4R5JA

Crystal structure of the dnak c-terminus (dnak-sbd-a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
222
structure length
218
Chain Sequence
HHHIEVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKANEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 62
structure length 218
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5jA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5jA01
3H0XA 4H6IA 4PO2A 2V7YA 3T47A 7HSCA 3N8EA 4EZOA 4HYBA 4F00A 4B9QA 3OHXM 4JWCA 4JNEA 1Q5LA 4EZXA 4EZQA 4H6HA 2QFFA 1CKRA 3DPQA 3DPPA 3C7NA 1U00A 4JN4A 3QNJA 3DQGA 2KHOA 4JWIA 1YUWA 3DOBA 3L3OM 4EZNA 3T46A 4EZZA 4EZPA 1BPRA 3T4AG 4EZUA 4HY9A 4R5JA 2QXLA 4FL9A 1DKYA 1DKXA 4JWDA 4EZVA 2BPRA 2OP6A 4E81A 3DPOA 4EZSA 4EZWA 1DKZA 4R5GA 4R5KA 5TKYA 1DG4A 3D2FA 5E84A 4JNFA 3D2EA 3T49A 4R5IA 4WV7A 4EZTA 2WINM 3T48A 4JWEA 4EZYA 3C7NB 4F01A 4WV5A 4R5LA 4EZRA
chains in the Genus database with same CATH superfamily
3QE6A 4H6IA 4UDXX 4IWQA 2PMRA 3D51A 2F7OA 3L3OM 5FIGA 3DX3A 3DX2A 1DKXA 4E3CA 3B52X 2RAIA 2RAJA 2WINM 5C5BB 1JQKA 3RV1A 4WV5A 3O3OB 2V7YA 4JLCA 3ZEDA 1Q5LA 3L3PA 3KDRA 2F7RA 2OZNB 1GN9A 2O0I1 3FD9A 4MQDA 1OA1A 2YLAA 4JWDA 4M0MA 2WYIA 3BUPA 4KIKB 2Z0NA 3LMFA 1R33A 1MJGA 3I04A 4EZYA 4ATMA 1HWWA 3BVWA 3BLBA 4EZOA 1SUFA 4NSWA 1E1DA 4ILIA 1I4DA 2X5CA 2Q12A 2BPRA 3BVXA 3DPOA 4HR1B 4JNFA 3T49A 4AZ5A 1WDZA 4JWEA 3C7NB 1QWUA 3DDGA 4IM0A 4WPCA 4KIKA 3M3WA 4AZIA 4H6HA 3BUBA 3DQGA 3I39X 1X03A 3GI7A 2ND1A 4EZVA 2F7QA 3CVRA 3EJTA 3CAZA 1OA0A 4R5LA 1E2UA 4HR1A 2N3KA 4JWCA 3ZEFA 4EZQA 3DDFA 3ER9B 3VKHA 3Q84A 3C7NA 2GAFD 2JNKA 2F18A 1QX1A 3VEBA 2D4CA 2YL9A 2LM0A 2V0OA 3UITA 2RAKA 3BVUA 3HAIA 3KAVA 3G9GA 3D4ZA 2YL5A 3CKDA 4IM3A 2QKWA 3ERCC 3I01A 1HTYA 4NPHA 1I4LA 3N8EA 4JN4A 1Y2OA 4ILGA 3SBTB 4EZNA 3CV5A 3D4YA 1GNLA 2FICA 3LVTA 3O3MB 4AZHA 3SOGA 2D1LA 2YIVX 4AZ7A 2ND0A 2X3VA 2ZXQA 4AKVA 2EWFA 1ZYLA 2KHOA 3Q0KA 3EJPA 2OBMA 3VEAA 1PS3A 2OW7A 3PLTA 4AZBA 3RPMA 4EZRA 4G6QA 4FZOA 1W9MA 3ABHA 