4EZSA

Crystal structure of the substrate binding domain of e.coli dnak in complex with metchnikowin (residues 20 to 26)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 65
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezsA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezsA01
4EZQA 4EZOA 1DG4A 1DKXA 5TKYA 4WV7A 1Q5LA 4H6HA 4R5KA 3L3OM 3C7NB 4JWCA 1CKRA 4EZPA 2QXLA 4HY9A 4R5IA 1DKZA 3D2EA 2WINM 3T47A 3D2FA 4F01A 2BPRA 3T46A 3DQGA 4JN4A 4JWDA 4E81A 7HSCA 1U00A 4F00A 3C7NA 4PO2A 2KHOA 1YUWA 3OHXM 2QFFA 4R5LA 2V7YA 5E84A 4EZVA 4R5JA 3T4AG 3H0XA 4WV5A 3T49A 3DPPA 4HYBA 4R5GA 3T48A 1BPRA 4EZZA 4JWIA 4EZTA 4EZXA 4EZSA 3DPQA 4JWEA 4H6IA 3DPOA 3QNJA 4EZRA 4EZWA 1DKYA 4EZYA 3DOBA 3N8EA 4JNFA 4EZUA 4FL9A 4EZNA 2OP6A 4B9QA 4JNEA
chains in the Genus database with same CATH superfamily
4IM0A 4BNEA 4DYLA 2OW6A 4R5KA 3SOGA 2ND1A 3D4YA 3DYTA 2ND0A 4EZVA 2D1LA 3CZNA 3ZEDA 3DPOA 2X5CA 2D4CA 1SUFA 1HWWA 2F7QA 2YL5A 2PY6A 3D51A 1O7DC 2RT6A 2YKTA 3CKDA 1DKXA 1Y2OA 2EFKA 2EFLA 1TQWA 3O3OB 3UITA 1SU8A 4R5JA 2OO2A 4I1QA 1BPRA 2YLLA 4I43A 1E9VA 4AZCA 4EZWA 2Q13A 2C08A 2F7PA 3BVTA 1UPXA 2FYVA 2YLAA 3BVVA 3OK8A 1CKRA 2GAFD 2X3XA 2WINM 3KAWA 2ZXQA 2GA9D 3VEAA 4JLCA 3HAJA 2V7YA 2ALWA 2QKWA 4EZRA 3DOBA 3O3NB 4EZNA 3PLTA 1R33A 1DKZA 4IWOA 3SBSA 2OBMA 7HSCA 3EJTA 4AZCB 4AZ7A 1TQVA 4IWQA 4WPEA 3QNJA 3RV1A 3D50A 3QA8A 3B51X 4EZOA 1DG4A 3GI7A 1URUA 4UDXX 2Z0OA 4HY9A 2YI8A 3BVXA 3CAZA 4NQIA 4E3CA 4AZ5A 4F00A 3ER9B 2Z8YA 4IW0A 1LQ7A 4EZZA 1QX1A 4H6IA 1TQTA 3DX4A 1Q5LA 3D4ZA 3D2EA 3D2FA 3OWGA 4DCNC 4JN4A 3FD9A 4PO2A 1YUWA 2F1BA 4JL9A 4MQDA 4R5GA 3BUQA 4AZBA 2F7OA 3I39X 1PS3A 2RAIA 3A98A 2F1AA 2Q12A 3L3OM 4JWCA 4NPHA 1OA0A 4AKVA 4AZ6A 3BVUA 1U00A 1SU6A 3B52X 5C5BA 1OA1A 2JNKA 2YI9A 3QE6A 3ERCC 4D8JA 4ILIA 4FL9A 4G6QA 2YL6A 4WPCA 1GNLA 2LM0A 1GNTA 2F18A 1HXKA 3I2WA 4R5IA 2YIAA 3BUBA 3D52A 1JQKA 1HTYA 2Z0NA 4IWPA 3C7NA 3RV0A 3EJSA 3EJRA 4KIKA 5E84A 4ILGA 3B53X 3CV5A 1I49A 