3G9GA 1OA1A 1TQWA 2D4CA 3A98A 5C5BA 2Z0VA 3ACOA 3N8EA 3EJSA 4E3CA 3VKHA 3QE6A 1YUWA 5KBPA 4JWIA 2X5CA 2OW6A 2JNKA 4EZQA 2EWFA 2F18A 1JQKA 3QA8A 3B51X 2ND1A 3OWGA 3BUPA 3ABHA 1GNTA 4EZPA 4EZSA 3C7NB 3QNJA 3EJQA 1E1DA 1YWMA 3BLBA 4R5KA 4WV7A 1R33A 2GAFD 3BVXA 1GNLA 3QWEA 4IM0A 3FD9A 2QKWA 4D8JA 3BUIA 4EZYA 4H6HA 4IM3A 3BUDA 4EZXA 1I4TA 3L3OM 4HYBA 3ZEDA 3DX4A 4JL9A 2ELBA 2YL6A 3D51A 4H6IA 3EJTA 4JWEA 4ILGA 2YKTA 2RAJA 4EZOA 4AVMA 4F00A 1TQSA 4ILIA 2Q12A 4IWOA 3D52A 3RV0A 2Q13A 1DG4A 3CKDA 4EZUA 3D50A 4WPEA 4G6QA 2V0OA 1MJGA 2LM0A 2ND0A 3O3OB 1UPXA 4KIKA 3DPOA 3CZNA 3L3PA 2C08A 4IM2A 2V7YA 3EJRA 3DX2A 1Q5LA 1TQTA 3SOGA 4EZWA 1W9MA 2F7OA 1HXKA 1TQUA 3BVWA 1HTYA 4AKVA 3OK8A 2WYIA 3T47A 3EJUA 4WPCA 4DCNC 3DX3A 2EFLA 4ILHB 4F01A 3CV5A 3KDRA 2YIAA 4EZVA 5FLEX 2YL8A 2RAKA 4R5GA 3T49A 4H8SA 3F7WA 5FIGA 1ZYLA 3BVVA 2JNSA 4WV5A 2OBMA 4EZNA 2RT6A 2YLAA 3ER8C 1SUFA 4AZBA 2ALWA 4AZHA 2PY6A 4AZ5A 4EZTA 2X3WA 4EZZA 1X03A 4AZCA 3DX0A 3DQGA 2YL9A 3SYVA 4JWDA 3T48A 3LMFA 3CZSA 1URUA 2YL5A 2YI8A 4UDXX 4ATMA 1R5EA 2Z8YA 1I4DA 1OAOA 2N3KA 4I43A 3DPQA 3VEBA 4HR1A 4FZSA 5C5BB 2FICA 2FYVA 3C7NA 1SU7A 3Q0KA 2YIVX 3I04A 2WINM 1QWNA 4JN4A 1HWWA 4FZPA 5E84A 3H0XA 3DDGA 2MI7A 3BVUA 4AZGA 4EZRA 4E81A 1QX1A 3BVTA 4I1QA 4AZ6A 1Y2OA 4PO2A 3RPMA 1O7DC 1BPRA 4MQDA 2PMRA 4FL9A 1GN9A 3BUBA 2YLLA 1U00A 4AZ7A 4NPHA 4IW0A 4JNFA 3ERCC 2F7QA 1I4LA 3O3NB 2YI9A 2F1BA 4AZCB 3VEAA 3EJPA 4IWQA 2OO2A 3D4ZA 1WDZA 1O7DB 3CAZA 3ZEFA 2EFKA 3DDFA 3D2EA 2EX3B 1CKRA 4JWCA 3KAVA 4HY9A 5TKYA 4JNEA 4DYLA 4NSWA 4AZIA 2OW7A 2X3XA 3QNIA 3D4YA 1DKYA 4HR1B 3BUQA 2F7RA 3CVRA 3SBTB 2F7PA 1QWUA 4M0MA 1LQ7A 3LLLA 4KIKB 4FM3A 1E9VA 3ER9B 4NQIA 3D2FA 3UITA 3RV1A 2NCZA 7HSCA 3Q84A 2OP6A 2Z0NA 2X3VA 3T46A 1SU8A 2D1LA 2QFFA 1OA0A 3I2WA 3DPPA 2F1AA 3I01A 4JLCA 2OBLA 3DX1A 3I39X 3HAHA 1DKZA 1SU6A 2YIBA 2LXYA 2O0I1 3GI7A 4BNEA 2QXLA 3OHXM 3DOBA 3KAWA 3SBSA 2Z0OA 2RAIA 2GF4A 2KHOA 4IWPA 4R5LA 2ZXQA 3O3MB 4R5JA 1R34A 4B9QA 2GA9D 3B52X
chains in the Genus database with same CATH topology
