4R5KA

Crystal structure of the dnak c-terminus (dnak-sbd-b)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
225
structure length
221
Chain Sequence
HHHHHHIEVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKANEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 221
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5kA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5kA01
4EZNA 4JWDA 2QXLA 1DKZA 4H6HA 4WV5A 4R5JA 4EZPA 3DQGA 1Q5LA 3DPQA 4HYBA 4EZQA 5E84A 3D2EA 3C7NB 4R5GA 3C7NA 2KHOA 2WINM 3DPOA 3L3OM 4B9QA 4EZWA 4EZOA 4JWCA 3T46A 4EZYA 4F01A 4EZRA 3H0XA 4WV7A 4FL9A 1CKRA 2V7YA 1U00A 1DKXA 1DKYA 4JWIA 4EZVA 3DOBA 4HY9A 2BPRA 4EZTA 2QFFA 3N8EA 7HSCA 4JN4A 5TKYA 3D2FA 3T48A 1DG4A 3T47A 4PO2A 1YUWA 4EZUA 3QNJA 4JWEA 4JNFA 2OP6A 4JNEA 4F00A 4R5KA 3T4AG 4R5IA 4EZXA 4R5LA 3T49A 4EZSA 1BPRA 4H6IA 4E81A 4EZZA 3DPPA 3OHXM
chains in the Genus database with same CATH superfamily
4R5JA 2MI7A 4AZ7A 2OBMA 2YL9A 4B9QA 2KHOA 4KIKA 3BUPA 3CZSA 3H0XA 2RAKA 2ND1A 1I4LA 3A98A 2FYVA 2OW6A 1TQUA 2EFKA 2N3KA 4FZOA 4ILHB 2EWFA 3HAHA 1YUWA 3I04A 4NSWA 4JWEA 2RAIA 3BLBA 2YIVX 2YLLA 1OA1A 4UDYX 4EZPA 3CZNA 3PLTA 4NQIA 3DPOA 4BNEA 1TQWA 2F7QA 3ER8C 1HWWA 3EJUA 2QFFA 1Y2OA 1X03A 3CVRA 1SU6A 1GNLA 2D1LA 3Q84A 4IW0A 3T47A 2YL5A 4E81A 3ZEFA 3OHXM 4I1QA 2OBLA 4EZNA 3SBTB 3EJPA 1I49A 2RAJA 3B52X 3DPQA 2OW7A 4EZQA 3BUQA 3DDFA 1WDZA 2F7OA 1URUA 3HAJA 1X04A 3B53X 1ZYLA 3DX3A 1MJGA 3M3WA 1DKZA 2QXLA 1Q5LA 2X3XA 3BVVA 2ZXQA 4AVMA 2V0OA 4EZTA 1DG4A 5TKYA 2YI9A 4AZHA 4EZXA 1JQKA 2F7RA 4JL9A 1R34A 2YIBA 3LMFA 4WPCA 1SU7A 2F7PA 2Z0OA 3LLLA 2GAFD 2C08A 2LXYA 4AZ5A 4FZSA 4HY9A 4UDXX 4ATMA 1QWNA 4PO2A 3OK8A 2JNSA 1UPXA 2JNKA 1GN9A 4M0MA 2YKTA 3BVWA 4H6HA 3KAWA 1GNTA 4IM2A 3B51X 5KBPA 3D4ZA 3BUIA 3EJRA 2BPRA 2Z0VA 3EJQA 1W9MA 3T4AG 3EJSA 1SU8A 4JNEA 2YI8A 3QA8A 4ILIA 2ND0A 2Q12A 3RPMA 3C7NA 2EX3B 4WV7A 4F01A 4JWIA 3F7WA 2Z0NA 5FIGA 3KAVA 4F00A 4R5IA 1HTYA 1R33A 3G9GA 3D50A 4JWDA 3I2WA 3DYTA 