4EZXA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrlmltg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
212
structure length
212
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 64
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezxA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezxA01
4WV7A 4EZWA 4H6HA 3T49A 4EZTA 4JNFA 4EZQA 1DG4A 3L3OM 5TKYA 4F01A 3T4AG 2KHOA 3C7NA 4JN4A 4FL9A 1DKZA 3T48A 3H0XA 4EZNA 4JWIA 4EZZA 3DPQA 4R5KA 4EZXA 4PO2A 5E84A 2V7YA 4JWCA 3T47A 4B9QA 3DPOA 4EZRA 4EZUA 1U00A 4EZPA 2WINM 1BPRA 1CKRA 4JWDA 4R5JA 3DOBA 4HY9A 4EZVA 4E81A 4EZYA 1Q5LA 2OP6A 2QFFA 3D2FA 2QXLA 4R5GA 3T46A 4R5LA 3N8EA 3DPPA 3DQGA 4WV5A 1DKYA 1DKXA 4EZOA 2BPRA 3QNJA 4F00A 4JWEA 3D2EA 3OHXM 4HYBA 3C7NB 1YUWA 7HSCA 4EZSA 4H6IA 4R5IA 4JNEA
chains in the Genus database with same CATH superfamily
3L3OM 3QE6A 3H0XA 1UPXA 4R5KA 4ATMA 3KAWA 2Z8YA 4M0MA 4AZCA 3O3NB 3QNJA 1I4LA 1LQ7A 3LLLA 4R5IA 4IWOA 1WDZA 2YIBA 3L3PA 2RT6A 4JWCA 2GA9D 1SU7A 1CKRA 1X04A 2F7OA 2JNKA 2EFLA 4AVMA 1JQKA 1SUFA 4ILHB 3I2WA 3SBSA 3O3OB 3T47A 4EZWA 4JNFA 2F7PA 3ZEDA 3BUPA 3VEAA 2OBMA 3G9GA 3GI7A 4EZVA 4NQIA 4ILIA 2Z0OA 3N8EA 2WYHA 4EZOA 4IM2A 1W9MA 3T4AG 4JN4A 1TQUA 1GNTA 3DDGA 3I39X 1O7DB 3EJTA 2ZXQA 4R5LA 1TQWA 2OW6A 2ND1A 2PMRA 3B53X 3D2EA 3HAJA 3BVTA 7HSCA 4E3CA 1SU6A 1URUA 2ND0A 3ER8C 3LVTA 4JWIA 1OA0A 3I01A 4IM0A 2EWFA 2JNSA 4WPCA 3QNIA 2YIAA 4JL9A 3ACOA 4FZOA 2Z0NA 1TQVA 4JWEA 3LMFA 4WV7A 3B52X 2YIVX 3T48A 2MI7A 3SBTB 2ALWA 3BUDA 4EZNA 1R34A 3UITA 4EZPA 2WYIA 4JWDA 2YLLA 4E81A 2OW7A 3OHXM 2Q12A 3HAIA 4H6HA 4NSWA 2V0OA 4FL9A 2KHOA 1TQSA 2YKTA 4WPEA 3BVXA 1BPRA 4HY9A 1E1DA 2NCZA 2X3WA 1YWMA 3I04A 3T49A 4IW0A 2OBLA 4FM3A 4AZ5A 4IWPA 4IM3A 3SOGA 3CV5A 4AZBA 1ZWWA 4R5JA 4IWQA 1R33A 4EZYA 3DX0A 5C5BB 4ILGA 4F00A 4JNEA 2GF4A 1MJGA 2Q13A 4EZQA 3ER9B 3KAVA 3D4ZA 2X3VA 5KBPA 3D4YA 5FLEX 3KDRA 3ERCC 3BVWA 3CAZA 2FICA 3EJQA 2YLAA 3EJUA 5TKYA 3BUBA 2YL8A 3DYTA 1QWUA 