4R5JA

Crystal structure of the dnak c-terminus (dnak-sbd-a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
222
structure length
218
Chain Sequence
HHHIEVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKANEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 218
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5jA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5jA01
1DKZA 3L3OM 3QNJA 4JWDA 4EZOA 4EZXA 1DG4A 3T46A 1U00A 4EZRA 4WV7A 4JNFA 4R5GA 7HSCA 4JWCA 2WINM 4WV5A 2V7YA 3DPOA 3DPPA 4JWIA 4JWEA 4R5JA 4EZWA 3DQGA 3T47A 4EZQA 4EZZA 3N8EA 3D2FA 4EZNA 4EZSA 1BPRA 3OHXM 3T48A 5E84A 3T49A 4B9QA 1CKRA 4JN4A 4R5LA 2QXLA 4F01A 4PO2A 2KHOA 4R5KA 4H6HA 4HYBA 4HY9A 4EZYA 3DOBA 3H0XA 4F00A 2BPRA 4EZTA 1Q5LA 4H6IA 1DKYA 3D2EA 4R5IA 2QFFA 4EZVA 3C7NB 4EZUA 4EZPA 3DPQA 4E81A 3T4AG 1DKXA 2OP6A 4JNEA 3C7NA 1YUWA 4FL9A 5TKYA
chains in the Genus database with same CATH superfamily
3ZEDA 4JNFA 4AZGA 1E1DA 2D4CA 1TQVA 2RT6A 4F01A 2FYVA 3DX3A 4WPEA 3O3OB 4R5IA 3BUPA 2PY6A 3O3MB 1W9MA 3QNJA 1R5EA 4WV5A 2OW6A 5FLEX 4EZWA 3CZSA 2LXYA 2YL9A 3QA8A 2N3KA 3BUDA 4EZTA 4I43A 2C08A 2F7PA 4EZVA 1GN9A 4JNEA 4IWPA 3CKDA 1O7DB 3D52A 2YIAA 1R34A 2RAKA 3EJRA 3QWEA 3T49A 2YL5A 2YI9A 3QE6A 1PS3A 1TQSA 2QXLA 2YIVX 4PO2A 3BUBA 3ER9B 3LLLA 1OA0A 2OBMA 2WYIA 2YLAA 4EZUA 1YUWA 3GI7A 3B51X 3UITA 4EZOA 4EZXA 1SU7A 3DX2A 5KBPA 7HSCA 4JLCA 4R5JA 1ZWWA 1BPRA 2X3WA 3OK8A 4AZCB 2KHOA 1WDZA 1QX1A 4AKVA 4AZ6A 2BPRA 2YL8A 2F7QA 3CV5A 4BNEA 4WPCA 3EJQA 1GNLA 4JWDA 2EX3B 2F1BA 2EWFA 4UDXX 4AVMA 3HAIA 3CZNA 4AZ7A 1CKRA 2OBLA 4H6HA 3HAHA 4AZCA 1TQTA 3I01A 1I4TA 1DKXA 3D50A 1QWUA 3I04A 4JWCA 2NCZA 3I2WA 2V7YA 2RAIA 4D8JA 3T47A 2YIBA 3BVVA 4HYBA 4ILIA 2GAFD 1Q5LA 3M3WA 1SUFA 4NPHA 3D4YA 4IWQA 4AZ5A 4EZZA 1TQUA 4HR1A 3OHXM 3BUQA 3PLTA 4F00A 1HTYA 3LMFA 3T4AG 3A98A 3RV0A 3I39X 3VEAA 1HWWA 3G9GA 1GNTA 3L3PA 4JWEA 3BVTA 4FZOA 3EJSA 2LM0A 2F7OA 3DX4A 2EFKA 1I4LA 1LQ7A 2Z0OA 1SU8A 3B52X 1HXKA 4IW0A 3C7NB 3SBSA 