3T4AG 4ILIA 3ZEFA 4IWOA 4EZTA 3RV0A 4EZZA 1DG4A 1DKXA 3D2EA 4EZUA 2EX3B 1E2UA 1CKRA 2BPRA 4JWCA 4G6QA 3KAVA 1MJGA 3DQGA 2LM0A 4R5IA 4UDYX 4HY9A 2ND0A 3O3OB 5TKYA 4JWDA 4JNEA 1UPXA 3B53X 4KIKA 3T48A 3LMFA 1OA1A 3DPOA 1DKYA 4HR1B 3A98A 4IM2A 2V7YA 3SBTB 2YI8A 1Q5LA 4UDXX 3N8EA 4E3CA 2Z8YA 1OAOA 2N3KA 4M0MA 4I43A 3VKHA 4KIKB 4EZOA 1YUWA 3DPQA 1E9VA 4FM3A 4JWIA 4EZWA 3ER9B 3VEBA 2X5CA 3D2FA 3UITA 4HR1A 3RV1A 1W9MA 2NCZA 7HSCA 4EZQA 2OP6A 2EWFA 3T46A 1SU8A 3C7NA 1SU7A 2QFFA 1JQKA 1OA0A 3QA8A 3DPPA 3B51X 2YIVX 3T47A 3I04A 2WINM 4JN4A 2ND1A 3I01A 3OWGA 4JLCA 2OBLA 1GNTA 4EZPA 5E84A 3H0XA 4EZSA 3C7NB 3I39X 3QNJA 1DKZA 4ILHB 4F01A 4EZRA 1SU6A 2YIBA 3KDRA 4E81A 1E1DA 2YIAA 3GI7A 4EZVA 4R5KA 5FLEX 2QXLA 3OHXM 3DOBA 4WV7A 4PO2A 2GAFD 1GNLA 1BPRA 4MQDA 3KAWA 4R5GA 4FL9A 3T49A 1GN9A 4IM0A 3FD9A 3SBSA 1U00A 3F7WA 5FIGA 4D8JA 1ZYLA 2KHOA 4NPHA 4EZYA 4H6HA 4IM3A 2JNSA 4IWPA 4R5LA 4IW0A 4EZXA 4WV5A 4JNFA 2OBMA 3L3OM 4HYBA 3ZEDA 3ERCC 4JL9A 4EZNA 3O3MB 4R5JA 4H6IA 2RT6A 3O3NB 2YI9A 3VEAA 3ER8C 4B9QA 2GA9D 3B52X 1SUFA 4JWEA 4ILGA 4IWQA 2PY6A 4F00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPO A;  3T4A G;  3DPP A;  1DKY A;  3T48 A;  4R5G A;  3T47 A;  3T49 A;  4FL9 A;  2WIN M;  2V7Y A;  4JN4 A;  1U00 A;  4EZT A;  1Q5L A;  2KHO A;  4EZZ A;  5E84 A;  4EZP A;  4H6H A;  4EZY A;  3H0X A;  3N8E A;  4EZS A;  1DKX A;  3D2E A;  3C7N B;  4R5L A;  3QNJ A;  1DKZ A;  4EZU A;  4EZX A;  1YUW A;  3DPQ A;  4JNF A;  4F01 A;  3L3O M;  4HYB A;  4JWI A;  4EZW A;  4EZR A;  4WV5 A;  1CKR A;  3D2F A;  4E81 A;  2BPR A;  4JWC A;  7HSC A;  4EZN A;  4EZQ A;  4R5J A;  2OP6 A;  4EZV A;  4H6I A;  4R5K A;  3DQG A;  2QXL A;  3OHX M;  4R5I A;  3T46 A;  3DOB A;  4HY9 A;  4WV7 A;  1DG4 A;  4B9Q A;  5TKY A;  3C7N A;  4JWE A;  4JWD A;  4JNE A;  4PO2 A;  1BPR A;  2QFF A;  4EZO A;  4F00 A; 
#chains in the Genus database with same CATH topology
 3T4A G;  3HAJ A;  3M3W A;  3LVT A;  3PLT A;  3HAI A;  1DKX A;  3DYT A;  1I49 A;  2WYH A;  4FZO A;  2OZN B;  1E2U A;  1TQV A;  2BPR A;  1X04 A;  4R5I A;  4UDY X;  1PS3 A;  1ZWW A;  3B53 X;  3G9G A;  1OA1 A;  1TQW A;  2D4C A;  3A98 A;  5C5B A;  2Z0V A;  3ACO A;  3N8E A;  3EJS A;  4E3C A;  3VKH A;  3QE6 A;  1YUW A;  5KBP A;  4JWI A;  2X5C A;  2OW6 A;  2JNK A;  4EZQ A;  2EWF A;  2F18 A;  1JQK A;  3QA8 A;  3B51 X;  2ND1 A;  3OWG A;  3BUP A;  3ABH A;  1GNT A;  4EZP