4R5JA

Crystal structure of the dnak c-terminus (dnak-sbd-a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
222
structure length
218
Chain Sequence
b'HHHIEVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKANEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 62
structure length 218
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5jA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5jA01
3T49A 4PO2A 3T48A 4EZZA 4EZRA 7HSCA 1DG4A 3DPOA 4WV5A 4EZVA 3N8EA 4EZTA 4EZYA 3H0XA 3DQGA 1DKXA 5TKYA 1CKRA 4HY9A 1DKZA 2WINM 4JNFA 4EZOA 4F01A 3OHXM 4EZXA 4JWCA 2BPRA 4JWIA 4EZWA 4EZNA 1YUWA 4H6IA 5E84A 3C7NB 4FL9A 4EZUA 4R5LA 3DPPA 3QNJA 4JNEA 3T47A 4F00A 4B9QA 3T4AG 2QXLA 1U00A 1DKYA 4JWEA 4R5JA 4E81A 4EZQA 3DOBA 4EZSA 4JWDA 3L3OM 2QFFA 3D2EA 4EZPA 3D2FA 4R5KA 1BPRA 2OP6A 4JN4A 4R5IA 4HYBA 3T46A 3DPQA 2V7YA 4R5GA 3C7NA 2KHOA 1Q5LA 4H6HA 4WV7A
chains in the Genus database with same CATH superfamily
3EJRA 2ZXQA 4PO2A 3Q0KA 7HSCA 1UPXA 3ZEFA 4AZGA 3GI7A 2YLAA 4I43A 2LM0A 2QFFA 3DX4A 4WPEA 2X3XA 4IM2A 4KIKB 4UDYX 5FIGA 3A98A 3CVRA 1X04A 4ILGA 1OAOA 2Z8YA 4B9QA 3QWEA 3M3WA 3D4YA 4R5GA 4WV7A 3ACOA 2YIAA 5C5BB 3SOGA 3H0XA 3DDGA 1MJGA 4EZOA 1HTYA 4I1QA 2GAFD 2YKTA 4DCNC 4EZUA 2Z0OA 3DX1A 2OO2A 3CKDA 4E81A 2OZNB 1ZYLA 2O0I1 3BUDA 3VEAA 3BUPA 1GN9A 1R5EA 2RAKA 3SBSA 4JLCA 3BVVA 3EJPA 3F7WA 4KIKA 2FYVA 1SUFA 3EJQA 2RAIA 3KDRA 1I4TA 1O7DC 2D4CA 3D2FA 4R5IA 3B52X 3DPQA 3LLLA 4FZPA 1Q5LA 1GNLA 4NSWA 4EZYA 1QWUA 3QE6A 1TQWA 3OHXM 4EZWA 5E84A 1I4LA 4FZOA 3CAZA 3D52A 5C5BA 4F00A 4ILHB 2YL6A 3SBTB 3C7NA 1TQUA 3KAVA 4E3CA 3PLTA 3BVTA 1CKRA 4HY9A 3RV0A 1HWWA 3HAJA 4AZCB 3Q84A 1SU8A 3DX2A 4AZ6A 1R34A 2OBMA 2QXLA 1DKYA 4M0MA 3BUIA 3FD9A 3HAIA 3I39X 4H8SA 1DKXA 4IWOA 2N3KA 2F7RA 2BPRA 2FICA 2F7OA 3DX3A 3QNJA 2PY6A 3T4AG 3D51A 3EJUA 4FM3A 2YLLA 2F1BA 3I2WA 4JN4A 3VKHA 4AZIA 1URUA 1LQ7A 2PMRA 5TKYA 3LMFA 4IW0A 4F01A 4AZ5A 2RAJA 4JWIA 4BNEA 3SYVA 3C7NB 2YL5A 3L3PA 1I49A 1YWMA 4FZSA 3ABHA 