4EZXA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrlmltg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
212
structure length
212
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 64
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezxA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezxA01
4R5LA 4H6HA 1U00A 4EZWA 3T4AG 4JWEA 4HYBA 4E81A 4F00A 4JNFA 4EZSA 4WV7A 4R5JA 4F01A 4JWIA 3C7NB 4EZRA 2V7YA 4EZTA 4EZOA 3H0XA 2OP6A 2QXLA 4B9QA 3DPOA 4JWDA 4EZQA 1DKYA 3C7NA 3DPQA 4EZUA 3T47A 4FL9A 4PO2A 3QNJA 4R5IA 3T48A 1Q5LA 3D2EA 3DOBA 4EZNA 1DKXA 3N8EA 3DQGA 3L3OM 4H6IA 4JNEA 4EZYA 4EZXA 7HSCA 5TKYA 5E84A 4EZVA 4EZZA 1DKZA 2QFFA 3T46A 1YUWA 4JN4A 1BPRA 4JWCA 4HY9A 3DPPA 3OHXM 4R5KA 4EZPA 2BPRA 4R5GA 1CKRA 1DG4A 2WINM 2KHOA 4WV5A 3T49A 3D2FA
chains in the Genus database with same CATH superfamily
2RAJA 4R5LA 4FZSA 3BVXA 2OBLA 2V7YA 4EZTA 2OP6A 1JQKA 3CAZA 3C7NA 3QE6A 3ERCC 2C08A 3B52X 3SOGA 4EZXA 4D8JA 1TQUA 1DKZA 2YIAA 3D4YA 1I49A 3DDFA 3KDRA 4JWEA 1I4TA 2YL8A 1TQTA 1Q5LA 3L3PA 1TQSA 4DYLA 1HTYA 2PMRA 2RAKA 2MI7A 1ZWWA 3B53X 3DPOA 1PS3A 1Y2OA 1QWNA 1DKXA 3DQGA 5C5BA 2EFKA 3QA8A 2JNSA 4JWCA 4R5GA 2F1AA 2OW7A 3RPMA 4E81A 1GN9A 3ACOA 1URUA 2D1LA 4WPEA 2YLAA 3BVWA 4HR1B 4AZCA 4E3CA 2Z0OA 1UPXA 3O3OB 2YIVX 3I04A 1DG4A 4NQIA 3ER9B 4AZ7A 2O0I1 3FD9A 4I1QA 4WV7A 4F01A 4I43A 4JWDA 3HAHA 4IM2A 1O7DC 4ILHB 4FZOA 2EFLA 4H8SA 3N8EA 1X04A 3BUIA 3OK8A 4EZPA 4JL9A 2YIBA 1HXKA 3BVTA 2ND0A 4EZWA 2FICA 3VEAA 3DX2A 4FZPA 2YI8A 4NSWA 2NCZA 2Z0NA 4KIKA 1R33A 3DOBA 2Z8YA 4H6IA 7HSCA 3EJPA 3BUDA 1SU6A 2YKTA 3DDGA 2WYHA 3D2FA 4AZBA 2F7QA 3B51X 3BVVA 2N3KA 5FIGA 2EX3B 4JLCA 1I4LA 4PO2A 1O7DB 3T48A 3LMFA 3O3MB 1OA0A 3EJQA 3EJTA 1SU8A 2ND1A 4EZZA 3QNIA 2GA9D 4ILGA 2KHOA 3D51A 2FYVA 2RAIA 3C7NB 1X03A 3H0XA 2X3VA 2OZNB 2ALWA 4EZNA 4IWQA 1GNLA 3I01A 3EJSA 3D52A 3EJUA 4AZIA 3SYVA 1OAOA 1U00A 4ATMA 2X3WA 3ZEFA 3HAIA 4EZSA 4MQDA 2F1BA 3CKDA 1E9VA 4AZ6A 4R5IA 3HAJA 4EZVA 