4EZSA

Crystal structure of the substrate binding domain of e.coli dnak in complex with metchnikowin (residues 20 to 26)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
total genus 65
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezsA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezsA01
2KHOA 4EZTA 3D2FA 2BPRA 3T47A 4R5IA 4JWEA 4E81A 3DQGA 4R5LA 4JNFA 3T46A 3C7NA 3T4AG 3OHXM 3QNJA 3N8EA 3H0XA 4JWCA 3DPQA 4JN4A 4EZPA 4JWIA 1CKRA 4H6IA 4H6HA 4B9QA 4PO2A 2QFFA 4EZXA 4F00A 1BPRA 2QXLA 4WV7A 7HSCA 4R5JA 5TKYA 1Q5LA 4EZUA 4EZYA 4EZSA 2WINM 3DPPA 3DOBA 1DKYA 3T48A 1DKXA 4EZRA 4R5KA 3D2EA 1YUWA 4FL9A 4EZNA 4EZWA 4EZVA 3C7NB 1U00A 5E84A 4EZQA 2OP6A 2V7YA 3DPOA 4F01A 4WV5A 4HY9A 4EZZA 3T49A 3L3OM 4JWDA 4JNEA 1DG4A 4HYBA 1DKZA 4R5GA 4EZOA
chains in the Genus database with same CATH superfamily
3QE6A 1LQ7A 3DQGA 4MQDA 3LVTA 3QNIA 4JNFA 3KAWA 2OW6A 1I49A 4IW0A 1TQSA 3HAJA 3UITA 4R5JA 4FZPA 4EZSA 2Q13A 4ILIA 4AZHA 2ND0A 1U00A 4EZQA 2GA9D 3O3OB 3O3MB 4HYBA 3EJUA 2GF4A 3VEAA 3B53X 3OHXM 3N8EA 3SOGA 4D8JA 4AZBA 3EJPA 3ACOA 3D2EA 2C08A 3BVWA 2X3WA 3ZEDA 2Z0VA 2EFKA 2Z8YA 3OWGA 2ZXQA 3EJTA 1GNTA 4AZCB 1JQKA 3EJQA 2QFFA 1O7DC 4FZSA 1Q5LA 4EZUA 4EZYA 4NQIA 3D51A 3DOBA 2F1AA 2YL6A 1E9VA 2F7PA 3DX3A 4R5GA 3D2FA 4DCNC 4AZ7A 4NSWA 1PS3A 2F7RA 4R5LA 3VEBA 3C7NA 3DX4A 2D1LA 1GNLA 2YL5A 4JN4A 1I4DA 4B9QA 2YLAA 4F00A 2Z0OA 3DDFA 1YWMA 3D4YA 3ER8C 4JLCA 3BUBA 1X03A 3I2WA 3ERCC 3QWEA 3CV5A 3I04A 2QXLA 1Y2OA 2N3KA 1O7DB 3DX1A 4PO2A 4IWOA 7HSCA 3ZEFA 3RV1A 3D50A 2OP6A 2YIAA 1I4TA 2RAKA 4F01A 3A98A 1OA1A 3BUIA 2LM0A 4ILHB 3RV0A 4EZTA 4KIKB 4E81A 3RPMA 2EX3B 1E2UA 2OO2A 1ZYLA 2MI7A 4HR1A 5FLEX 4AKVA 3PLTA 4WV5A 4EZZA 4EZOA 2GAFD 4FZOA 3BUPA 4H8SA 1WDZA 3BUQA 3DPQA 3CAZA 3KDRA 1MJGA 1I4LA 3HAHA 1DKYA 3T48A 3FD9A 4AZ5A 4AVMA 1E1DA 2LXYA 2F7OA 4JWDA 5C5BA 1R34A 3SBSA 1UPXA 2JNSA 2F7QA 2OBMA 2YIVX 1R33A 3OK8A 