A;  4EZS A;  3C7N B;  3QNJ A;  3EJQ A;  1E1D A;  1YWM A;  3BLB A;  4R5K A;  4WV7 A;  1R33 A;  2GAF D;  3BVX A;  1GNL A;  3QWE A;  4IM0 A;  3FD9 A;  2QKW A;  4D8J A;  3BUI A;  4EZY A;  4H6H A;  4IM3 A;  3BUD A;  4EZX A;  1I4T A;  3L3O M;  4HYB A;  3ZED A;  3DX4 A;  4JL9 A;  2ELB A;  2YL6 A;  3D51 A;  4H6I A;  3EJT A;  4JWE A;  4ILG A;  2YKT A;  2RAJ A;  4EZO A;  4AVM A;  4F00 A;  1TQS A;  4ILI A;  2Q12 A;  4IWO A;  3D52 A;  3RV0 A;  2Q13 A;  1DG4 A;  3CKD A;  4EZU A;  3D50 A;  4WPE A;  4G6Q A;  2V0O A;  1MJG A;  2LM0 A;  2ND0 A;  3O3O B;  1UPX A;  4KIK A;  3DPO A;  3CZN A;  3L3P A;  2C08 A;  4IM2 A;  2V7Y A;  3EJR A;  3DX2 A;  1Q5L A;  1TQT A;  3SOG A;  4EZW A;  1W9M A;  2F7O A;  1HXK A;  1TQU A;  3BVW A;  1HTY A;  4AKV A;  3OK8 A;  2WYI A;  3T47 A;  3EJU A;  4WPC A;  4DCN C;  3DX3 A;  2EFL A;  4ILH B;  4F01 A;  3CV5 A;  3KDR A;  2YIA A;  4EZV A;  5FLE X;  2YL8 A;  2RAK A;  4R5G A;  3T49 A;  4H8S A;  3F7W A;  5FIG A;  1ZYL A;  3BVV A;  2JNS A;  4WV5 A;  2OBM A;  4EZN A;  2RT6 A;  2YLA A;  3ER8 C;  1SUF A;  4AZB A;  2ALW A;  4AZH A;  2PY6 A;  4AZ5 A;  4EZT A;  2X3W A;  4EZZ A;  1X03 A;  4AZC A;  3DX0 A;  3DQG A;  2YL9 A;  3SYV A;  4JWD A;  3T48 A;  3LMF A;  3CZS A;  1URU A;  2YL5 A;  2YI8 A;  4UDX X;  4ATM A;  1R5E A;  2Z8Y A;  1I4D A;  1OAO A;  2N3K A;  4I43 A;  3DPQ A;  3VEB A;  4HR1 A;  4FZS A;  5C5B B;  2FIC A;  2FYV A;  3C7N A;  1SU7 A;  3Q0K A;  2YIV X;  3I04 A;  2WIN M;  1QWN A;  4JN4 A;  1HWW A;  4FZP A;  5E84 A;  3H0X A;  3DDG A;  2MI7 A;  3BVU A;  4AZG A;  4EZR A;  4E81 A;  1QX1 A;  3BVT A;  4I1Q A;  4AZ6 A;  1Y2O A;  4PO2 A;  3RPM A;  1O7D C;  1BPR A;  4MQD A;  2PMR A;  4FL9 A;  1GN9 A;  3BUB A;  2YLL A;  1U00 A;  4AZ7 A;  4NPH A;  4IW0 A;  4JNF A;  3ERC C;  2F7Q A;  1I4L A;  3O3N B;  2YI9 A;  2F1B A;  4AZC B;  3VEA A;  3EJP A;  4IWQ A;  2OO2 A;  3D4Z A;  1WDZ A;  1O7D B;  3CAZ A;  3ZEF A;  2EFK A;  3DDF A;  3D2E A;  2EX3 B;  1CKR A;  4JWC A;  3KAV A;  4HY9 A;  5TKY A;  4JNE A;  4DYL A;  4NSW A;  4AZI A;  2OW7 A;  2X3X A;  3QNI A;  3D4Y A;  1DKY A;  4HR1 B;  3BUQ A;  2F7R A;  3CVR A;  3SBT B;  2F7P A;  1QWU A;  4M0M A;  1LQ7 A;  3LLL A;  4KIK B;  4FM3 A;  1E9V A;  3ER9 