2WYHA 3O3OB 4NQIA 2EFKA 3BLBA 2RT6A 4JWDA 2F7PA 4EZPA 2OP6A 1BPRA 4H6HA 1O7DB 4AZCA 1OA1A 2C08A 3B51X 3CV5A 1I4DA 2JNSA 3B53X 2OW6A 3DQGA 2X3WA 3RV1A 2OW7A 2YIBA 3I04A 1Y2OA 4ATMA 3QA8A 3DOBA 2ALWA 3ER8C 1E2UA 2V7YA 5FLEX 4AZ7A 4ILIA 3BVWA 2YL8A 3G9GA 4EZZA 1QX1A 2WYIA 4EZTA 2YI9A 1E1DA 4IWQA 3I01A 1WDZA 4H6IA 1W9MA 1U00A 3ZEDA 3DYTA 3OK8A 4R5KA 3EJTA 2EWFA 2QKWA 3T48A 1DG4A 4IWPA 3QNIA 3RPMA 2F18A 1X03A 2YIVX 4DYLA 3DPPA 4AZBA 4MQDA 3L3OM 3D2EA 2Q12A 2X5CA 3CZSA 2KHOA 2OBLA 3EJSA 3DPOA 2F7QA 4IM0A 2ND0A 2WINM 3VEBA 2ND1A 4JNEA 2MI7A 2EFLA 4EZQA 3KAWA 1GNTA 2X3VA 5KBPA 3BUQA 1DKZA 3OWGA 2GA9D 4FL9A 1SU6A 4R5LA 2D1LA 3BUBA 4R5JA 1PS3A 1TQSA 2ELBA 3T46A 4HR1B 3HAHA 2Z0NA 4EZRA 4WPCA 4WV5A 2Q13A 1ZWWA 4D8JA 4NPHA 4EZNA 1HXKA 3T47A 4JWEA 3D50A 3UITA 3ER9B 4IM3A 1R33A 4HYBA 2GF4A 4AZHA 3T49A 3LVTA 1SU7A 2NCZA 3DDFA 2YL9A 2EX3B 4EZVA 4AKVA 3DX0A 4JWCA 3D4ZA 1TQVA 3O3NB 4AVMA 4EZSA 2JNKA 4G6QA 3O3MB 2YI8A 3ERCC 3N8EA 4JNFA 1OA0A 2F1AA 2LXYA 4EZXA 3CZNA 3BVUA 2V0OA 1YUWA 1E9VA 4HR1A 2Z0VA 4JL9A 1TQTA 4UDXX 3BVXA 1JQKA 1QWNA
chains in the Genus database with same CATH topology
1OA1A 4PO2A 3B51X 7HSCA 2JNSA 4EZYA 3B53X 3DQGA 1UPXA 1DKZA 3ZEFA 3OHXM 3RV1A 4EZWA 3OWGA 5E84A 2GA9D 4FL9A 3GI7A 1SU6A 4R5LA 2YIBA 3I04A 4F00A 4ILHB 3QA8A 4I43A 2LM0A 4R5JA 3DOBA 3ER8C 2QFFA 1E2UA 2V7YA 3T46A 5FLEX 3SBTB 4IM2A 3C7NA 4ILIA 4KIKB 4UDYX 4HR1B 3KAVA 5FIGA 4E3CA 3A98A 4EZZA 4EZRA 4WV5A 4EZTA 4D8JA 1CKRA 2YI9A 4HY9A 1E1DA 3RV0A 4NPHA 4IWQA 3I01A 4EZNA 4H6IA 4ILGA 1OAOA 1W9MA 2Z8YA 1SU8A 3T47A 2OBMA 4B9QA 1U00A 2QXLA 1DKYA 4JWEA 3ZEDA 3UITA 3ER9B 4IM3A 4R5KA 4M0MA 4HYBA 4R5GA 2EWFA 4WV7A 2YIAA 3T49A 3FD9A 3T48A 1SU7A 2NCZA 1DG4A 2EX3B 4IWPA 4EZVA 3I39X 3H0XA 1DKXA 4IWOA 1MJGA 2N3KA 4EZOA 4JWCA 2BPRA 2GAFD 2YIVX 4EZUA 3DPPA 3QNJA 2PY6A 3O3NB 3T4AG 4MQDA 4E81A 4EZSA 3L3OM 1ZYLA 3D2EA 4G6QA 3O3MB 4FM3A 4JN4A 2YI8A 3VKHA 2X5CA 2KHOA 2OBLA 3VEAA 3ERCC 3DPOA 3N8EA 4IM0A 5TKYA 2ND0A 4JNFA 2WINM 1GN9A 