2FICA 3LVTA 1MJGA 3QWEA 1E2UA 3BUDA 3SYVA 1ZYLA 2QXLA 3DDFA 5C5BB 1I4DA 3Q84A 1YWMA 4M0MA 3KDRA 3EJUA 2YIVX 4FZSA 3H0XA 2PMRA 4NSWA 3VKHA 3G9GA 4EZSA 3DPQA 1SU7A 2X3WA 2OP6A 4FM3A 5TKYA 3C7NB 2JNSA 4F01A 1W9MA 4KIKB 3KAVA 3DDGA 3DX3A 4FZOA 4HR1A 1I4TA 3EJPA 2NCZA 1OAOA 4EZTA 2N3KA 4IM2A 2EWFA 4AZIA 2EX3B 1TQSA 1X03A 4UDYX 3DQGA 2RAJA 1TQUA 3DX1A 3T49A 4HYBA 2ELBA 1DKYA 2YIBA 4B9QA 1WDZA 4ILHB 4H6HA 2X3VA 4HR1B 3BVWA 3BUPA 4WV5A 3ACOA 4JWIA 2O0I1 3DX0A 2RAKA 1ZWWA 4AVMA 4JNEA 4IM3A 3ABHA 2OBLA 1R5EA 3BUIA 2WYIA 2WYHA 4JWDA 4E81A 1QWNA 3CVRA 3OHXM 4R5LA 3O3MB 2YL8A 3T48A 2OZNB 1R34A 3M3WA 3HAHA 3SBTB 3N8EA 4AZHA 4EZQA 3ER8C 2LXYA 3L3PA 4EZPA 1I4LA 3T47A 2BPRA 4H8SA 1GN9A 2GF4A 3CZSA 3ZEFA 1E1DA 1QWUA 2QFFA 3VEBA 3QNIA 3LMFA 3HAIA 4JWEA 1X04A 4EZYA 4EZUA 3F7WA 3LLLA 3I01A 2F7RA 2MI7A 3T46A 2OW7A 3EJQA 3BLBA 2Z0VA 3DPPA 2V0OA 4ATMA 3DX2A 5FLEX 3Q0KA 2YL9A 4JNFA 5FIGA 3I04A 4AZGA 4WV7A 3RPMA 4FZPA 2KHOA 3T4AG 1O7DB 5KBPA 4EZXA
chains in the Genus database with same CATH topology
3B51X 4IM0A 1E2UA 4IM3A 4EZOA 1DG4A 3GI7A 2OBLA 4R5KA 1ZYLA 2QXLA 4UDXX 4HY9A 2YI8A 2ND1A 4M0MA 3KDRA 4JWDA 4E81A 4E3CA 2YIVX 4F00A 3ER9B 2Z8YA 3OHXM 4R5LA 3O3MB 2ND0A 4EZVA 3ZEDA 3H0XA 4IW0A 3T48A 3VKHA 4EZZA 4EZSA 3DPQA 4H6IA 1SU7A 2X5CA 3DPOA 1SUFA 3SBTB 3N8EA 2PY6A 2OP6A 2RT6A 4EZQA 3ER8C 1DKXA 4FM3A 5TKYA 1Q5LA 3C7NB 4EZPA 2JNSA 1W9MA 3D2EA 3T47A 4F01A 3D2FA 3OWGA 4KIKB 2BPRA 4JN4A 3KAVA 1GN9A 3FD9A 3O3OB 4PO2A 1YUWA 1E1DA 4HR1A 3ZEFA 2QFFA 3UITA 3VEBA 1SU8A 3LMFA 4R5JA 4JL9A 4MQDA 1BPRA 4R5GA 2NCZA 1OAOA 4EZTA 4JWEA 4I43A 1E9VA 4EZWA 4EZYA 4EZUA 3F7WA 2N3KA 3I39X 1UPXA 3I01A 4IM2A 3A98A 2EWFA 2EX3B 3L3OM 4JWCA 1CKRA 2GAFD 4NPHA 2WINM 4UDYX 3DQGA 3T46A 1OA0A 3KAWA 1U00A 2GA9D 3VEAA 1SU6A 3B52X 4JLCA 1OA1A 2V7YA 2YI9A 3ERCC 4D8JA 3T49A 3DPPA 4HYBA 4EZRA 3DOBA 5FLEX 1DKYA 3O3NB 4JNFA 5FIGA 2YIBA 4FL9A 3I04A 4EZNA 4ILIA 4B9QA 4ILHB 4G6QA 4WV7A 1GNLA 4H6HA 1GNTA 2LM0A 4HR1B 