B;  4NQI A;  3D2F A;  3UIT A;  3RV1 A;  2NCZ A;  7HSC A;  3Q84 A;  2OP6 A;  2Z0N A;  2X3V A;  3T46 A;  1SU8 A;  2D1L A;  2QFF A;  1OA0 A;  3I2W A;  3DPP A;  2F1A A;  3I01 A;  4JLC A;  2OBL A;  3DX1 A;  3I39 X;  3HAH A;  1DKZ A;  1SU6 A;  2YIB A;  2LXY A;  2O0I 1;  3GI7 A;  4BNE A;  2QXL A;  3OHX M;  3DOB A;  3KAW A;  3SBS A;  2Z0O A;  2RAI A;  2GF4 A;  2KHO A;  4IWP A;  4R5L A;  2ZXQ A;  3O3M B;  4R5J A;  1R34 A;  4B9Q A;  2GA9 D;  3B52 X; 
#chains in the Genus database with same CATH homology
 3T4A G;  4ILI A;  3ZEF A;  4IWO A;  4EZT A;  3RV0 A;  4EZZ A;  1DG4 A;  1DKX A;  3D2E A;  4EZU A;  2EX3 B;  1E2U A;  1CKR A;  2BPR A;  4JWC A;  4G6Q A;  3KAV A;  1MJG A;  3DQG A;  2LM0 A;  4R5I A;  4UDY X;  4HY9 A;  2ND0 A;  3O3O B;  5TKY A;  4JWD A;  4JNE A;  1UPX A;  3B53 X;  4KIK A;  3T48 A;  3LMF A;  1OA1 A;  3DPO A;  1DKY A;  4HR1 B;  3A98 A;  4IM2 A;  2V7Y A;  3SBT B;  2YI8 A;  1Q5L A;  4UDX X;  3N8E A;  4E3C A;  2Z8Y A;  1OAO A;  2N3K A;  4M0M A;  4I43 A;  3VKH A;  4KIK B;  4EZO A;  1YUW A;  3DPQ A;  1E9V A;  4FM3 A;  4JWI A;  4EZW A;  3ER9 B;  3VEB A;  2X5C A;  3D2F A;  3UIT A;  4HR1 A;  3RV1 A;  1W9M A;  2NCZ A;  7HSC A;  4EZQ A;  2OP6 A;  2EWF A;  3T46 A;  1SU8 A;  3C7N A;  1SU7 A;  2QFF A;  1JQK A;  1OA0 A;  3QA8 A;  3DPP A;  3B51 X;  2YIV X;  3T47 A;  3I04 A;  2WIN M;  4JN4 A;  2ND1 A;  3I01 A;  3OWG A;  4JLC A;  2OBL A;  1GNT A;  4EZP A;  5E84 A;  3H0X A;  4EZS A;  3C7N B;  3I39 X;  3QNJ A;  1DKZ A;  4ILH B;  4F01 A;  4EZR A;  1SU6 A;  2YIB A;  3KDR A;  4E81 A;  1E1D A;  2YIA A;  3GI7 A;  4EZV A;  4R5K A;  5FLE X;  2QXL A;  3OHX M;  3DOB A;  4WV7 A;  4PO2 A;  2GAF D;  1GNL A;  1BPR A;  4MQD A;  3KAW A;  4R5G A;  4FL9 A;  3T49 A;  1GN9 A;  4IM0 A;  3FD9 A;  3SBS A;  1U00 A;  3F7W A;  5FIG A;  4D8J A;  1ZYL A;  2KHO A;  4NPH A;  4EZY A;  4H6H A;  4IM3 A;  2JNS A;  4IWP A;  4R5L A;  4IW0 A;  4EZX A;  4WV5 A;  4JNF A;  2OBM A;  3L3O M;  4HYB A;  3ZED A;  3ERC C;  4JL9 A;  4EZN A;  3O3M B;  4R5J A;  4H6I A;  2RT6 A;  3O3N B;  2YI9 A;  3VEA A;  3ER8 C;  4B9Q A;  2GA9 D;  3B52 X;  1SUF A;  4JWE A;  4ILG A;  4IWQ A;  2PY6 A;  4F00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...