2Z0NA 2JNKA 2GF4A 3EJTA 3BUIA 2OO2A 4IM0A 2FICA 4MQDA 2MI7A 4JL9A 3F7WA 3KDRA 3N8EA 3DDFA 2Z0VA 2Z8YA 2Q13A 3DPQA 2X3VA 2OP6A 3C7NA 4IM2A 4G6QA 4EZRA 4IWOA 2WYHA 2F7RA 1YWMA 5FIGA 3T48A 3KAVA 2YI8A 4EZYA 3KAWA 1I49A 2QFFA 4EZPA 3BVUA 4AZHA 2ND0A 4H8SA 1Y2OA 1MJGA 2ZXQA 3DPOA 3Q0KA 2D1LA 3B53X 4JWIA 4HR1B 1OAOA 3QNIA 3ERCC 3BLBA 4M0MA 1E9VA 3DDGA 4R5LA 1SU6A 3H0XA 3ACOA 3ABHA 1I4DA 4E81A 1ZYLA 5TKYA 4UDYX 1DG4A 1URUA 4WV7A 2ALWA 4NSWA 2YL6A 2YKTA 4FL9A 3O3NB 1DKZA 3ZEFA 3L3OM 2RAJA 1U00A 1JQKA 3Q84A 3VKHA 3DQGA 4ILGA 4EZQA 1OA1A 2OZNB 2Q12A 3SOGA 4EZSA 5E84A 1O7DC 4NQIA 4B9QA 1UPXA 3EJUA 2ND1A 4DCNC 4HY9A 5C5BB 4IM3A 3VEBA 1X04A 4E3CA 2V0OA 3DYTA 3T46A 4AZBA 3D4ZA 4FM3A 3DPPA 3D2FA 3RPMA 3DX1A 2QKWA 2PMRA 3DOBA 2GA9D 4ILHB 4H6IA 3D2EA 5C5BA 1R33A 4AZIA 3OWGA 2JNSA 3HAJA 4KIKB 4I1QA 1X03A 2X5CA 2X3XA 4ATMA 2EFLA 3D51A 4JN4A 3SYVA 3FD9A 3EJPA 3LVTA 2YLLA 3CAZA 3RV1A 2ELBA 1E2UA 3BVWA 3CVRA 4R5GA 2WINM 3ER8C 2OW7A 4KIKA 3DX0A 4FZPA 4EZNA 2O0I1 2F18A 1QWNA 4R5KA 4DYLA 3SBTB 1TQWA 3BVXA 1DKYA 2F1AA 4FZSA
chains in the Genus database with same CATH topology
3ZEDA 1DKZA 3ZEFA 1GNLA 3L3OM 4JWDA 2EX3B 1U00A 4JNFA 4IM0A 1E1DA 2EWFA 4MQDA 4UDXX 1JQKA 3VKHA 4JL9A 3F7WA 3DQGA 3KDRA 4ILGA 4EZQA 1OA1A 3N8EA 4EZSA 2RT6A 5E84A 4B9QA 1CKRA 1UPXA 2ND1A 4F01A 2OBLA 4H6HA 4HY9A 2Z8YA 3O3OB 4IM3A 3I01A 4R5IA 3VEBA 2PY6A 4E3CA 3DPQA 1DKXA 3O3MB 2OP6A 3C7NA 1W9MA 4IM2A 3QNJA 3T46A 3I04A 4G6QA 4EZRA 4JWCA 2NCZA 4IWOA 4WV5A 2V7YA 4FM3A 3DPPA 5FLEX 4D8JA 4EZWA 3T47A 3D2FA 5FIGA 2YIBA 3T48A 3KAVA 3QA8A 2YI8A 4HYBA 4EZYA 2N3KA 3DOBA 2GA9D 4ILIA 3KAWA 2GAFD 4EZTA 1Q5LA 4H6IA 4I43A 4ILHB 3D2EA 4EZVA 2QFFA 1GN9A 4EZPA 1SUFA 4JNEA 4IWPA 2ND0A 3OWGA 4NPHA 1MJGA 2JNSA 2YIAA 4IWQA 4KIKB 3DPOA 4JWIA 3B53X 2X5CA 4HR1B 1OAOA 3ERCC 4EZZA 4HR1A 3OHXM 4M0MA 3T49A 1E9VA 2YI9A 4JN4A 4R5LA 2QXLA 2YIVX 4PO2A 1SU6A 3ER9B 3H0XA 4F00A 1OA0A 2OBMA 3FD9A 3LMFA 4EZUA 4E81A 3T4AG 3RV1A 1ZYLA 1YUWA 3GI7A 5TKYA 3A98A 