4R5KA

Crystal structure of the dnak c-terminus (dnak-sbd-b)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
225
structure length
221
Chain Sequence
HHHHHHIEVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKANEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 68
structure length 221
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5kA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5kA01
4R5JA 7HSCA 3T46A 3C7NA 3OHXM 4R5LA 5TKYA 4B9QA 4HYBA 4R5IA 3T49A 4E81A 4EZTA 4EZZA 4EZOA 4EZNA 4EZXA 4JNFA 4WV5A 4HY9A 3D2FA 4H6HA 2BPRA 2QFFA 5E84A 3D2EA 1DKZA 4EZVA 1DKXA 3T4AG 1CKRA 2KHOA 1U00A 4EZWA 4FL9A 2V7YA 4R5KA 3T47A 3DPOA 4EZQA 3QNJA 4R5GA 3DPQA 1BPRA 4JWEA 2WINM 4EZYA 4F00A 1YUWA 4JWCA 4EZSA 4F01A 3DPPA 1Q5LA 3N8EA 4WV7A 4EZRA 4H6IA 4PO2A 3C7NB 3DQGA 3L3OM 3H0XA 2OP6A 4EZUA 3DOBA 1DG4A 2QXLA 3T48A 4JWDA 4JN4A 4JNEA 1DKYA 4EZPA 4JWIA
chains in the Genus database with same CATH superfamily
3O3MB 3VEAA 3T46A 2JNSA 4B9QA 4E81A 4NQIA 2Z0OA 2YL8A 1U00A 4FL9A 2LM0A 2YI9A 3DPQA 2Z0NA 1E1DA 4AZIA 2Z8YA 3GI7A 3EJQA 3C7NA 1I49A 1O7DB 4WPCA 2QFFA 2ZXQA 3DX0A 1DKZA 3BVVA 2OBMA 3Q84A 1QWUA 2V7YA 4KIKA 4EZYA 2FYVA 3RV0A 3C7NB 1HWWA 3DQGA 3L3OM 2OW6A 4FZOA 3BVTA 3EJSA 2RAIA 4EZOA 3T49A 3DX3A 3KAVA 2C08A 2Q13A 2YLAA 4G6QA 3EJRA 4I1QA 3QA8A 1CKRA 4IM3A 4UDXX 4JWEA 4FZSA 1X03A 2YI8A 2YIAA 3T48A 1URUA 4JWIA 4AZ7A 3CZSA 3LVTA 4AZ5A 2X3WA 4WPEA 4I43A 3QNIA 4AKVA 2MI7A 3ER8C 5C5BA 4JLCA 3EJPA 2KHOA 2ELBA 4EZWA 2X5CA 2D1LA 3SYVA 4E3CA 3D51A 4EZSA 4WV7A 3KAWA 4PO2A 3I04A 2GA9D 3OK8A 1HXKA 2OZNB 2JNKA 3D50A 1UPXA 1TQTA 2WYHA 3EJTA 2YL9A 4R5GA 1QWNA 2F7QA 1OA0A 1X04A 4D8JA 3Q0KA 3PLTA 4AZ6A 2F18A 3SOGA 4NPHA 4ILGA 2GF4A 3BUPA 3I39X 3QWEA 2Z0VA 3DYTA 4IM0A 3D4YA 4JN4A 3OWGA 1TQUA 2YL5A 2F7PA 2BPRA 1GN9A 4FZPA 4JL9A 3B53X 3D52A 3UITA 4EZRA 1HTYA 3O3NB 2NCZA 2N3KA 4R5JA 3VKHA 1I4TA 3B52X 4JNFA 3D2FA 2YKTA 2Q12A 4KIKB 3DX2A 2ND1A 3B51X 2EWFA 3T47A 1OA1A 3CVRA 3N8EA 3I01A 1E2UA 2FICA 