4WV5A 3GI7A 4JLCA 3QWEA 4AZGA 3LVTA 3L3PA 2WYIA 3ERCC 2X5CA 4HR1B 4JN4A 3UITA 3D2FA 5C5BA 3BVUA 3D51A 4AZ6A 4AZCB 1YWMA 3DPPA 2EFLA 3VEAA 5FLEX 3CKDA 1PS3A 1QWUA 3OWGA 1E1DA 3ER9B 1I4DA 2Q13A 2ALWA 1TQSA 2F18A 3ACOA 4MQDA 3T49A 3QE6A 4EZZA 3O3OB 3D2EA 3C7NB 2ELBA 3L3OM 4EZYA 4G6QA 4E3CA 3ABHA 2F1AA 4IWOA 4HR1A 1HXKA 2OP6A 4I43A 1E9VA 2OO2A 1O7DC 4AZCA 1LQ7A 2PMRA 3O3MB 4JWCA 1QX1A 2YLAA 2X3VA 3T48A 2YL8A 5C5BB 3D4YA 3DDGA 3SBSA 4R5KA 3ZEDA 1I4TA 2GF4A 3DX2A 4EZWA 2YIAA 3VEBA 3BUDA 4FL9A 2D4CA 2X3WA 3DX4A 1DKYA 3QNIA 1TQVA 3DOBA 1SUFA 1OA0A 4JNFA 1BPRA 1E2UA 3Q0KA 1R5EA 4ILGA 3KDRA 2PY6A 3RV0A 1OAOA 2YL6A 1TQTA 4WPEA 4FZPA 1DKXA 4IM0A 4EZVA 2LM0A 3FD9A 3HAIA 4EZSA 4R5LA 4D8JA 4EZOA 2O0I1 3VKHA 3SOGA 3I01A 3CAZA 5E84A 4R5GA 4AZBA 4AZIA 4FM3A 3DX0A 4EZUA 3QNJA 4IM3A 4IWQA 4H8SA 4DCNC 3BVTA 3T46A 1O7DB 2QKWA 3BUBA 3DQGA 3O3NB 4HYBA 4KIKB 3CV5A 4EZRA 3DX1A 2GA9D 4DYLA 2RT6A 1ZWWA 3SYVA 4AKVA 4IWPA 2WYHA 2NCZA 2Z8YA 2WINM 1CKRA 2FICA 2OZNB 2V7YA 1U00A 4NPHA 3N8EA 7HSCA 3EJTA 2F1BA 3BVXA 3I39X 3RV1A 3D52A 4H6IA
chains in the Genus database with same CATH topology
2YIBA 3LMFA 3KDRA 4R5JA 3VEAA 1SU7A 2OBMA 5FLEX 2PY6A 3RV0A 1OAOA 3OWGA 1E1DA 4B9QA 2KHOA 4KIKA 3H0XA 3ER9B 2GAFD 2ND1A 3A98A 1DKXA 4IM0A 4EZVA 2N3KA 4HY9A 4UDXX 4ILHB 4PO2A 2EWFA 1YUWA 3I04A 4JWEA 2JNSA 1UPXA 2LM0A 3FD9A 4MQDA 4EZSA 4R5LA 3T49A 2YIVX 1GN9A 4D8JA 4M0MA 4EZZA 4EZOA 3O3OB 4H6HA 3KAWA 3VKHA 1GNTA 1OA1A 4UDYX 4EZPA 3I01A 4IM2A 3B51X 5E84A 3D2EA 3C7NB 4R5GA 3DPOA 3L3OM 4EZYA 4G6QA 3ER8C 4E3CA 4FM3A 2BPRA 4IWOA 2QFFA 3T47A 1SU6A 1GNLA 4HR1A 4IW0A 3QNJA 4IM3A 4IWQA 4EZUA 1W9MA 2OP6A 3T4AG 1SU8A 4I43A 1E9VA 4JNEA 4E81A 3ZEFA 3T46A 3OHXM 2OBLA 4EZNA 2YI8A 3QA8A 4ILIA 3SBTB 2ND0A 3DQGA 3O3NB 3B52X 3DPQA 4HYBA 4KIKB 4EZQA 3C7NA 2EX3B 3O3MB 4WV7A 4EZRA 4F01A 4JWCA 4JWIA 3F7WA 3T48A 3B53X 5FIGA 3KAVA 1ZYLA 2GA9D 3SBSA 1MJGA 4R5KA 2RT6A 4R5IA 4F00A 1DKZA 4JWDA 2QXLA 4IWPA 4WV5A 2NCZA 3GI7A 3ZEDA 4JLCA 1Q5LA 2Z8YA 