3RV0A 3B51X 3UITA 4UDYX 4EZOA 4EZXA 1SU7A 1E2UA 1DG4A 3I39X 4WV7A 4R5GA 7HSCA 2WINM 4JLCA 3ER8C 3VEAA 4JWEA 1GNTA 4KIKA 4R5JA 4EZNA 2LM0A 1BPRA 2KHOA 4R5KA 1SU8A 3B52X 2BPRA 4IW0A 3SBTB 1DKYA 3C7NB 3SBSA 4FL9A 3O3NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKZ A;  3L3O M;  3QNJ A;  4JWD A;  4EZO A;  4EZX A;  1DG4 A;  3T46 A;  1U00 A;  4EZR A;  4WV7 A;  4JNF A;  4R5G A;  7HSC A;  4JWC A;  2WIN M;  4WV5 A;  2V7Y A;  3DPO A;  3DPP A;  4JWI A;  4JWE A;  4R5J A;  4EZW A;  3DQG A;  3T47 A;  4EZQ A;  4EZZ A;  3N8E A;  3D2F A;  4EZN A;  4EZS A;  1BPR A;  3OHX M;  3T48 A;  5E84 A;  3T49 A;  4B9Q A;  1CKR A;  4JN4 A;  4R5L A;  2QXL A;  4F01 A;  4PO2 A;  2KHO A;  4R5K A;  4H6H A;  4HYB A;  4HY9 A;  4EZY A;  3DOB A;  3H0X A;  4F00 A;  2BPR A;  4EZT A;  1Q5L A;  4H6I A;  1DKY A;  3D2E A;  4R5I A;  2QFF A;  4EZV A;  3C7N B;  4EZU A;  4EZP A;  3DPQ A;  4E81 A;  3T4A G;  1DKX A;  2OP6 A;  4JNE A;  3C7N A;  1YUW A;  4FL9 A;  5TKY A; 
#chains in the Genus database with same CATH topology
 3ZED A;  4JNF A;  4AZG A;  1E1D A;  2D4C A;  1TQV A;  2RT6 A;  4F01 A;  2FYV A;  3DX3 A;  4WPE A;  3O3O B;  4R5I A;  3BUP A;  2PY6 A;  3O3M B;  1W9M A;  3QNJ A;  1R5E A;  4WV5 A;  2OW6 A;  5FLE X;  4EZW A;  3CZS A;  2LXY A;  2YL9 A;  3QA8 A;  2N3K A;  3BUD A;  4EZT A;  4I43 A;  2C08 A;  2F7P A;  4EZV A;  1GN9 A;  4JNE A;  4IWP A;  3CKD A;  1O7D B;  3D52 A;  2YIA A;  1R34 A;  2RAK A;  3EJR A;  3QWE A;  3T49 A;  2YL5 A;  2YI9 A;  3QE6 A;  1PS3 A;  1TQS A;  2QXL A;  2YIV X;  4PO2 A;  3BUB A;  3ER9 B;  3LLL A;  1OA0 A;  2OBM A;  2WYI A;  2YLA A;  4EZU A;  1YUW A;  3GI7 A;  3B51 X;  3UIT A;  4EZO A;  4EZX A;  1SU7 A;  3DX2 A;  5KBP A;  7HSC A;  4JLC A;  4R5J A;  1ZWW A;  1BPR A;  2X3W A;  3OK8 A;  4AZC B;  2KHO A;  1WDZ A;  1QX1 A;  4AKV A;  4AZ6 A;  2BPR A;  2YL8 A;  2F7Q A;  3CV5 A;  4BNE A;  4WPC A;  3EJQ A;  1GNL A;  4JWD A;  2EX3 B;  2F1B A;  2EWF A;  4UDX X;  4AVM A;  3HAI A;  3CZN A;  4AZ7 