4B9QA 2WINM 2D4CA 3QWEA 2X5CA 4R5GA 2F18A 3DPPA 4D8JA 3CZSA 2C08A 4BNEA 2YL5A 5C5BA 3DX1A 1R5EA 1GN9A 4I1QA 3FD9A 1Y2OA 1ZYLA 3QA8A 3EJSA 2F1AA 3DX4A 3BVVA 3F7WA 2PY6A 2X3XA 2QFFA 3DX3A 4AZGA 2BPRA 2N3KA 3PLTA 4H8SA 4AZHA 3OK8A 3VEBA 2YL9A 3BUQA 4PO2A 4EZXA 4KIKB 3DPOA 3B51X 2OP6A 3ABHA 3T46A 3EJRA 4WV5A 1HXKA 3BLBA 4MQDA 2GAFD 1Q5LA 3ZEFA 3D50A 3HAHA 2EX3B 1O7DC 1X03A 3Q84A 4UDXX 1GNLA 5E84A 1HWWA 4EZRA 2EFKA 4FZPA 1PS3A 1HTYA 1SU8A 1I4DA 1OAOA 3BUIA 4HYBA 3C7NB 2LM0A 3D2FA 2ELBA 2QKWA 4EZTA 3BVUA 3D51A 2D1LA 4F01A 3RV1A 3DDFA 4HR1B 5FIGA 1TQTA 2RAJA 4UDYX 4EZZA 3DPQA 2V7YA 3VKHA 3O3MB 4AZIA 4EZUA 1U00A 3RV0A 4DYLA 2OO2A 3DOBA 4AZ7A 4FZSA 2QXLA 4KIKA 1DKYA 3RPMA 4AZ6A 3SYVA 1I4TA 2F7RA 4EZSA 4H6IA 1I49A 1DG4A 3CVRA 2YI8A 4I43A 3D52A 3CZNA 4AZCB 4JLCA 1E9VA 2FYVA 3M3WA 1QX1A 4G6QA 3CKDA 3DQGA 2YL6A 1QWNA 2F1BA 2LXYA 1YUWA 2YI9A 2OZNB 4DCNC 3DX2A 3C7NA 2F7QA 1DKZA 3OWGA 3Q0KA 2O0I1 2RAIA 2Z0VA 3A98A 4HR1A 4NPHA 1OA1A 1DKXA 1E2UA 2RAKA 4AKVA 3EJPA
chains in the Genus database with same CATH topology
1SU6A 4EZQA 2EX3B 3L3OM 3ER9B 3KAVA 3H0XA 2ND0A 1UPXA 4UDXX 3ER8C 4JWIA 1OA0A 1GNLA 3I01A 4R5KA 4IM0A 5E84A 3KAWA 2EWFA 2JNSA 4EZRA 2YIAA 2Z8YA 4M0MA 4JL9A 5FLEX 3KDRA 3ERCC 1SU8A 1OAOA 3O3NB 3QNJA 4JWEA 4HYBA 3C7NB 2LM0A 4E3CA 3LMFA 3D2FA 4R5IA 4WV7A 4EZTA 3B52X 5TKYA 4F01A 2YIVX 3RV1A 4IWOA 4HR1B 5FIGA 3T48A 2YIBA 3SBTB 4UDYX 4EZNA 4EZZA 2RT6A 3DPQA 2V7YA 4JWCA 3VKHA 4B9QA 3O3MB 2GA9D 1SU7A 3UITA 4EZUA 1U00A 3RV0A 2WINM 4EZPA 1CKRA 4JWDA 3DOBA 4E81A 2X5CA 2QXLA 4KIKA 4R5GA 3DPPA 4D8JA 1JQKA 1DKYA 1SUFA 4ILHB 3SBSA 3O3OB 3OHXM 4EZSA 4H6IA 3T47A 4EZWA 4H6HA 1DG4A 4JNFA 1GN9A 2YI8A 3ZEDA 4FL9A 2KHOA 4I43A 3FD9A 1ZYLA 3QA8A 3VEAA 4JLCA 1E9VA 2OBMA 3F7WA 1BPRA 2PY6A 3GI7A 4HY9A 4EZVA 4ILIA 4G6QA 2QFFA 3N8EA 3DQGA 1E1DA 4EZOA 2BPRA 2NCZA 4IM2A 2N3KA 1YUWA 2YI9A 1W9MA 3I04A 3T49A 3VEBA 4IW0A 2OBLA 4FM3A 3T4AG 4JN4A 3C7NA 1DKZA 3OWGA 4IWPA 4IM3A 1GNTA 4PO2A 4EZXA 