4R5IA 1DKZA 2YIAA 4IWOA 3SBSA 2OBMA 7HSCA 1JQKA 4IWPA 3C7NA 3RV0A 2KHOA 4KIKA 5E84A 3T4AG 4WV5A 4IWQA 4ILGA 3B53X 4JWIA 4EZXA 3QNJA 3RV1A 1MJGA 3QA8A 4JNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZQ A;  4EZO A;  1DG4 A;  1DKX A;  5TKY A;  4WV7 A;  1Q5L A;  4H6H A;  4R5K A;  3L3O M;  3C7N B;  4JWC A;  1CKR A;  4EZP A;  2QXL A;  4HY9 A;  4R5I A;  1DKZ A;  3D2E A;  2WIN M;  3T47 A;  3D2F A;  4F01 A;  2BPR A;  3T46 A;  3DQG A;  4JN4 A;  4JWD A;  4E81 A;  7HSC A;  1U00 A;  4F00 A;  3C7N A;  4PO2 A;  2KHO A;  1YUW A;  3OHX M;  2QFF A;  4R5L A;  2V7Y A;  5E84 A;  4EZV A;  4R5J A;  3T4A G;  3H0X A;  4WV5 A;  3T49 A;  3DPP A;  4HYB A;  4R5G A;  3T48 A;  1BPR A;  4EZZ A;  4JWI A;  4EZT A;  4EZX A;  4EZS A;  3DPQ A;  4JWE A;  4H6I A;  3DPO A;  3QNJ A;  4EZR A;  4EZW A;  1DKY A;  4EZY A;  3DOB A;  3N8E A;  4JNF A;  4EZU A;  4FL9 A;  4EZN A;  2OP6 A;  4B9Q A;  4JNE A; 
#chains in the Genus database with same CATH topology
 4IM0 A;  4BNE A;  4DYL A;  2OW6 A;  4R5K A;  3SOG A;  2ND1 A;  3D4Y A;  3DYT A;  2ND0 A;  4EZV A;  2D1L A;  3CZN A;  3ZED A;  3DPO A;  2X5C A;  2D4C A;  1SUF A;  1HWW A;  2F7Q A;  2YL5 A;  2PY6 A;  3D51 A;  1O7D C;  2RT6 A;  2YKT A;  3CKD A;  1DKX A;  1Y2O A;  2EFK A;  2EFL A;  1TQW A;  3O3O B;  3UIT A;  1SU8 A;  4R5J A;  2OO2 A;  4I1Q A;  1BPR A;  2YLL A;  4I43 A;  1E9V A;  4AZC A;  4EZW A;  2Q13 A;  2C08 A;  2F7P A;  3BVT A;  1UPX A;  2FYV A;  2YLA A;  3BVV A;  3OK8 A;  1CKR A;  2GAF D;  2X3X A;  2WIN M;  3KAW A;  2ZXQ A;  2GA9 D;  3VEA A;  4JLC A;  3HAJ A;  2V7Y A;  2ALW A;  2QKW A;  4EZR A;  3DOB A;  3O3N B;  4EZN A;  3PLT A;  1R33 A;  1DKZ A;  4IWO A;  3SBS A;  2OBM A;  7HSC A;  3EJT A;  4AZC B;  4AZ7 A;  1TQV A;  4IWQ A;  4WPE A;  3QNJ A;  3RV1 A;  3D50 A;  3QA8 A;  3B51 X;  4EZO A;  1DG4 A;  3GI7 A;  1URU A;  4UDX X;  2Z0O A;  4HY9 A;  2YI8 A;  3BVX A;  3CAZ A;  4NQI A;  4E3C A;  4AZ5 A;  4F00 A;  3ER9 B;  2Z8Y A;  4IW0 