A;  1CKR A;  2OBL A;  4H6H A;  3HAH A;  4AZC A;  1TQT A;  3I01 A;  1I4T A;  1DKX A;  3D50 A;  1QWU A;  3I04 A;  4JWC A;  2NCZ A;  3I2W A;  2V7Y A;  2RAI A;  4D8J A;  3T47 A;  2YIB A;  3BVV A;  4HYB A;  4ILI A;  2GAF D;  1Q5L A;  3M3W A;  1SUF A;  4NPH A;  3D4Y A;  4IWQ A;  4AZ5 A;  4EZZ A;  1TQU A;  4HR1 A;  3OHX M;  3BUQ A;  3PLT A;  4F00 A;  1HTY A;  3LMF A;  3T4A G;  3A98 A;  3RV0 A;  3I39 X;  3VEA A;  1HWW A;  3G9G A;  1GNT A;  3L3P A;  4JWE A;  3BVT A;  4FZO A;  3EJS A;  2LM0 A;  2F7O A;  3DX4 A;  2EFK A;  1I4L A;  1LQ7 A;  2Z0O A;  1SU8 A;  3B52 X;  1HXK A;  4IW0 A;  3C7N B;  3SBS A;  2Z0N A;  2JNK A;  2GF4 A;  3EJT A;  3BUI A;  2OO2 A;  4IM0 A;  2FIC A;  4MQD A;  2MI7 A;  4JL9 A;  3F7W A;  3KDR A;  3N8E A;  3DDF A;  2Z0V A;  2Z8Y A;  2Q13 A;  3DPQ A;  2X3V A;  2OP6 A;  3C7N A;  4IM2 A;  4G6Q A;  4EZR A;  4IWO A;  2WYH A;  2F7R A;  1YWM A;  5FIG A;  3T48 A;  3KAV A;  2YI8 A;  4EZY A;  3KAW A;  1I49 A;  2QFF A;  4EZP A;  3BVU A;  4AZH A;  2ND0 A;  4H8S A;  1Y2O A;  1MJG A;  2ZXQ A;  3DPO A;  3Q0K A;  2D1L A;  3B53 X;  4JWI A;  4HR1 B;  1OAO A;  3QNI A;  3ERC C;  3BLB A;  4M0M A;  1E9V A;  3DDG A;  4R5L A;  1SU6 A;  3H0X A;  3ACO A;  3ABH A;  1I4D A;  4E81 A;  1ZYL A;  5TKY A;  4UDY X;  1DG4 A;  1URU A;  4WV7 A;  2ALW A;  4NSW A;  2YL6 A;  2YKT A;  4FL9 A;  3O3N B;  1DKZ A;  3ZEF A;  3L3O M;  2RAJ A;  1U00 A;  1JQK A;  3Q84 A;  3VKH A;  3DQG A;  4ILG A;  4EZQ A;  1OA1 A;  2OZN B;  2Q12 A;  3SOG A;  4EZS A;  5E84 A;  1O7D C;  4NQI A;  4B9Q A;  1UPX A;  3EJU A;  2ND1 A;  4DCN C;  4HY9 A;  5C5B B;  4IM3 A;  3VEB A;  1X04 A;  4E3C A;  2V0O A;  3DYT A;  3T46 A;  4AZB A;  3D4Z A;  4FM3 A;  3DPP A;  3D2F A;  3RPM A;  3DX1 A;  2QKW A;  2PMR A;  3DOB A;  2GA9 D;  4ILH B;  4H6I A;  3D2E A;  5C5B A;  1R33 A;  4AZI A;  3OWG A;  2JNS A;  3HAJ A;  4KIK B;  4I1Q A;  1X03 A;  2X5C A;  2X3X A;  4ATM A;  2EFL A;  3D51 A;  4JN4 A;  3SYV A;  3FD9 A;  3EJP A;  3LVT A;  2YLL A;  3CAZ A;  3RV1 A;  2ELB A;  1E2U A;  3BVW A;  3CVR A;  4R5G A;  2WIN M;  3ER8 C;  2OW7 A;  4KIK A;  3DX0 A;  4FZP A;  4EZN A;  2O0I 1;  2F18 A;  1QWN A;  4R5K A;  4DYL A;  3SBT B;  1TQW A;  3BVX A;  1DKY A;  2F1A A;  4FZS A; 