3A98A 3I39X 4KIKB 3DPOA 4HR1A 3B51X 4NPHA 1OA1A 4R5JA 4IWQA 4EZYA 2OP6A 3T46A 4R5LA 4WV5A 1DKXA 1E2UA 2ND1A 4ILGA 4F00A 3B53X 3D2EA 4MQDA 7HSCA 2GAFD 1Q5LA 4JNEA 1MJGA 3ZEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV7 A;  4EZW A;  4H6H A;  3T49 A;  4EZT A;  4JNF A;  4EZQ A;  1DG4 A;  3L3O M;  5TKY A;  4F01 A;  3T4A G;  2KHO A;  3C7N A;  4JN4 A;  4FL9 A;  1DKZ A;  3T48 A;  3H0X A;  4EZN A;  4JWI A;  4EZZ A;  3DPQ A;  4R5K A;  4EZX A;  4PO2 A;  5E84 A;  2V7Y A;  4JWC A;  3T47 A;  4B9Q A;  3DPO A;  4EZR A;  4EZU A;  1U00 A;  4EZP A;  2WIN M;  1BPR A;  1CKR A;  4JWD A;  4R5J A;  3DOB A;  4HY9 A;  4EZV A;  4E81 A;  4EZY A;  1Q5L A;  2OP6 A;  2QFF A;  3D2F A;  2QXL A;  4R5G A;  3T46 A;  4R5L A;  3N8E A;  3DPP A;  3DQG A;  4WV5 A;  1DKY A;  1DKX A;  4EZO A;  2BPR A;  3QNJ A;  4F00 A;  4JWE A;  3D2E A;  3OHX M;  4HYB A;  3C7N B;  1YUW A;  7HSC A;  4EZS A;  4H6I A;  4R5I A;  4JNE A; 
#chains in the Genus database with same CATH topology
 3L3O M;  3QE6 A;  3H0X A;  1UPX A;  4R5K A;  4ATM A;  3KAW A;  2Z8Y A;  4M0M A;  4AZC A;  3O3N B;  3QNJ A;  1I4L A;  1LQ7 A;  3LLL A;  4R5I A;  4IWO A;  1WDZ A;  2YIB A;  3L3P A;  2RT6 A;  4JWC A;  2GA9 D;  1SU7 A;  1CKR A;  1X04 A;  2F7O A;  2JNK A;  2EFL A;  4AVM A;  1JQK A;  1SUF A;  4ILH B;  3I2W A;  3SBS A;  3O3O B;  3T47 A;  4EZW A;  4JNF A;  2F7P A;  3ZED A;  3BUP A;  3VEA A;  2OBM A;  3G9G A;  3GI7 A;  4EZV A;  4NQI A;  4ILI A;  2Z0O A;  3N8E A;  2WYH A;  4EZO A;  4IM2 A;  1W9M A;  3T4A G;  4JN4 A;  1TQU A;  1GNT A;  3DDG A;  3I39 X;  1O7D B;  3EJT A;  2ZXQ A;  4R5L A;  1TQW A;  2OW6 A;  2ND1 A;  2PMR A;  3B53 X;  3D2E A;  3HAJ A;  3BVT A;  7HSC A;  4E3C A;  1SU6 A;  1URU A;  2ND0 A;  3ER8 C;  3LVT A;  4JWI A;  1OA0 A;  3I01 A;  4IM0 A;  2EWF A;  2JNS A;  4WPC A;  3QNI A;  2YIA A;  4JL9 A;  3ACO A;  4FZO A;  2Z0N A;  1TQV A;  4JWE A;  3LMF A;  4WV7 A;  3B52 X;  2YIV X;  3T48 A;  2MI7 A;  3SBT B;  2ALW A;  3BUD