2ELBA 2EWFA 4AZHA 1BPRA 3BLBA 3LLLA 4NPHA 4UDYX 4IM3A 4M0MA 2YL9A 1E2UA 4EZRA 3I39X 2F7OA 3DPQA 3Q0KA 5C5BB 3ABHA 5TKYA 1W9MA 2F18A 4ILIA 3KAVA 4DCNC 2X3XA 2BPRA 1QWUA 1CKRA 2YL6A 2ZXQA 3ER8C 3D4ZA 3RV0A 4AKVA 4IW0A 1R5EA 2QXLA 4AZCB 3UITA 4EZUA 2Z0VA 3CVRA 3KAWA 3VKHA 2LXYA 2QFFA 2WYIA 1MJGA 5FLEX 4R5KA 2YI9A 3EJRA 3VEBA 1QX1A 4H6HA 3DX3A 1TQWA 2GF4A 4AZ5A 3M3WA 4R5JA 4B9QA 3A98A 4EZYA 3BUQA 1ZYLA 3BVUA 3BUPA 3T46A 2YL5A 3OHXM 2D4CA 2YLLA 2RT6A 4BNEA 3DYTA 4UDXX 1HWWA 1WDZA 3GI7A 3DX1A 2LM0A 1R34A 4KIKB 4EZQA 1DKYA 3LVTA 3QNJA 2PY6A 4HR1A 3RV1A 4JN4A 3T49A 3Q84A 1I4DA 3DX0A 3T4AG 3ZEDA 4IWOA 3F7WA 4IWPA 4AZGA 3DX4A 3PLTA 3BUBA 2F7RA 2V0OA 5E84A 1YUWA 3CZSA 1GNTA 2QKWA 2OBMA 2WINM 3CV5A 3G9GA 3I2WA 1LQ7A 2OO2A 4JNFA 2F7PA 4EZOA 1E1DA 3OWGA 4FL9A 2Q13A 4AVMA 3D50A 1SUFA 3L3OM 2OW6A 3CZNA 2GAFD 2JNKA 4WV5A 1YWMA 4F00A 4HYBA 3SBTB 2Q12A 1SU7A 4IM0A 4G6QA 4JWIA 3QWEA 3SBSA 4FM3A 1OA1A 3O3NB 3D2EA 5KBPA 4JNEA 1TQVA 2X5CA 4WPCA 4HY9A 3DPPA 3T47A
chains in the Genus database with same CATH topology
4R5LA 1OAOA 1U00A 4UDXX 3ZEFA 3FD9A 4EZSA 4MQDA 4WV7A 3GI7A 4F01A 2OBLA 2V7YA 2LM0A 4EZTA 2OP6A 1JQKA 4KIKB 4I43A 4JWDA 1E9VA 4EZQA 1DKYA 3C7NA 4IM2A 4ILHB 3QNJA 2PY6A 4R5IA 3ERCC 3N8EA 3B52X 4EZXA 4D8JA 4HR1A 3RV1A 4EZVA 1DKZA 4JN4A 2EWFA 1BPRA 2YIAA 4EZPA 4JL9A 2YIBA 3T49A 4NPHA 4UDYX 2ND0A 3KDRA 4EZWA 3T4AG 4JWEA 4IWOA 3ZEDA 4IM3A 4M0MA 3VEAA 1E2UA 3F7WA 4EZRA 3I39X 4IWPA 2YI8A 3DPQA 2NCZA 4KIKA 1Q5LA 3DOBA 2Z8YA 4H6IA 7HSCA 5TKYA 5E84A 1W9MA 1YUWA 4ILIA 3KAVA 1SU6A 1GNTA 2OBMA 2BPRA 1CKRA 2WINM 3D2FA 3B51X 3ER8C 4JNFA 3RV0A 2N3KA 5FIGA 4IW0A 4EZOA 2EX3B 3B53X 1E1DA 2QXLA 3DPOA 3OWGA 4JLCA 3UITA 4EZUA 4FL9A 4PO2A 3T48A 3LMFA 3KAWA 1DKXA 3O3MB 1OA0A 3VKHA 1SUFA 3DQGA 3L3OM 1SU8A 3QA8A 2ND1A 2QFFA 4EZZA 2JNSA 2GA9D 1MJGA 4JWCA 5FLEX 4R5KA 2YI9A 4R5GA 2GAFD 4ILGA 2KHOA 4WV5A 3VEBA 4H6HA 4F00A 4E81A 4HYBA 3SBTB 1GN9A 1SU7A 4IM0A 4G6QA 4R5JA 4JWIA 3C7NB 3H0XA 