2F1AA 2EX3B 5C5BA 1OAOA 3T46A 2F7PA 4E81A 2MI7A 3EJSA 2YI8A 4HYBA 4F00A 3QNJA 4NQIA 1TQWA 3SBSA 4FZSA 4EZSA 3RV0A 4AZCB 3EJQA 3F7WA 4H8SA 3QA8A 2YL6A 2Q13A 4B9QA 1URUA 2C08A 1O7DC 3A98A 4I1QA 2OW6A 3O3NB 2PY6A 3BVTA 2LXYA 4EZWA 5TKYA 2Z8YA 4WV7A 1TQTA 4DYLA 3DX4A 1GNTA 2X3XA 3BUIA 4AZCA 4BNEA 7HSCA 1SU8A 4IM2A 2ALWA 1TQVA 3B53X 4DCNC 3T4AG 2Z0OA 1I49A 1SU6A 3OK8A 3CZNA 4IWPA 3T48A 5FLEX 1HXKA 2YKTA 3OHXM 2Z0VA 1R34A 4JWIA 3D52A 4AVMA 3DX0A 1YWMA 4HY9A 3DYTA 4IWOA 3BUQA 2ELBA 4PO2A 4JNEA 1CKRA 2QFFA 2EFLA 1X04A 3D50A 3EJRA 1YUWA 4WPEA 4EZPA 4R5JA 4FL9A 1O7DB 2NCZA 4AZ6A 2YI9A 4R5GA 1DG4A 3B51X 1R5EA 5E84A 4D8JA 4ILHB 3EJUA 3HAHA 3ACOA 1E9VA 3H0XA 4FZPA 2F1BA 2YIAA 1SU7A 3DPPA 1U00A 2JNSA 3DOBA 3SYVA 1BPRA 4EZZA 3QWEA 4EZUA 2QXLA 3ER8C 2OBLA 2GA9D 3D2EA 1I4TA 3HAJA 4F01A 3T47A 1TQUA 3CZSA 2RT6A 2GF4A 2WYHA 1UPXA 2FYVA 3KAWA 4AZGA 3BVVA 2OP6A 2YL8A 4IW0A 1DKZA 2OO2A 1QWNA 4R5IA 4EZTA 1ZWWA 2YLLA 3OWGA 2X3WA 1TQSA 3BUDA 4EZXA 5KBPA 3DPQA 4FM3A 4UDYX 4JL9A 3LLLA 2EFKA 3DX1A 1DKYA 3QNIA 4I43A 4R5KA 3I2WA 3D2FA 2YIBA 1LQ7A
chains in the Genus database with same CATH topology
4H6IA 1E2UA 4PO2A 4HR1A 4UDXX 4HYBA 4F00A 2N3KA 4JWCA 4JNEA 4EZQA 3ZEFA 1CKRA 2QFFA 3ER9B 3VKHA 4IWQA 3C7NA 2GAFD 3QNJA 1YUWA 3VEBA 3L3OM 3SBSA 5FIGA 4EZPA 4R5JA 4FL9A 1DKXA 2LM0A 3UITA 4EZSA 4E3CA 3RV0A 2NCZA 3KAVA 2YI9A 4R5GA 1DG4A 3B51X 3B52X 5E84A 4D8JA 4ILHB 3F7WA 2WINM 4IM3A 1JQKA 3RV1A 1E9VA 3ERCC 4WV5A 3I01A 3QA8A 4NPHA 3H0XA 3O3OB 2V7YA 4JLCA 3ZEDA 3N8EA 2YIAA 4B9QA 1SU7A 1Q5LA 3DPPA 1U00A 4JN4A 3A98A 3KDRA 2JNSA 3DOBA 4ILGA 3SBTB 1GN9A 4EZNA 1BPRA 4EZZA 3O3NB 2PY6A 4EZUA 3FD9A 2QXLA 4MQDA 1GNLA 1OA1A 4JWDA 4M0MA 3ER8C 4EZWA 5TKYA 2OBLA 2GA9D 4KIKB 3O3MB 3D2EA 2Z8YA 4WV7A 3LMFA 1MJGA 2YIVX 2ND0A 3I04A 4EZYA 4F01A 1GNTA 7HSCA 3T47A 2EWFA 1ZYLA 4EZOA 1SU8A 1SUFA 4IM2A 1E1DA 2RT6A 3B53X 4ILIA 2KHOA 1UPXA 2X5CA 3KAWA 3T4AG 2OP6A 2BPRA 3DPOA 4IW0A 2OBMA 1DKZA 4HR1B 3VEAA 4JNFA 1SU6A 3T49A 4R5IA 4EZTA 