A;  1LQ7 A;  4EZZ A;  1QX1 A;  4H6I A;  1TQT A;  3DX4 A;  1Q5L A;  3D4Z A;  3D2E A;  3D2F A;  3OWG A;  4DCN C;  4JN4 A;  3FD9 A;  4PO2 A;  1YUW A;  2F1B A;  4JL9 A;  4MQD A;  4R5G A;  3BUQ A;  4AZB A;  2F7O A;  3I39 X;  1PS3 A;  2RAI A;  3A98 A;  2F1A A;  2Q12 A;  3L3O M;  4JWC A;  4NPH A;  1OA0 A;  4AKV A;  4AZ6 A;  3BVU A;  1U00 A;  1SU6 A;  3B52 X;  5C5B A;  1OA1 A;  2JNK A;  2YI9 A;  3QE6 A;  3ERC C;  4D8J A;  4ILI A;  4FL9 A;  4G6Q A;  2YL6 A;  4WPC A;  1GNL A;  2LM0 A;  1GNT A;  2F18 A;  1HXK A;  3I2W A;  4R5I A;  2YIA A;  3BUB A;  3D52 A;  1JQK A;  1HTY A;  2Z0N A;  4IWP A;  3C7N A;  3RV0 A;  3EJS A;  3EJR A;  4KIK A;  5E84 A;  4ILG A;  3B53 X;  3CV5 A;  1I49 A;  2FIC A;  3LVT A;  1MJG A;  3QWE A;  1E2U A;  3BUD A;  3SYV A;  1ZYL A;  2QXL A;  3DDF A;  5C5B B;  1I4D A;  3Q84 A;  1YWM A;  4M0M A;  3KDR A;  3EJU A;  2YIV X;  4FZS A;  3H0X A;  2PMR A;  4NSW A;  3VKH A;  3G9G A;  4EZS A;  3DPQ A;  1SU7 A;  2X3W A;  2OP6 A;  4FM3 A;  5TKY A;  3C7N B;  2JNS A;  4F01 A;  1W9M A;  4KIK B;  3KAV A;  3DDG A;  3DX3 A;  4FZO A;  4HR1 A;  1I4T A;  3EJP A;  2NCZ A;  1OAO A;  4EZT A;  2N3K A;  4IM2 A;  2EWF A;  4AZI A;  2EX3 B;  1TQS A;  1X03 A;  4UDY X;  3DQG A;  2RAJ A;  1TQU A;  3DX1 A;  3T49 A;  4HYB A;  2ELB A;  1DKY A;  2YIB A;  4B9Q A;  1WDZ A;  4ILH B;  4H6H A;  2X3V A;  4HR1 B;  3BVW A;  3BUP A;  4WV5 A;  3ACO A;  4JWI A;  2O0I 1;  3DX0 A;  2RAK A;  1ZWW A;  4AVM A;  4JNE A;  4IM3 A;  3ABH A;  2OBL A;  1R5E A;  3BUI A;  2WYI A;  2WYH A;  4JWD A;  4E81 A;  1QWN A;  3CVR A;  3OHX M;  4R5L A;  3O3M B;  2YL8 A;  3T48 A;  2OZN B;  1R34 A;  3M3W A;  3HAH A;  3SBT B;  3N8E A;  4AZH A;  4EZQ A;  3ER8 C;  2LXY A;  3L3P A;  4EZP A;  1I4L A;  3T47 A;  2BPR A;  4H8S A;  1GN9 A;  2GF4 A;  3CZS A;  3ZEF A;  1E1D A;  1QWU A;  2QFF A;  3VEB A;  3QNI A;  3LMF A;  3HAI A;  4JWE A;  1X04 A;  4EZY A;  4EZU A;  3F7W A;  3LLL A;  3I01 A;  2F7R A;  2MI7 A;  3T46 A;  2OW7 A;  3EJQ A;  3BLB A;  2Z0V A;  3DPP A;  2V0O A;  4ATM A;  3DX2 A;  5FLE X;  3Q0K A;  2YL9 A;  4JNF A;  5FIG A;  3I04 A;  4AZG A;  4WV7 A;  3RPM A;  4FZP A;  2KHO A;  3T4A G;  1O7D B;  5KBP A;  4EZX A; 