4B9QA 3SBSA 4FM3A 3A98A 4HR1B 1OA1A 3O3NB 3D2EA 4E3CA 4EZNA 4JNEA 4EZYA 1ZYLA 4IWQA 1UPXA 3T46A 1GNLA 3O3OB 2YIVX 2X5CA 4HY9A 3DPPA 3OHXM 3I01A 3I04A 1DG4A 3ER9B 2RT6A 3T47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5L A;  4H6H A;  1U00 A;  4EZW A;  3T4A G;  4JWE A;  4HYB A;  4E81 A;  4F00 A;  4JNF A;  4EZS A;  4WV7 A;  4R5J A;  4F01 A;  4JWI A;  3C7N B;  4EZR A;  2V7Y A;  4EZT A;  4EZO A;  3H0X A;  2OP6 A;  2QXL A;  4B9Q A;  3DPO A;  4JWD A;  4EZQ A;  1DKY A;  3C7N A;  3DPQ A;  4EZU A;  3T47 A;  4FL9 A;  4PO2 A;  3QNJ A;  4R5I A;  3T48 A;  1Q5L A;  3D2E A;  3DOB A;  4EZN A;  1DKX A;  3N8E A;  3DQG A;  3L3O M;  4H6I A;  4JNE A;  4EZY A;  4EZX A;  7HSC A;  5TKY A;  5E84 A;  4EZV A;  4EZZ A;  1DKZ A;  2QFF A;  3T46 A;  1YUW A;  4JN4 A;  1BPR A;  4JWC A;  4HY9 A;  3DPP A;  3OHX M;  4R5K A;  4EZP A;  2BPR A;  4R5G A;  1CKR A;  1DG4 A;  2WIN M;  2KHO A;  4WV5 A;  3T49 A;  3D2F A; 
#chains in the Genus database with same CATH topology
 2RAJ A;  4R5L A;  4FZS A;  3BVX A;  2OBL A;  2V7Y A;  4EZT A;  2OP6 A;  1JQK A;  3CAZ A;  3C7N A;  3QE6 A;  3ERC C;  2C08 A;  3B52 X;  3SOG A;  4EZX A;  4D8J A;  1TQU A;  1DKZ A;  2YIA A;  3D4Y A;  1I49 A;  3DDF A;  3KDR A;  4JWE A;  1I4T A;  2YL8 A;  1TQT A;  1Q5L A;  3L3P A;  1TQS A;  4DYL A;  1HTY A;  2PMR A;  2RAK A;  2MI7 A;  1ZWW A;  3B53 X;  3DPO A;  1PS3 A;  1Y2O A;  1QWN A;  1DKX A;  3DQG A;  5C5B A;  2EFK A;  3QA8 A;  2JNS A;  4JWC A;  4R5G A;  2F1A A;  2OW7 A;  3RPM A;  4E81 A;  1GN9 A;  3ACO A;  1URU A;  2D1L A;  4WPE A;  2YLA A;  3BVW A;  4HR1 B;  4AZC A;  4E3C A;  2Z0O A;  1UPX A;  3O3O B;  2YIV X;  3I04 A;  1DG4 A;  4NQI A;  3ER9 B;  4AZ7 A;  2O0I 1;  3FD9 A;  4I1Q A;  4WV7 A;  4F01 A;  4I43 A;  4JWD A;  3HAH A;  4IM2 A;  1O7D C;  4ILH B;  4FZO A;  2EFL A;  4H8S A;  3N8E A;  1X04 A;  3BUI A;  3OK8 A;  4EZP A;  4JL9 A;  2YIB A;  1HXK A;  3BVT A;  2ND0 A;  4EZW A;  2FIC A;  3VEA A;  3DX2 A;  4FZP A;  2YI8 