4IWPA 3T48A 4JWEA 3C7NB 5FLEX 3OWGA 4EZRA 4IM0A 4G6QA 3OHXM 4KIKA 4EZXA 4H6HA 3DPQA 4FM3A 4UDYX 1W9MA 4JL9A 3DQGA 2EX3B 4JWIA 3I39X 1OAOA 3T46A 3GI7A 4HY9A 2ND1A 1DKYA 4EZVA 4I43A 4E81A 4IWOA 4R5KA 3D2FA 2YIBA 1OA0A 4R5LA 2YI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0X A;  4H6I A;  4PO2 A;  2V7Y A;  3T47 A;  7HSC A;  3N8E A;  4EZO A;  4HYB A;  4F00 A;  4B9Q A;  3OHX M;  4JWC A;  4JNE A;  1Q5L A;  4EZX A;  4EZQ A;  4H6H A;  2QFF A;  1CKR A;  3DPQ A;  3DPP A;  3C7N A;  1U00 A;  4JN4 A;  3QNJ A;  3DQG A;  2KHO A;  4JWI A;  1YUW A;  3DOB A;  3L3O M;  4EZN A;  3T46 A;  4EZZ A;  4EZP A;  1BPR A;  3T4A G;  4EZU A;  4HY9 A;  4R5J A;  2QXL A;  4FL9 A;  1DKY A;  1DKX A;  4JWD A;  4EZV A;  2BPR A;  2OP6 A;  4E81 A;  3DPO A;  4EZS A;  4EZW A;  1DKZ A;  4R5G A;  4R5K A;  5TKY A;  1DG4 A;  3D2F A;  5E84 A;  4JNF A;  3D2E A;  3T49 A;  4R5I A;  4WV7 A;  4EZT A;  2WIN M;  3T48 A;  4JWE A;  4EZY A;  3C7N B;  4F01 A;  4WV5 A;  4R5L A;  4EZR A; 
#chains in the Genus database with same CATH topology
 3QE6 A;  4H6I A;  4UDX X;  4IWQ A;  2PMR A;  3D51 A;  2F7O A;  3L3O M;  5FIG A;  3DX3 A;  3DX2 A;  1DKX A;  4E3C A;  3B52 X;  2RAI A;  2RAJ A;  2WIN M;  5C5B B;  1JQK A;  3RV1 A;  4WV5 A;  3O3O B;  2V7Y A;  4JLC A;  3ZED A;  1Q5L A;  3L3P A;  3KDR A;  2F7R A;  2OZN B;  1GN9 A;  2O0I 1;  3FD9 A;  4MQD A;  1OA1 A;  2YLA A;  4JWD A;  4M0M A;  2WYI A;  3BUP A;  4KIK B;  2Z0N A;  3LMF A;  1R33 A;  1MJG A;  3I04 A;  4EZY A;  4ATM A;  1HWW A;  3BVW A;  3BLB A;  4EZO A;  1SUF A;  4NSW A;  1E1D A;  4ILI A;  1I4D A;  2X5C A;  2Q12 A;  2BPR A;  3BVX A;  3DPO A;  4HR1 B;  4JNF A;  3T49 A;  4AZ5 A;  1WDZ A;  4JWE A;  3C7N B;  1QWU A;  3DDG A;  4IM0 A;  4WPC A;  4KIK A;  3M3W A;  4AZI A;  4H6H A;  3BUB A;  3DQG A;  3I39 X;  1X03 A;  3GI7 A;  2ND1 A;  4EZV A;  2F7Q A;  3CVR A;  3EJT A;  3CAZ A;  1OA0 A;  4R5L A;  1E2U A;  4HR1 A;  2N3K A;  4JWC A;  3ZEF A;  4EZQ A;  3DDF A;  3ER9 B;  3VKH A;  3Q84 