2WINM 4EZWA 2YIAA 3VEBA 4FL9A 1CKRA 2V7YA 1U00A 4NPHA 1DKYA 3DOBA 3ERCC 2X5CA 4EZTA 3N8EA 4HR1B 7HSCA 4JN4A 5TKYA 3D2FA 3UITA 1DG4A 1SUFA 1OA0A 2YI9A 3I39X 4JNFA 1BPRA 3RV1A 4EZXA 1E2UA 1JQKA 4ILGA 4H6IA 4JL9A 3DPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZN A;  4JWD A;  2QXL A;  1DKZ A;  4H6H A;  4WV5 A;  4R5J A;  4EZP A;  3DQG A;  1Q5L A;  3DPQ A;  4HYB A;  4EZQ A;  5E84 A;  3D2E A;  3C7N B;  4R5G A;  3C7N A;  2KHO A;  2WIN M;  3DPO A;  3L3O M;  4B9Q A;  4EZW A;  4EZO A;  4JWC A;  3T46 A;  4EZY A;  4F01 A;  4EZR A;  3H0X A;  4WV7 A;  4FL9 A;  1CKR A;  2V7Y A;  1U00 A;  1DKX A;  1DKY A;  4JWI A;  4EZV A;  3DOB A;  4HY9 A;  2BPR A;  4EZT A;  2QFF A;  3N8E A;  7HSC A;  4JN4 A;  5TKY A;  3D2F A;  3T48 A;  1DG4 A;  3T47 A;  4PO2 A;  1YUW A;  4EZU A;  3QNJ A;  4JWE A;  4JNF A;  2OP6 A;  4JNE A;  4F00 A;  4R5K A;  3T4A G;  4R5I A;  4EZX A;  4R5L A;  3T49 A;  4EZS A;  1BPR A;  4H6I A;  4E81 A;  4EZZ A;  3DPP A;  3OHX M; 
#chains in the Genus database with same CATH topology
 4R5J A;  2MI7 A;  4AZ7 A;  2OBM A;  2YL9 A;  4B9Q A;  2KHO A;  4KIK A;  3BUP A;  3CZS A;  3H0X A;  2RAK A;  2ND1 A;  1I4L A;  3A98 A;  2FYV A;  2OW6 A;  1TQU A;  2EFK A;  2N3K A;  4FZO A;  4ILH B;  2EWF A;  3HAH A;  1YUW A;  3I04 A;  4NSW A;  4JWE A;  2RAI A;  3BLB A;  2YIV X;  2YLL A;  1OA1 A;  4UDY X;  4EZP A;  3CZN A;  3PLT A;  4NQI A;  3DPO A;  4BNE A;  1TQW A;  2F7Q A;  3ER8 C;  1HWW A;  3EJU A;  2QFF A;  1Y2O A;  1X03 A;  3CVR A;  1SU6 A;  1GNL A;  2D1L A;  3Q84 A;  4IW0 A;  3T47 A;  2YL5 A;  4E81 A;  3ZEF A;  3OHX M;  4I1Q A;  2OBL A;  4EZN A;  3SBT B;  3EJP A;  1I49 A;  2RAJ A;  3B52 X;  3DPQ A;  2OW7 A;  4EZQ A;  3BUQ A;  3DDF A;  1WDZ A;  2F7O A;  1URU A;  3HAJ A;  1X04 A;  3B53 X;  1ZYL A;  3DX3 A;  1MJG A;  3M3W A;  1DKZ A;  2QXL A;  1Q5L A;  2X3X A;  3BVV A;  2ZXQ A;  4AVM A;  2V0O A;  4EZT A;  1DG4 A;  5TKY A;  2YI9 A;  4AZH A;  4EZX A;  1JQK A;  2F7R A;  4JL9 A;  1R34 A;  