A;  4EZN A;  1R34 A;  3UIT A;  4EZP A;  2WYI A;  4JWD A;  2YLL A;  4E81 A;  2OW7 A;  3OHX M;  2Q12 A;  3HAI A;  4H6H A;  4NSW A;  2V0O A;  4FL9 A;  2KHO A;  1TQS A;  2YKT A;  4WPE A;  3BVX A;  1BPR A;  4HY9 A;  1E1D A;  2NCZ A;  2X3W A;  1YWM A;  3I04 A;  3T49 A;  4IW0 A;  2OBL A;  4FM3 A;  4AZ5 A;  4IWP A;  4IM3 A;  3SOG A;  3CV5 A;  4AZB A;  1ZWW A;  4R5J A;  4IWQ A;  1R33 A;  4EZY A;  3DX0 A;  5C5B B;  4ILG A;  4F00 A;  4JNE A;  2GF4 A;  1MJG A;  2Q13 A;  4EZQ A;  3ER9 B;  3KAV A;  3D4Z A;  2X3V A;  5KBP A;  3D4Y A;  5FLE X;  3KDR A;  3ERC C;  3BVW A;  3CAZ A;  2FIC A;  3EJQ A;  2YLA A;  3EJU A;  5TKY A;  3BUB A;  2YL8 A;  3DYT A;  1QWU A;  4B9Q A;  2WIN M;  2D4C A;  3QWE A;  2X5C A;  4R5G A;  2F18 A;  3DPP A;  4D8J A;  3CZS A;  2C08 A;  4BNE A;  2YL5 A;  5C5B A;  3DX1 A;  1R5E A;  1GN9 A;  4I1Q A;  3FD9 A;  1Y2O A;  1ZYL A;  3QA8 A;  3EJS A;  2F1A A;  3DX4 A;  3BVV A;  3F7W A;  2PY6 A;  2X3X A;  2QFF A;  3DX3 A;  4AZG A;  2BPR A;  2N3K A;  3PLT A;  4H8S A;  4AZH A;  3OK8 A;  3VEB A;  2YL9 A;  3BUQ A;  4PO2 A;  4EZX A;  4KIK B;  3DPO A;  3B51 X;  2OP6 A;  3ABH A;  3T46 A;  3EJR A;  4WV5 A;  1HXK A;  3BLB A;  4MQD A;  2GAF D;  1Q5L A;  3ZEF A;  3D50 A;  3HAH A;  2EX3 B;  1O7D C;  1X03 A;  3Q84 A;  4UDX X;  1GNL A;  5E84 A;  1HWW A;  4EZR A;  2EFK A;  4FZP A;  1PS3 A;  1HTY A;  1SU8 A;  1I4D A;  1OAO A;  3BUI A;  4HYB A;  3C7N B;  2LM0 A;  3D2F A;  2ELB A;  2QKW A;  4EZT A;  3BVU A;  3D51 A;  2D1L A;  4F01 A;  3RV1 A;  3DDF A;  4HR1 B;  5FIG A;  1TQT A;  2RAJ A;  4UDY X;  4EZZ A;  3DPQ A;  2V7Y A;  3VKH A;  3O3M B;  4AZI A;  4EZU A;  1U00 A;  3RV0 A;  4DYL A;  2OO2 A;  3DOB A;  4AZ7 A;  4FZS A;  2QXL A;  4KIK A;  1DKY A;  3RPM A;  4AZ6 A;  3SYV A;  1I4T A;  2F7R A;  4EZS A;  4H6I A;  1I49 A;  1DG4 A;  3CVR A;  2YI8 A;  4I43 A;  3D52 A;  3CZN A;  4AZC B;  4JLC A;  1E9V A;  2FYV A;  3M3W A;  1QX1 A;  4G6Q A;  3CKD A;  3DQG A;  2YL6 A;  1QWN A;  2F1B A;  2LXY A;  1YUW A;  2YI9 A;  2OZN B;  4DCN C;  3DX2 A;  3C7N A;  2F7Q A;  1DKZ A;  3OWG A;  3Q0K A;  2O0I 1;  2RAI A;  2Z0V A;  3A98 A;  4HR1 A;  4NPH A;  1OA1 A;  1DKX A;  1E2U A;  2RAK A;  4AKV A;  3EJP A; 