#chains in the Genus database with same CATH homology
 3ZED A;  1DKZ A;  3ZEF A;  1GNL A;  3L3O M;  4JWD A;  2EX3 B;  1U00 A;  4JNF A;  4IM0 A;  1E1D A;  2EWF A;  4MQD A;  4UDX X;  1JQK A;  3VKH A;  4JL9 A;  3F7W A;  3DQG A;  3KDR A;  4ILG A;  4EZQ A;  1OA1 A;  3N8E A;  4EZS A;  2RT6 A;  5E84 A;  4B9Q A;  1CKR A;  1UPX A;  2ND1 A;  4F01 A;  2OBL A;  4H6H A;  4HY9 A;  2Z8Y A;  3O3O B;  4IM3 A;  3I01 A;  4R5I A;  3VEB A;  2PY6 A;  4E3C A;  3DPQ A;  1DKX A;  3O3M B;  2OP6 A;  3C7N A;  1W9M A;  4IM2 A;  3QNJ A;  3T46 A;  3I04 A;  4G6Q A;  4EZR A;  4JWC A;  2NCZ A;  4IWO A;  4WV5 A;  2V7Y A;  4FM3 A;  3DPP A;  5FLE X;  4D8J A;  4EZW A;  3T47 A;  3D2F A;  5FIG A;  2YIB A;  3T48 A;  3KAV A;  3QA8 A;  2YI8 A;  4HYB A;  4EZY A;  2N3K A;  3DOB A;  2GA9 D;  4ILI A;  3KAW A;  2GAF D;  4EZT A;  1Q5L A;  4H6I A;  4I43 A;  4ILH B;  3D2E A;  4EZV A;  2QFF A;  1GN9 A;  4EZP A;  1SUF A;  4JNE A;  4IWP A;  2ND0 A;  3OWG A;  4NPH A;  1MJG A;  2JNS A;  2YIA A;  4IWQ A;  4KIK B;  3DPO A;  4JWI A;  3B53 X;  2X5C A;  4HR1 B;  1OAO A;  3ERC C;  4EZZ A;  4HR1 A;  3OHX M;  4M0M A;  3T49 A;  1E9V A;  2YI9 A;  4JN4 A;  4R5L A;  2QXL A;  2YIV X;  4PO2 A;  1SU6 A;  3ER9 B;  3H0X A;  4F00 A;  1OA0 A;  2OBM A;  3FD9 A;  3LMF A;  4EZU A;  4E81 A;  3T4A G;  3RV1 A;  1ZYL A;  1YUW A;  3GI7 A;  5TKY A;  3A98 A;  3RV0 A;  3B51 X;  3UIT A;  4UDY X;  4EZO A;  4EZX A;  1SU7 A;  1E2U A;  1DG4 A;  3I39 X;  4WV7 A;  4R5G A;  7HSC A;  2WIN M;  4JLC A;  3ER8 C;  3VEA A;  4JWE A;  1GNT A;  4KIK A;  4R5J A;  4EZN A;  2LM0 A;  1BPR A;  2KHO A;  4R5K A;  1SU8 A;  3B52 X;  2BPR A;  4IW0 A;  3SBT B;  1DKY A;  3C7N B;  3SBS A;  4FL9 A;  3O3N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...