A;  3C7N A;  2GAF D;  2JNK A;  2F18 A;  1QX1 A;  3VEB A;  2D4C A;  2YL9 A;  2LM0 A;  2V0O A;  3UIT A;  2RAK A;  3BVU A;  3HAI A;  3KAV A;  3G9G A;  3D4Z A;  2YL5 A;  3CKD A;  4IM3 A;  2QKW A;  3ERC C;  3I01 A;  1HTY A;  4NPH A;  1I4L A;  3N8E A;  4JN4 A;  1Y2O A;  4ILG A;  3SBT B;  4EZN A;  3CV5 A;  3D4Y A;  1GNL A;  2FIC A;  3LVT A;  3O3M B;  4AZH A;  3SOG A;  2D1L A;  2YIV X;  4AZ7 A;  2ND0 A;  2X3V A;  2ZXQ A;  4AKV A;  2EWF A;  1ZYL A;  2KHO A;  3Q0K A;  3EJP A;  2OBM A;  3VEA A;  1PS3 A;  2OW7 A;  3PLT A;  4AZB A;  3RPM A;  4EZR A;  4G6Q A;  4FZO A;  1W9M A;  3ABH A;  2F1A A;  2EX3 B;  5C5B A;  1OAO A;  3T46 A;  2F7P A;  4E81 A;  2MI7 A;  3EJS A;  2YI8 A;  4HYB A;  4F00 A;  3QNJ A;  4NQI A;  1TQW A;  3SBS A;  4FZS A;  4EZS A;  3RV0 A;  4AZC B;  3EJQ A;  3F7W A;  4H8S A;  3QA8 A;  2YL6 A;  2Q13 A;  4B9Q A;  1URU A;  2C08 A;  1O7D C;  3A98 A;  4I1Q A;  2OW6 A;  3O3N B;  2PY6 A;  3BVT A;  2LXY A;  4EZW A;  5TKY A;  2Z8Y A;  4WV7 A;  1TQT A;  4DYL A;  3DX4 A;  1GNT A;  2X3X A;  3BUI A;  4AZC A;  4BNE A;  7HSC A;  1SU8 A;  4IM2 A;  2ALW A;  1TQV A;  3B53 X;  4DCN C;  3T4A G;  2Z0O A;  1I49 A;  1SU6 A;  3OK8 A;  3CZN A;  4IWP A;  3T48 A;  5FLE X;  1HXK A;  2YKT A;  3OHX M;  2Z0V A;  1R34 A;  4JWI A;  3D52 A;  4AVM A;  3DX0 A;  1YWM A;  4HY9 A;  3DYT A;  4IWO A;  3BUQ A;  2ELB A;  4PO2 A;  4JNE A;  1CKR A;  2QFF A;  2EFL A;  1X04 A;  3D50 A;  3EJR A;  1YUW A;  4WPE A;  4EZP A;  4R5J A;  4FL9 A;  1O7D B;  2NCZ A;  4AZ6 A;  2YI9 A;  4R5G A;  1DG4 A;  3B51 X;  1R5E A;  5E84 A;  4D8J A;  4ILH B;  3EJU A;  3HAH A;  3ACO A;  1E9V A;  3H0X A;  4FZP A;  2F1B A;  2YIA A;  1SU7 A;  3DPP A;  1U00 A;  2JNS A;  3DOB A;  3SYV A;  1BPR A;  4EZZ A;  3QWE A;  4EZU A;  2QXL A;  3ER8 C;  2OBL A;  2GA9 D;  3D2E A;  1I4T A;  3HAJ A;  4F01 A;  3T47 A;  1TQU A;  3CZS A;  2RT6 A;  2GF4 A;  2WYH A;  1UPX A;  2FYV A;  3KAW A;  4AZG A;  3BVV A;  2OP6 A;  2YL8 A;  4IW0 A;  1DKZ A;  2OO2 A;  1QWN A;  4R5I A;  4EZT A;  1ZWW A;  2YLL A;  3OWG A;  2X3W A;  1TQS A;  3BUD A;  4EZX A;  5KBP A;  3DPQ A;  4FM3 A;  4UDY X;  4JL9 A;  3LLL A;  2EFK A;  3DX1 A;  1DKY A;  3QNI A;  4I43 A;  4R5K A;  3I2W A;  3D2F A;  2YIB A;  1LQ7 A; 