3BUBA 2X3VA 3QE6A 3BVXA 2RT6A 3LLLA 4H8SA 2V0OA 4IWPA 2ND0A 1DKXA 3T4AG 2ALWA 2F1BA 2PY6A 3F7WA 2D4CA 3O3OB 4IW0A 3SBTB 3RPMA 4IWOA 3DPOA 3CZNA 2RAKA 3BUQA 1YWMA 4AZHA 4HR1A 3M3WA 4EZPA 1R5EA 5C5BB 1TQVA 2YL6A 4EZTA 3ZEDA 4WV5A 1SU7A 1E9VA 1SU6A 3CKDA 3DX4A 1SU8A 1SUFA 3ACOA 4IWQA 2OO2A 3DOBA 1DG4A 2F7RA 2QXLA 1R33A 3DX1A 4IM2A 2EFKA 4AZBA 5TKYA 4HY9A 2EX3B 1I4LA 3ZEFA 4EZVA 3BLBA 4UDYX 2LXYA 2GAFD 2RAJA 3HAIA 4AZCA 5FLEX 1R34A 1Q5LA 4ATMA 4EZUA 4MQDA 1PS3A 3OHXM 4AVMA 1QX1A 1TQSA 4AZCB 4ILHB 5KBPA 2OBLA 4R5KA 3L3PA 2WINM 4DYLA 1YUWA 3FD9A 4ILIA 4H6IA 3ER9B 3CAZA 1TQWA 4JWDA 1ZYLA 1W9MA 2OW7A 3ERCC 1WDZA 1ZWWA 2F7OA 4DCNC 1Y2OA 3EJUA 1OAOA 3BUIA 4F01A 3DPPA 3SBSA 3HAHA 3LMFA 4AZGA 3I2WA 4JNEA 2QKWA 2PMRA 4R5LA 2WYIA 4EZNA 2F1AA 3ABHA 2YLLA 4F00A 4M0MA 2YIBA 1JQKA 3A98A 3H0XA 3BVUA 3CV5A 3DDFA 4HYBA 3RV1A 4H6HA 3VEBA 5E84A 3D2EA 3D4ZA 3HAJA 2O0I1 1MJGA 1LQ7A 4EZQA 3QNJA 4HR1B 1O7DC 4JWCA 2YIVX 2OP6A 4NSWA 5FIGA 3BVWA 4R5IA 4FM3A 7HSCA 4EZZA 3KDRA 4EZXA 1GNTA 3G9GA 2EFLA 4BNEA 3DDGA 1BPRA 3BUDA 2X3XA 1I4DA 1GNLA 1DKYA
chains in the Genus database with same CATH topology
1UPXA 3O3MB 3VEAA 3T46A 3ERCC 2JNSA 4IWPA 4B9QA 4E81A 2ND0A 1DKXA 3T4AG 2PY6A 3F7WA 1U00A 3O3OB 4IW0A 3SBTB 4FL9A 2LM0A 4IWOA 3DPOA 2YI9A 4R5GA 3DPQA 1OAOA 4F01A 3DPPA 1E1DA 3SBSA 3LMFA 2Z8YA 1OA0A 4HR1A 4D8JA 3GI7A 4JNEA 4EZPA 3C7NA 4R5LA 4EZTA 3ZEDA 4EZNA 4NPHA 4WV5A 4ILGA 1SU7A 2QFFA 1DKZA 1E9VA 1SU6A 2OBMA 1SU8A 2V7YA 4KIKA 1SUFA 4EZYA 4F00A 4M0MA 3I39X 4IWQA 2YIBA 1JQKA 4IM0A 3RV0A 3C7NB 3A98A 3DQGA 3L3OM 3H0XA 3DOBA 1DG4A 2QXLA 4JN4A 3OWGA 4IM2A 4EZOA 5TKYA 4HYBA 3RV1A 3T49A 3KAVA 4HY9A 2EX3B 4H6HA 3VEBA 2BPRA 1GN9A 5E84A 3D2EA 4JL9A 3ZEFA 4EZVA 3B53X 3UITA 4G6QA 1MJGA 3QA8A 4UDYX 1CKRA 4IM3A 4UDXX 4EZQA 2GAFD 3QNJA 4HR1B 4JWEA 4JWCA 5FLEX 1Q5LA 2YIVX 4EZRA 2OP6A 4EZUA 2YI8A 5FIGA 2YIAA 4MQDA 3T48A 3O3NB 4R5IA 2NCZA 4FM3A 4JWIA 2N3KA 4R5JA 7HSCA 3VKHA 3OHXM 4EZZA 3KDRA 4I43A 4EZXA 1GNTA 3B52X 4JNFA 