1OA0A 3LMFA 4IW0A 4F01A 3VEBA 3SBSA 4JLCA 4EZXA 4JWIA 1YUWA 3F7WA 3C7NB 2ND1A 4KIKA 1E9VA 4HR1A 1SUFA 4JNEA 3O3OB 3KDRA 4JL9A 4EZQA 2RT6A 4JWDA 3KAWA 4EZPA 1GNTA 3D2FA 2OP6A 1BPRA 4R5IA 3B52X 4UDXX 3DPQA 4H6HA 1Q5LA 1JQKA 1GNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T49 A;  4PO2 A;  3T48 A;  4EZZ A;  4EZR A;  7HSC A;  1DG4 A;  3DPO A;  4WV5 A;  4EZV A;  3N8E A;  4EZT A;  4EZY A;  3H0X A;  3DQG A;  1DKX A;  5TKY A;  1CKR A;  4HY9 A;  1DKZ A;  2WIN M;  4JNF A;  4EZO A;  4F01 A;  3OHX M;  4EZX A;  4JWC A;  2BPR A;  4JWI A;  4EZW A;  4EZN A;  1YUW A;  4H6I A;  5E84 A;  3C7N B;  4FL9 A;  4EZU A;  4R5L A;  3DPP A;  3QNJ A;  4JNE A;  3T47 A;  4F00 A;  4B9Q A;  3T4A G;  2QXL A;  1U00 A;  1DKY A;  4JWE A;  4R5J A;  4E81 A;  4EZQ A;  3DOB A;  4EZS A;  4JWD A;  3L3O M;  2QFF A;  3D2E A;  4EZP A;  3D2F A;  4R5K A;  1BPR A;  2OP6 A;  4JN4 A;  4R5I A;  4HYB A;  3T46 A;  3DPQ A;  2V7Y A;  4R5G A;  3C7N A;  2KHO A;  1Q5L A;  4H6H A;  4WV7 A; 
#chains in the Genus database with same CATH topology
 3EJR A;  2ZXQ A;  4PO2 A;  3Q0K A;  7HSC A;  1UPX A;  3ZEF A;  4AZG A;  3GI7 A;  2YLA A;  4I43 A;  2LM0 A;  2QFF A;  3DX4 A;  4WPE A;  2X3X A;  4IM2 A;  4KIK B;  4UDY X;  5FIG A;  3A98 A;  3CVR A;  1X04 A;  4ILG A;  1OAO A;  2Z8Y A;  4B9Q A;  3QWE A;  3M3W A;  3D4Y A;  4R5G A;  4WV7 A;  3ACO A;  2YIA A;  5C5B B;  3SOG A;  3H0X A;  3DDG A;  1MJG A;  4EZO A;  1HTY A;  4I1Q A;  2GAF D;  2YKT A;  4DCN C;  4EZU A;  2Z0O A;  3DX1 A;  2OO2 A;  3CKD A;  4E81 A;  2OZN B;  1ZYL A;  2O0I 1;  3BUD A;  3VEA A;  3BUP A;  1GN9 A;  1R5E A;  2RAK A;  3SBS A;  4JLC A;  3BVV A;  3EJP A;  3F7W A;  4KIK A;  2FYV A;  1SUF A;  3EJQ A;  2RAI A;  3KDR A;  1I4T A;  1O7D C;  2D4C A;  3D2F A;  4R5I A;  3B52 X;  3DPQ A;  3LLL A;  4FZP A;  1Q5L A;  1GNL A;  4NSW A;  4EZY A;  1QWU A;  3QE6 A;  1TQW A;  3OHX M;  4EZW A;  5E84 A;  1I4L A;  4FZO A;  3CAZ A;  3D52 A;  5C5B A;  4F00 A;  4ILH B;  2YL6 A;  3SBT B;  