#chains in the Genus database with same CATH homology
 4H6I A;  1E2U A;  4PO2 A;  4HR1 A;  4UDX X;  4HYB A;  4F00 A;  2N3K A;  4JWC A;  4JNE A;  4EZQ A;  3ZEF A;  1CKR A;  2QFF A;  3ER9 B;  3VKH A;  4IWQ A;  3C7N A;  2GAF D;  3QNJ A;  1YUW A;  3VEB A;  3L3O M;  3SBS A;  5FIG A;  4EZP A;  4R5J A;  4FL9 A;  1DKX A;  2LM0 A;  3UIT A;  4EZS A;  4E3C A;  3RV0 A;  2NCZ A;  3KAV A;  2YI9 A;  4R5G A;  1DG4 A;  3B51 X;  3B52 X;  5E84 A;  4D8J A;  4ILH B;  3F7W A;  2WIN M;  4IM3 A;  1JQK A;  3RV1 A;  1E9V A;  3ERC C;  4WV5 A;  3I01 A;  3QA8 A;  4NPH A;  3H0X A;  3O3O B;  2V7Y A;  4JLC A;  3ZED A;  3N8E A;  2YIA A;  4B9Q A;  1SU7 A;  1Q5L A;  3DPP A;  1U00 A;  4JN4 A;  3A98 A;  3KDR A;  2JNS A;  3DOB A;  4ILG A;  3SBT B;  1GN9 A;  4EZN A;  1BPR A;  4EZZ A;  3O3N B;  2PY6 A;  4EZU A;  3FD9 A;  2QXL A;  4MQD A;  1GNL A;  1OA1 A;  4JWD A;  4M0M A;  3ER8 C;  4EZW A;  5TKY A;  2OBL A;  2GA9 D;  4KIK B;  3O3M B;  3D2E A;  2Z8Y A;  4WV7 A;  3LMF A;  1MJG A;  2YIV X;  2ND0 A;  3I04 A;  4EZY A;  4F01 A;  1GNT A;  7HSC A;  3T47 A;  2EWF A;  1ZYL A;  4EZO A;  1SU8 A;  1SUF A;  4IM2 A;  1E1D A;  2RT6 A;  3B53 X;  4ILI A;  2KHO A;  1UPX A;  2X5C A;  3KAW A;  3T4A G;  2OP6 A;  2BPR A;  3DPO A;  4IW0 A;  2OBM A;  1DKZ A;  4HR1 B;  3VEA A;  4JNF A;  1SU6 A;  3T49 A;  4R5I A;  4EZT A;  4IWP A;  3T48 A;  4JWE A;  3C7N B;  5FLE X;  3OWG A;  4EZR A;  4IM0 A;  4G6Q A;  3OHX M;  4KIK A;  4EZX A;  4H6H A;  3DPQ A;  4FM3 A;  4UDY X;  1W9M A;  4JL9 A;  3DQG A;  2EX3 B;  4JWI A;  3I39 X;  1OAO A;  3T46 A;  3GI7 A;  4HY9 A;  2ND1 A;  1DKY A;  4EZV A;  4I43 A;  4E81 A;  4IWO A;  4R5K A;  3D2F A;  2YIB A;  1OA0 A;  4R5L A;  2YI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...