3D2FA 3ER8C 4KIKB 4ILHB 2ND1A 4JLCA 3B51X 2KHOA 4EZWA 2EWFA 2X5CA 2OBLA 4R5KA 3T47A 1BPRA 1OA1A 2WINM 4E3CA 1YUWA 4EZSA 3N8EA 3I01A 4WV7A 1E2UA 3KAWA 3FD9A 4ILIA 4H6IA 3I04A 4PO2A 3ER9B 2GA9D 1GNLA 2RT6A 4JWDA 1DKYA 1ZYLA 1W9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5J A;  7HSC A;  3T46 A;  3C7N A;  3OHX M;  4R5L A;  5TKY A;  4B9Q A;  4HYB A;  4R5I A;  3T49 A;  4E81 A;  4EZT A;  4EZZ A;  4EZO A;  4EZN A;  4EZX A;  4JNF A;  4WV5 A;  4HY9 A;  3D2F A;  4H6H A;  2BPR A;  2QFF A;  5E84 A;  3D2E A;  1DKZ A;  4EZV A;  1DKX A;  3T4A G;  1CKR A;  2KHO A;  1U00 A;  4EZW A;  4FL9 A;  2V7Y A;  4R5K A;  3T47 A;  3DPO A;  4EZQ A;  3QNJ A;  4R5G A;  3DPQ A;  1BPR A;  4JWE A;  2WIN M;  4EZY A;  4F00 A;  1YUW A;  4JWC A;  4EZS A;  4F01 A;  3DPP A;  1Q5L A;  3N8E A;  4WV7 A;  4EZR A;  4H6I A;  4PO2 A;  3C7N B;  3DQG A;  3L3O M;  3H0X A;  2OP6 A;  4EZU A;  3DOB A;  1DG4 A;  2QXL A;  3T48 A;  4JWD A;  4JN4 A;  4JNE A;  1DKY A;  4EZP A;  4JWI A; 
#chains in the Genus database with same CATH topology
 3O3M B;  3VEA A;  3T46 A;  2JNS A;  4B9Q A;  4E81 A;  4NQI A;  2Z0O A;  2YL8 A;  1U00 A;  4FL9 A;  2LM0 A;  2YI9 A;  3DPQ A;  2Z0N A;  1E1D A;  4AZI A;  2Z8Y A;  3GI7 A;  3EJQ A;  3C7N A;  1I49 A;  1O7D B;  4WPC A;  2QFF A;  2ZXQ A;  3DX0 A;  1DKZ A;  3BVV A;  2OBM A;  3Q84 A;  1QWU A;  2V7Y A;  4KIK A;  4EZY A;  2FYV A;  3RV0 A;  3C7N B;  1HWW A;  3DQG A;  3L3O M;  2OW6 A;  4FZO A;  3BVT A;  3EJS A;  2RAI A;  4EZO A;  3T49 A;  3DX3 A;  3KAV A;  2C08 A;  2Q13 A;  2YLA A;  4G6Q A;  3EJR A;  4I1Q A;  3QA8 A;  1CKR A;  4IM3 A;  4UDX X;  4JWE A;  4FZS A;  1X03 A;  2YI8 A;  2YIA A;  3T48 A;  1URU A;  4JWI A;  4AZ7 A;  3CZS A;  3LVT A;  4AZ5 A;  2X3W A;  4WPE A;  4I43 A;  3QNI A;  4AKV A;  2MI7 A;  3ER8 C;  5C5B A;  4JLC A;  3EJP A;  2KHO A;  2ELB A;  4EZW A;  2X5C A;  2D1L A;  3SYV A;  4E3C A;  3D51 A;  4EZS A;  4WV7 A;  3KAW A;  4PO2 A;  3I04 A;  2GA9 D;  3OK8 A;  1HXK A;  2OZN B;  