#chains in the Genus database with same CATH homology
 1SU6 A;  4EZQ A;  2EX3 B;  3L3O M;  3ER9 B;  3KAV A;  3H0X A;  2ND0 A;  1UPX A;  4UDX X;  3ER8 C;  4JWI A;  1OA0 A;  1GNL A;  3I01 A;  4R5K A;  4IM0 A;  5E84 A;  3KAW A;  2EWF A;  2JNS A;  4EZR A;  2YIA A;  2Z8Y A;  4M0M A;  4JL9 A;  5FLE X;  3KDR A;  3ERC C;  1SU8 A;  1OAO A;  3O3N B;  3QNJ A;  4JWE A;  4HYB A;  3C7N B;  2LM0 A;  4E3C A;  3LMF A;  3D2F A;  4R5I A;  4WV7 A;  4EZT A;  3B52 X;  5TKY A;  4F01 A;  2YIV X;  3RV1 A;  4IWO A;  4HR1 B;  5FIG A;  3T48 A;  2YIB A;  3SBT B;  4UDY X;  4EZN A;  4EZZ A;  2RT6 A;  3DPQ A;  2V7Y A;  4JWC A;  3VKH A;  4B9Q A;  3O3M B;  2GA9 D;  1SU7 A;  3UIT A;  4EZU A;  1U00 A;  3RV0 A;  2WIN M;  4EZP A;  1CKR A;  4JWD A;  3DOB A;  4E81 A;  2X5C A;  2QXL A;  4KIK A;  4R5G A;  3DPP A;  4D8J A;  1JQK A;  1DKY A;  1SUF A;  4ILH B;  3SBS A;  3O3O B;  3OHX M;  4EZS A;  4H6I A;  3T47 A;  4EZW A;  4H6H A;  1DG4 A;  4JNF A;  1GN9 A;  2YI8 A;  3ZED A;  4FL9 A;  2KHO A;  4I43 A;  3FD9 A;  1ZYL A;  3QA8 A;  3VEA A;  4JLC A;  1E9V A;  2OBM A;  3F7W A;  1BPR A;  2PY6 A;  3GI7 A;  4HY9 A;  4EZV A;  4ILI A;  4G6Q A;  2QFF A;  3N8E A;  3DQG A;  1E1D A;  4EZO A;  2BPR A;  2NCZ A;  4IM2 A;  2N3K A;  1YUW A;  2YI9 A;  1W9M A;  3I04 A;  3T49 A;  3VEB A;  4IW0 A;  2OBL A;  4FM3 A;  3T4A G;  4JN4 A;  3C7N A;  1DKZ A;  3OWG A;  4IWP A;  4IM3 A;  1GNT A;  4PO2 A;  4EZX A;  3A98 A;  3I39 X;  4KIK B;  3DPO A;  4HR1 A;  3B51 X;  4NPH A;  1OA1 A;  4R5J A;  4IWQ A;  4EZY A;  2OP6 A;  3T46 A;  4R5L A;  4WV5 A;  1DKX A;  1E2U A;  2ND1 A;  4ILG A;  4F00 A;  3B53 X;  3D2E A;  4MQD A;  7HSC A;  2GAF D;  1Q5L A;  4JNE A;  1MJG A;  3ZEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...