2YIB A;  3LMF A;  4WPC A;  1SU7 A;  2F7P A;  2Z0O A;  3LLL A;  2GAF D;  2C08 A;  2LXY A;  4AZ5 A;  4FZS A;  4HY9 A;  4UDX X;  4ATM A;  1QWN A;  4PO2 A;  3OK8 A;  2JNS A;  1UPX A;  2JNK A;  1GN9 A;  4M0M A;  2YKT A;  3BVW A;  4H6H A;  3KAW A;  1GNT A;  4IM2 A;  3B51 X;  5KBP A;  3D4Z A;  3BUI A;  3EJR A;  2BPR A;  2Z0V A;  3EJQ A;  1W9M A;  3T4A G;  3EJS A;  1SU8 A;  4JNE A;  2YI8 A;  3QA8 A;  4ILI A;  2ND0 A;  2Q12 A;  3RPM A;  3C7N A;  2EX3 B;  4WV7 A;  4F01 A;  4JWI A;  3F7W A;  2Z0N A;  5FIG A;  3KAV A;  4F00 A;  4R5I A;  1HTY A;  1R33 A;  3G9G A;  3D50 A;  4JWD A;  3I2W A;  3DYT A;  4WV5 A;  3GI7 A;  4JLC A;  3QWE A;  4AZG A;  3LVT A;  3L3P A;  2WYI A;  3ERC C;  2X5C A;  4HR1 B;  4JN4 A;  3UIT A;  3D2F A;  5C5B A;  3BVU A;  3D51 A;  4AZ6 A;  4AZC B;  1YWM A;  3DPP A;  2EFL A;  3VEA A;  5FLE X;  3CKD A;  1PS3 A;  1QWU A;  3OWG A;  1E1D A;  3ER9 B;  1I4D A;  2Q13 A;  2ALW A;  1TQS A;  2F18 A;  3ACO A;  4MQD A;  3T49 A;  3QE6 A;  4EZZ A;  3O3O B;  3D2E A;  3C7N B;  2ELB A;  3L3O M;  4EZY A;  4G6Q A;  4E3C A;  3ABH A;  2F1A A;  4IWO A;  4HR1 A;  1HXK A;  2OP6 A;  4I43 A;  1E9V A;  2OO2 A;  1O7D C;  4AZC A;  1LQ7 A;  2PMR A;  3O3M B;  4JWC A;  1QX1 A;  2YLA A;  2X3V A;  3T48 A;  2YL8 A;  5C5B B;  3D4Y A;  3DDG A;  3SBS A;  4R5K A;  3ZED A;  1I4T A;  2GF4 A;  3DX2 A;  4EZW A;  2YIA A;  3VEB A;  3BUD A;  4FL9 A;  2D4C A;  2X3W A;  3DX4 A;  1DKY A;  3QNI A;  1TQV A;  3DOB A;  1SUF A;  1OA0 A;  4JNF A;  1BPR A;  1E2U A;  3Q0K A;  1R5E A;  4ILG A;  3KDR A;  2PY6 A;  3RV0 A;  1OAO A;  2YL6 A;  1TQT A;  4WPE A;  4FZP A;  1DKX A;  4IM0 A;  4EZV A;  2LM0 A;  3FD9 A;  3HAI A;  4EZS A;  4R5L A;  4D8J A;  4EZO A;  2O0I 1;  3VKH A;  3SOG A;  3I01 A;  3CAZ A;  5E84 A;  4R5G A;  4AZB A;  4AZI A;  4FM3 A;  3DX0 A;  4EZU A;  3QNJ A;  4IM3 A;  4IWQ A;  4H8S A;  4DCN C;  3BVT A;  3T46 A;  1O7D B;  2QKW A;  3BUB A;  3DQG A;  3O3N B;  4HYB A;  4KIK B;  3CV5 A;  4EZR A;  3DX1 A;  2GA9 D;  4DYL A;  2RT6 A;  1ZWW A;  3SYV A;  4AKV A;  4IWP A;  2WYH A;  2NCZ A;  2Z8Y A;  2WIN M;  1CKR A;  2FIC A;  2OZN B;  2V7Y A;  1U00 A;  4NPH A;  3N8E A;  7HSC A;  3EJT A;  2F1B A;  3BVX A;  3I39 X;  3RV1 A;  3D52 A;  4H6I A; 