2JNK A;  3D50 A;  1UPX A;  1TQT A;  2WYH A;  3EJT A;  2YL9 A;  4R5G A;  1QWN A;  2F7Q A;  1OA0 A;  1X04 A;  4D8J A;  3Q0K A;  3PLT A;  4AZ6 A;  2F18 A;  3SOG A;  4NPH A;  4ILG A;  2GF4 A;  3BUP A;  3I39 X;  3QWE A;  2Z0V A;  3DYT A;  4IM0 A;  3D4Y A;  4JN4 A;  3OWG A;  1TQU A;  2YL5 A;  2F7P A;  2BPR A;  1GN9 A;  4FZP A;  4JL9 A;  3B53 X;  3D52 A;  3UIT A;  4EZR A;  1HTY A;  3O3N B;  2NCZ A;  2N3K A;  4R5J A;  3VKH A;  1I4T A;  3B52 X;  4JNF A;  3D2F A;  2YKT A;  2Q12 A;  4KIK B;  3DX2 A;  2ND1 A;  3B51 X;  2EWF A;  3T47 A;  1OA1 A;  3CVR A;  3N8E A;  3I01 A;  1E2U A;  2FIC A;  3BUB A;  2X3V A;  3QE6 A;  3BVX A;  2RT6 A;  3LLL A;  4H8S A;  2V0O A;  4IWP A;  2ND0 A;  1DKX A;  3T4A G;  2ALW A;  2F1B A;  2PY6 A;  3F7W A;  2D4C A;  3O3O B;  4IW0 A;  3SBT B;  3RPM A;  4IWO A;  3DPO A;  3CZN A;  2RAK A;  3BUQ A;  1YWM A;  4AZH A;  4HR1 A;  3M3W A;  4EZP A;  1R5E A;  5C5B B;  1TQV A;  2YL6 A;  4EZT A;  3ZED A;  4WV5 A;  1SU7 A;  1E9V A;  1SU6 A;  3CKD A;  3DX4 A;  1SU8 A;  1SUF A;  3ACO A;  4IWQ A;  2OO2 A;  3DOB A;  1DG4 A;  2F7R A;  2QXL A;  1R33 A;  3DX1 A;  4IM2 A;  2EFK A;  4AZB A;  5TKY A;  4HY9 A;  2EX3 B;  1I4L A;  3ZEF A;  4EZV A;  3BLB A;  4UDY X;  2LXY A;  2GAF D;  2RAJ A;  3HAI A;  4AZC A;  5FLE X;  1R34 A;  1Q5L A;  4ATM A;  4EZU A;  4MQD A;  1PS3 A;  3OHX M;  4AVM A;  1QX1 A;  1TQS A;  4AZC B;  4ILH B;  5KBP A;  2OBL A;  4R5K A;  3L3P A;  2WIN M;  4DYL A;  1YUW A;  3FD9 A;  4ILI A;  4H6I A;  3ER9 B;  3CAZ A;  1TQW A;  4JWD A;  1ZYL A;  1W9M A;  2OW7 A;  3ERC C;  1WDZ A;  1ZWW A;  2F7O A;  4DCN C;  1Y2O A;  3EJU A;  1OAO A;  3BUI A;  4F01 A;  3DPP A;  3SBS A;  3HAH A;  3LMF A;  4AZG A;  3I2W A;  4JNE A;  2QKW A;  2PMR A;  4R5L A;  2WYI A;  4EZN A;  2F1A A;  3ABH A;  2YLL A;  4F00 A;  4M0M A;  2YIB A;  1JQK A;  3A98 A;  3H0X A;  3BVU A;  3CV5 A;  3DDF A;  4HYB A;  3RV1 A;  4H6H A;  3VEB A;  5E84 A;  3D2E A;  3D4Z A;  3HAJ A;  2O0I 1;  1MJG A;  1LQ7 A;  4EZQ A;  3QNJ A;  4HR1 B;  1O7D C;  4JWC A;  2YIV X;  2OP6 A;  4NSW A;  5FIG A;  3BVW A;  4R5I A;  4FM3 A;  7HSC A;  4EZZ A;  3KDR A;  4EZX A;  1GNT A;  3G9G A;  2EFL A;  4BNE A;  3DDG A;  1BPR A;  3BUD A;  2X3X A;  1I4D A;  1GNL A;  1DKY A; 