A;  4NSW A;  2NCZ A;  2Z0N A;  4KIK A;  1R33 A;  3DOB A;  2Z8Y A;  4H6I A;  7HSC A;  3EJP A;  3BUD A;  1SU6 A;  2YKT A;  3DDG A;  2WYH A;  3D2F A;  4AZB A;  2F7Q A;  3B51 X;  3BVV A;  2N3K A;  5FIG A;  2EX3 B;  4JLC A;  1I4L A;  4PO2 A;  1O7D B;  3T48 A;  3LMF A;  3O3M B;  1OA0 A;  3EJQ A;  3EJT A;  1SU8 A;  2ND1 A;  4EZZ A;  3QNI A;  2GA9 D;  4ILG A;  2KHO A;  3D51 A;  2FYV A;  2RAI A;  3C7N B;  1X03 A;  3H0X A;  2X3V A;  2OZN B;  2ALW A;  4EZN A;  4IWQ A;  1GNL A;  3I01 A;  3EJS A;  3D52 A;  3EJU A;  4AZI A;  3SYV A;  1OAO A;  1U00 A;  4ATM A;  2X3W A;  3ZEF A;  3HAI A;  4EZS A;  4MQD A;  2F1B A;  3CKD A;  1E9V A;  4AZ6 A;  4R5I A;  3HAJ A;  4EZV A;  2ELB A;  2EWF A;  4AZH A;  1BPR A;  3BLB A;  3LLL A;  4NPH A;  4UDY X;  4IM3 A;  4M0M A;  2YL9 A;  1E2U A;  4EZR A;  3I39 X;  2F7O A;  3DPQ A;  3Q0K A;  5C5B B;  3ABH A;  5TKY A;  1W9M A;  2F18 A;  4ILI A;  3KAV A;  4DCN C;  2X3X A;  2BPR A;  1QWU A;  1CKR A;  2YL6 A;  2ZXQ A;  3ER8 C;  3D4Z A;  3RV0 A;  4AKV A;  4IW0 A;  1R5E A;  2QXL A;  4AZC B;  3UIT A;  4EZU A;  2Z0V A;  3CVR A;  3KAW A;  3VKH A;  2LXY A;  2QFF A;  2WYI A;  1MJG A;  5FLE X;  4R5K A;  2YI9 A;  3EJR A;  3VEB A;  1QX1 A;  4H6H A;  3DX3 A;  1TQW A;  2GF4 A;  4AZ5 A;  3M3W A;  4R5J A;  4B9Q A;  3A98 A;  4EZY A;  3BUQ A;  1ZYL A;  3BVU A;  3BUP A;  3T46 A;  2YL5 A;  3OHX M;  2D4C A;  2YLL A;  2RT6 A;  4BNE A;  3DYT A;  4UDX X;  1HWW A;  1WDZ A;  3GI7 A;  3DX1 A;  2LM0 A;  1R34 A;  4KIK B;  4EZQ A;  1DKY A;  3LVT A;  3QNJ A;  2PY6 A;  4HR1 A;  3RV1 A;  4JN4 A;  3T49 A;  3Q84 A;  1I4D A;  3DX0 A;  3T4A G;  3ZED A;  4IWO A;  3F7W A;  4IWP A;  4AZG A;  3DX4 A;  3PLT A;  3BUB A;  2F7R A;  2V0O A;  5E84 A;  1YUW A;  3CZS A;  1GNT A;  2QKW A;  2OBM A;  2WIN M;  3CV5 A;  3G9G A;  3I2W A;  1LQ7 A;  2OO2 A;  4JNF A;  2F7P A;  4EZO A;  1E1D A;  3OWG A;  4FL9 A;  2Q13 A;  4AVM A;  3D50 A;  1SUF A;  3L3O M;  2OW6 A;  3CZN A;  2GAF D;  2JNK A;  4WV5 A;  1YWM A;  4F00 A;  4HYB A;  3SBT B;  2Q12 A;  1SU7 A;  4IM0 A;  4G6Q A;  4JWI A;  3QWE A;  3SBS A;  4FM3 A;  1OA1 A;  3O3N B;  3D2E A;  5KBP A;  4JNE A;  1TQV A;  2X5C A;  4WPC A;  4HY9 A;  3DPP A;  3T47 A; 