3C7N A;  1TQU A;  3KAV A;  4E3C A;  3PLT A;  3BVT A;  1CKR A;  4HY9 A;  3RV0 A;  1HWW A;  3HAJ A;  4AZC B;  3Q84 A;  1SU8 A;  3DX2 A;  4AZ6 A;  1R34 A;  2OBM A;  2QXL A;  1DKY A;  4M0M A;  3BUI A;  3FD9 A;  3HAI A;  3I39 X;  4H8S A;  1DKX A;  4IWO A;  2N3K A;  2F7R A;  2BPR A;  2FIC A;  2F7O A;  3DX3 A;  3QNJ A;  2PY6 A;  3T4A G;  3D51 A;  3EJU A;  4FM3 A;  2YLL A;  2F1B A;  3I2W A;  4JN4 A;  3VKH A;  4AZI A;  1URU A;  1LQ7 A;  2PMR A;  5TKY A;  3LMF A;  4IW0 A;  4F01 A;  4AZ5 A;  2RAJ A;  4JWI A;  4BNE A;  3SYV A;  3C7N B;  2YL5 A;  3L3P A;  1I49 A;  1YWM A;  4FZS A;  3ABH A;  2WYH A;  3O3O B;  4NQI A;  2EFK A;  3BLB A;  2RT6 A;  4JWD A;  2F7P A;  4EZP A;  2OP6 A;  1BPR A;  4H6H A;  1O7D B;  4AZC A;  1OA1 A;  2C08 A;  3B51 X;  3CV5 A;  1I4D A;  2JNS A;  3B53 X;  2OW6 A;  3DQG A;  2X3W A;  3RV1 A;  2OW7 A;  2YIB A;  3I04 A;  1Y2O A;  4ATM A;  3QA8 A;  3DOB A;  2ALW A;  3ER8 C;  1E2U A;  2V7Y A;  5FLE X;  4AZ7 A;  4ILI A;  3BVW A;  2YL8 A;  3G9G A;  4EZZ A;  1QX1 A;  2WYI A;  4EZT A;  2YI9 A;  1E1D A;  4IWQ A;  3I01 A;  1WDZ A;  4H6I A;  1W9M A;  1U00 A;  3ZED A;  3DYT A;  3OK8 A;  4R5K A;  3EJT A;  2EWF A;  2QKW A;  3T48 A;  1DG4 A;  4IWP A;  3QNI A;  3RPM A;  2F18 A;  1X03 A;  2YIV X;  4DYL A;  3DPP A;  4AZB A;  4MQD A;  3L3O M;  3D2E A;  2Q12 A;  2X5C A;  3CZS A;  2KHO A;  2OBL A;  3EJS A;  3DPO A;  2F7Q A;  4IM0 A;  2ND0 A;  2WIN M;  3VEB A;  2ND1 A;  4JNE A;  2MI7 A;  2EFL A;  4EZQ A;  3KAW A;  1GNT A;  2X3V A;  5KBP A;  3BUQ A;  1DKZ A;  3OWG A;  2GA9 D;  4FL9 A;  1SU6 A;  4R5L A;  2D1L A;  3BUB A;  4R5J A;  1PS3 A;  1TQS A;  2ELB A;  3T46 A;  4HR1 B;  3HAH A;  2Z0N A;  4EZR A;  4WPC A;  4WV5 A;  2Q13 A;  1ZWW A;  4D8J A;  4NPH A;  4EZN A;  1HXK A;  3T47 A;  4JWE A;  3D50 A;  3UIT A;  3ER9 B;  4IM3 A;  1R33 A;  4HYB A;  2GF4 A;  4AZH A;  3T49 A;  3LVT A;  1SU7 A;  2NCZ A;  3DDF A;  2YL9 A;  2EX3 B;  4EZV A;  4AKV A;  3DX0 A;  4JWC A;  3D4Z A;  1TQV A;  3O3N B;  4AVM A;  4EZS A;  2JNK A;  4G6Q A;  3O3M B;  2YI8 A;  3ERC C;  3N8E A;  4JNF A;  1OA0 A;  2F1A A;  2LXY A;  4EZX A;  3CZN A;  3BVU A;  2V0O A;  1YUW A;  1E9V A;  4HR1 A;  2Z0V A;  4JL9 A;  1TQT A;  4UDX X;  3BVX A;  1JQK A;  1QWN A; 