#chains in the Genus database with same CATH homology
 1UPX A;  3O3M B;  3VEA A;  3T46 A;  3ERC C;  2JNS A;  4IWP A;  4B9Q A;  4E81 A;  2ND0 A;  1DKX A;  3T4A G;  2PY6 A;  3F7W A;  1U00 A;  3O3O B;  4IW0 A;  3SBT B;  4FL9 A;  2LM0 A;  4IWO A;  3DPO A;  2YI9 A;  4R5G A;  3DPQ A;  1OAO A;  4F01 A;  3DPP A;  1E1D A;  3SBS A;  3LMF A;  2Z8Y A;  1OA0 A;  4HR1 A;  4D8J A;  3GI7 A;  4JNE A;  4EZP A;  3C7N A;  4R5L A;  4EZT A;  3ZED A;  4EZN A;  4NPH A;  4WV5 A;  4ILG A;  1SU7 A;  2QFF A;  1DKZ A;  1E9V A;  1SU6 A;  2OBM A;  1SU8 A;  2V7Y A;  4KIK A;  1SUF A;  4EZY A;  4F00 A;  4M0M A;  3I39 X;  4IWQ A;  2YIB A;  1JQK A;  4IM0 A;  3RV0 A;  3C7N B;  3A98 A;  3DQG A;  3L3O M;  3H0X A;  3DOB A;  1DG4 A;  2QXL A;  4JN4 A;  3OWG A;  4IM2 A;  4EZO A;  5TKY A;  4HYB A;  3RV1 A;  3T49 A;  3KAV A;  4HY9 A;  2EX3 B;  4H6H A;  3VEB A;  2BPR A;  1GN9 A;  5E84 A;  3D2E A;  4JL9 A;  3ZEF A;  4EZV A;  3B53 X;  3UIT A;  4G6Q A;  1MJG A;  3QA8 A;  4UDY X;  1CKR A;  4IM3 A;  4UDX X;  4EZQ A;  2GAF D;  3QNJ A;  4HR1 B;  4JWE A;  4JWC A;  5FLE X;  1Q5L A;  2YIV X;  4EZR A;  2OP6 A;  4EZU A;  2YI8 A;  5FIG A;  2YIA A;  4MQD A;  3T48 A;  3O3N B;  4R5I A;  2NCZ A;  4FM3 A;  4JWI A;  2N3K A;  4R5J A;  7HSC A;  3VKH A;  3OHX M;  4EZZ A;  3KDR A;  4I43 A;  4EZX A;  1GNT A;  3B52 X;  4JNF A;  3D2F A;  3ER8 C;  4KIK B;  4ILH B;  2ND1 A;  4JLC A;  3B51 X;  2KHO A;  4EZW A;  2EWF A;  2X5C A;  2OBL A;  4R5K A;  3T47 A;  1BPR A;  1OA1 A;  2WIN M;  4E3C A;  1YUW A;  4EZS A;  3N8E A;  3I01 A;  4WV7 A;  1E2U A;  3KAW A;  3FD9 A;  4ILI A;  4H6I A;  3I04 A;  4PO2 A;  3ER9 B;  2GA9 D;  1GNL A;  2RT6 A;  4JWD A;  1DKY A;  1ZYL A;  1W9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...