#chains in the Genus database with same CATH homology
 3B51 X;  4IM0 A;  1E2U A;  4IM3 A;  4EZO A;  1DG4 A;  3GI7 A;  2OBL A;  4R5K A;  1ZYL A;  2QXL A;  4UDX X;  4HY9 A;  2YI8 A;  2ND1 A;  4M0M A;  3KDR A;  4JWD A;  4E81 A;  4E3C A;  2YIV X;  4F00 A;  3ER9 B;  2Z8Y A;  3OHX M;  4R5L A;  3O3M B;  2ND0 A;  4EZV A;  3ZED A;  3H0X A;  4IW0 A;  3T48 A;  3VKH A;  4EZZ A;  4EZS A;  3DPQ A;  4H6I A;  1SU7 A;  2X5C A;  3DPO A;  1SUF A;  3SBT B;  3N8E A;  2PY6 A;  2OP6 A;  2RT6 A;  4EZQ A;  3ER8 C;  1DKX A;  4FM3 A;  5TKY A;  1Q5L A;  3C7N B;  4EZP A;  2JNS A;  1W9M A;  3D2E A;  3T47 A;  4F01 A;  3D2F A;  3OWG A;  4KIK B;  2BPR A;  4JN4 A;  3KAV A;  1GN9 A;  3FD9 A;  3O3O B;  4PO2 A;  1YUW A;  1E1D A;  4HR1 A;  3ZEF A;  2QFF A;  3UIT A;  3VEB A;  1SU8 A;  3LMF A;  4R5J A;  4JL9 A;  4MQD A;  1BPR A;  4R5G A;  2NCZ A;  1OAO A;  4EZT A;  4JWE A;  4I43 A;  1E9V A;  4EZW A;  4EZY A;  4EZU A;  3F7W A;  2N3K A;  3I39 X;  1UPX A;  3I01 A;  4IM2 A;  3A98 A;  2EWF A;  2EX3 B;  3L3O M;  4JWC A;  1CKR A;  2GAF D;  4NPH A;  2WIN M;  4UDY X;  3DQG A;  3T46 A;  1OA0 A;  3KAW A;  1U00 A;  2GA9 D;  3VEA A;  1SU6 A;  3B52 X;  4JLC A;  1OA1 A;  2V7Y A;  2YI9 A;  3ERC C;  4D8J A;  3T49 A;  3DPP A;  4HYB A;  4EZR A;  3DOB A;  5FLE X;  1DKY A;  3O3N B;  4JNF A;  5FIG A;  2YIB A;  4FL9 A;  3I04 A;  4EZN A;  4ILI A;  4B9Q A;  4ILH B;  4G6Q A;  4WV7 A;  1GNL A;  4H6H A;  1GNT A;  2LM0 A;  4HR1 B;  4R5I A;  1DKZ A;  2YIA A;  4IWO A;  3SBS A;  2OBM A;  7HSC A;  1JQK A;  4IWP A;  3C7N A;  3RV0 A;  2KHO A;  4KIK A;  5E84 A;  3T4A G;  4WV5 A;  4IWQ A;  4ILG A;  3B53 X;  4JWI A;  4EZX A;  3QNJ A;  3RV1 A;  1MJG A;  3QA8 A;  4JNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...