#chains in the Genus database with same CATH homology
 4R5L A;  1OAO A;  1U00 A;  4UDX X;  3ZEF A;  3FD9 A;  4EZS A;  4MQD A;  4WV7 A;  3GI7 A;  4F01 A;  2OBL A;  2V7Y A;  2LM0 A;  4EZT A;  2OP6 A;  1JQK A;  4KIK B;  4I43 A;  4JWD A;  1E9V A;  4EZQ A;  1DKY A;  3C7N A;  4IM2 A;  4ILH B;  3QNJ A;  2PY6 A;  4R5I A;  3ERC C;  3N8E A;  3B52 X;  4EZX A;  4D8J A;  4HR1 A;  3RV1 A;  4EZV A;  1DKZ A;  4JN4 A;  2EWF A;  1BPR A;  2YIA A;  4EZP A;  4JL9 A;  2YIB A;  3T49 A;  4NPH A;  4UDY X;  2ND0 A;  3KDR A;  4EZW A;  3T4A G;  4JWE A;  4IWO A;  3ZED A;  4IM3 A;  4M0M A;  3VEA A;  1E2U A;  3F7W A;  4EZR A;  3I39 X;  4IWP A;  2YI8 A;  3DPQ A;  2NCZ A;  4KIK A;  1Q5L A;  3DOB A;  2Z8Y A;  4H6I A;  7HSC A;  5TKY A;  5E84 A;  1W9M A;  1YUW A;  4ILI A;  3KAV A;  1SU6 A;  1GNT A;  2OBM A;  2BPR A;  1CKR A;  2WIN M;  3D2F A;  3B51 X;  3ER8 C;  4JNF A;  3RV0 A;  2N3K A;  5FIG A;  4IW0 A;  4EZO A;  2EX3 B;  3B53 X;  1E1D A;  2QXL A;  3DPO A;  3OWG A;  4JLC A;  3UIT A;  4EZU A;  4FL9 A;  4PO2 A;  3T48 A;  3LMF A;  3KAW A;  1DKX A;  3O3M B;  1OA0 A;  3VKH A;  1SUF A;  3DQG A;  3L3O M;  1SU8 A;  3QA8 A;  2ND1 A;  2QFF A;  4EZZ A;  2JNS A;  2GA9 D;  1MJG A;  4JWC A;  5FLE X;  4R5K A;  2YI9 A;  4R5G A;  2GAF D;  4ILG A;  2KHO A;  4WV5 A;  3VEB A;  4H6H A;  4F00 A;  4E81 A;  4HYB A;  3SBT B;  1GN9 A;  1SU7 A;  4IM0 A;  4G6Q A;  4R5J A;  4JWI A;  3C7N B;  3H0X A;  4B9Q A;  3SBS A;  4FM3 A;  3A98 A;  4HR1 B;  1OA1 A;  3O3N B;  3D2E A;  4E3C A;  4EZN A;  4JNE A;  4EZY A;  1ZYL A;  4IWQ A;  1UPX A;  3T46 A;  1GNL A;  3O3O B;  2YIV X;  2X5C A;  4HY9 A;  3DPP A;  3OHX M;  3I01 A;  3I04 A;  1DG4 A;  3ER9 B;  2RT6 A;  3T47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...