#chains in the Genus database with same CATH homology
 2YIB A;  3LMF A;  3KDR A;  4R5J A;  3VEA A;  1SU7 A;  2OBM A;  5FLE X;  2PY6 A;  3RV0 A;  1OAO A;  3OWG A;  1E1D A;  4B9Q A;  2KHO A;  4KIK A;  3H0X A;  3ER9 B;  2GAF D;  2ND1 A;  3A98 A;  1DKX A;  4IM0 A;  4EZV A;  2N3K A;  4HY9 A;  4UDX X;  4ILH B;  4PO2 A;  2EWF A;  1YUW A;  3I04 A;  4JWE A;  2JNS A;  1UPX A;  2LM0 A;  3FD9 A;  4MQD A;  4EZS A;  4R5L A;  3T49 A;  2YIV X;  1GN9 A;  4D8J A;  4M0M A;  4EZZ A;  4EZO A;  3O3O B;  4H6H A;  3KAW A;  3VKH A;  1GNT A;  1OA1 A;  4UDY X;  4EZP A;  3I01 A;  4IM2 A;  3B51 X;  5E84 A;  3D2E A;  3C7N B;  4R5G A;  3DPO A;  3L3O M;  4EZY A;  4G6Q A;  3ER8 C;  4E3C A;  4FM3 A;  2BPR A;  4IWO A;  2QFF A;  3T47 A;  1SU6 A;  1GNL A;  4HR1 A;  4IW0 A;  3QNJ A;  4IM3 A;  4IWQ A;  4EZU A;  1W9M A;  2OP6 A;  3T4A G;  1SU8 A;  4I43 A;  1E9V A;  4JNE A;  4E81 A;  3ZEF A;  3T46 A;  3OHX M;  2OBL A;  4EZN A;  2YI8 A;  3QA8 A;  4ILI A;  3SBT B;  2ND0 A;  3DQG A;  3O3N B;  3B52 X;  3DPQ A;  4HYB A;  4KIK B;  4EZQ A;  3C7N A;  2EX3 B;  3O3M B;  4WV7 A;  4EZR A;  4F01 A;  4JWC A;  4JWI A;  3F7W A;  3T48 A;  3B53 X;  5FIG A;  3KAV A;  1ZYL A;  2GA9 D;  3SBS A;  1MJG A;  4R5K A;  2RT6 A;  4R5I A;  4F00 A;  1DKZ A;  4JWD A;  2QXL A;  4IWP A;  4WV5 A;  2NCZ A;  3GI7 A;  3ZED A;  4JLC A;  1Q5L A;  2Z8Y A;  2WIN M;  4EZW A;  2YIA A;  3VEB A;  4FL9 A;  1CKR A;  2V7Y A;  1U00 A;  4NPH A;  1DKY A;  3DOB A;  3ERC C;  2X5C A;  4EZT A;  3N8E A;  4HR1 B;  7HSC A;  4JN4 A;  5TKY A;  3D2F A;  3UIT A;  1DG4 A;  1SUF A;  1OA0 A;  2YI9 A;  3I39 X;  4JNF A;  1BPR A;  3RV1 A;  4EZX A;  1E2U A;  1JQK A;  4ILG A;  4H6I A;  4JL9 A;  3DPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...