#chains in the Genus database with same CATH homology
 1OA1 A;  4PO2 A;  3B51 X;  7HSC A;  2JNS A;  4EZY A;  3B53 X;  3DQG A;  1UPX A;  1DKZ A;  3ZEF A;  3OHX M;  3RV1 A;  4EZW A;  3OWG A;  5E84 A;  2GA9 D;  4FL9 A;  3GI7 A;  1SU6 A;  4R5L A;  2YIB A;  3I04 A;  4F00 A;  4ILH B;  3QA8 A;  4I43 A;  2LM0 A;  4R5J A;  3DOB A;  3ER8 C;  2QFF A;  1E2U A;  2V7Y A;  3T46 A;  5FLE X;  3SBT B;  4IM2 A;  3C7N A;  4ILI A;  4KIK B;  4UDY X;  4HR1 B;  3KAV A;  5FIG A;  4E3C A;  3A98 A;  4EZZ A;  4EZR A;  4WV5 A;  4EZT A;  4D8J A;  1CKR A;  2YI9 A;  4HY9 A;  1E1D A;  3RV0 A;  4NPH A;  4IWQ A;  3I01 A;  4EZN A;  4H6I A;  4ILG A;  1OAO A;  1W9M A;  2Z8Y A;  1SU8 A;  3T47 A;  2OBM A;  4B9Q A;  1U00 A;  2QXL A;  1DKY A;  4JWE A;  3ZED A;  3UIT A;  3ER9 B;  4IM3 A;  4R5K A;  4M0M A;  4HYB A;  4R5G A;  2EWF A;  4WV7 A;  2YIA A;  3T49 A;  3FD9 A;  3T48 A;  1SU7 A;  2NCZ A;  1DG4 A;  2EX3 B;  4IWP A;  4EZV A;  3I39 X;  3H0X A;  1DKX A;  4IWO A;  1MJG A;  2N3K A;  4EZO A;  4JWC A;  2BPR A;  2GAF D;  2YIV X;  4EZU A;  3DPP A;  3QNJ A;  2PY6 A;  3O3N B;  3T4A G;  4MQD A;  4E81 A;  4EZS A;  3L3O M;  1ZYL A;  3D2E A;  4G6Q A;  3O3M B;  4FM3 A;  4JN4 A;  2YI8 A;  3VKH A;  2X5C A;  2KHO A;  2OBL A;  3VEA A;  3ERC C;  3DPO A;  3N8E A;  4IM0 A;  5TKY A;  2ND0 A;  4JNF A;  2WIN M;  1GN9 A;  1OA0 A;  3LMF A;  4IW0 A;  4F01 A;  3VEB A;  3SBS A;  4JLC A;  4EZX A;  4JWI A;  1YUW A;  3F7W A;  3C7N B;  2ND1 A;  4KIK A;  1E9V A;  4HR1 A;  1SUF A;  4JNE A;  3O3O B;  3KDR A;  4JL9 A;  4EZQ A;  2RT6 A;  4JWD A;  3KAW A;  4EZP A;  1GNT A;  3D2F A;  2OP6 A;  1BPR A;  4R5I A;  3B52 X;  4UDX X;  3DPQ A;  4H6H A;  1Q5L A;  1JQK A;  1GNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...