2F18A 2YL8A 1QWNA 5E84A 4E3CA 4I1QA 3VKHA 4JNEA 2RAJA 1SU8A 4DYLA 4ILGA 4FM3A 2EWFA 5FIGA 2V0OA 3GI7A 3QA8A 4H6HA 2YL9A 2QKWA 3ABHA 1TQWA 3B51X 2BPRA 1HWWA 2WYIA 3T47A 3F7WA 2X5CA 2Z0NA 3DDGA 3H0XA 4JWIA 1HTYA 1X04A 3EJRA 2FYVA 1DKXA 2JNKA 4R5KA 3SYVA 4EZVA 4G6QA 3LLLA 1SUFA 4JWEA 2F1BA 3T4AG 2O0I1 4JWCA 3O3NB 3BLBA 2FICA 4AZ6A 4NPHA 4I43A 1R5EA 3G9GA 3C7NB 4AZCA 3ER9B 4UDYX 2YIBA 3CZNA 2WYHA 3HAIA 1URUA 3T46A 2Q12A 2YI8A 1CKRA 2PY6A 1W9MA 3DPPA 2D4CA 3D52A 2V7YA 4WPCA 2X3XA 2NCZA 1HXKA 4UDXX 1OAOA 2ELBA 3QNJA 1QWUA 2OW7A 2PMRA 4H6IA 3B52X 1BPRA 4JL9A 5TKYA 3CZSA 3Q0KA 4EZRA 4EZNA 2RAIA 1DG4A 4HR1B 3I39X 2EFLA 2KHOA 4IWPA 3KAVA 4AZIA 3BUDA 3Q84A 3BVTA 3D4ZA 1ZWWA 1SU6A 1SU7A 1QX1A 1GN9A 4KIKA 2ALWA 4ATMA 1YUWA 4FL9A 2YLLA 4EZWA 1OA0A 3M3WA 3DPOA 5KBPA 4HY9A 1TQUA 3L3OM 3SBTB 3BVXA 3DYTA 3L3PA 4AZGA 3I01A 3BVUA 4EZPA 2RT6A 4BNEA 3CKDA 4EZXA 5C5BB 2WINM 4IM2A 3BVVA 4WPEA 3CVRA 1DKZA 3T49A 2X3VA 4WV7A 2OBLA 4IWQA 4R5IA 2YI9A 2ND1A 1TQTA 3LMFA 2OZNB 4IM0A 1TQVA 3EJSA 3DX2A 3DX0A 4IM3A 4M0MA 2YKTA
chains in the Genus database with same CATH topology
4FM3A 2NCZA 4UDXX 2EWFA 3DQGA 4MQDA 1OAOA 4JNFA 3KAWA 3QNJA 2N3KA 5FIGA 3GI7A 3QA8A 4IW0A 4H6IA 3B52X 4H6HA 3UITA 4PO2A 1BPRA 4IWOA 4JL9A 4R5JA 5TKYA 7HSCA 4EZSA 4EZRA 3ZEFA 3RV1A 4EZNA 4ILIA 2ND0A 1U00A 2OP6A 4EZQA 2YIAA 4F01A 2GA9D 3A98A 1OA1A 3O3OB 2LM0A 3O3MB 3B51X 3I39X 4HR1B 4HYBA 4ILHB 1DG4A 2KHOA 4IWPA 3RV0A 4EZTA 4KIKB 2BPRA 3KAVA 3T47A 4E81A 3F7WA 3VEAA 2EX3B 1E2UA 2X5CA 1ZYLA 3B53X 3OHXM 3N8EA 3H0XA 4JWIA 4D8JA 4HR1A 5FLEX 1SU7A 1SU6A 1GN9A 4KIKA 1DKXA 4R5KA 3D2EA 1YUWA 4FL9A 4EZWA 1OA0A 4EZVA 3ZEDA 4G6QA 3DPOA 4WV5A 4HY9A 4EZZA 3SBTB 3L3OM 2Z8YA 4EZOA 2GAFD 3OWGA 1SUFA 4JWEA 3I01A 3T4AG 1GNTA 4JWCA 1JQKA 3DPQA 3O3NB 4EZPA 2RT6A 3KDRA 2QFFA 4EZXA 1MJGA 1Q5LA 4EZUA 4EZYA 2WINM 4IM2A 3DOBA 1DKYA 3T48A 3FD9A 4NPHA 4I43A 1E1DA 1E9VA 3C7NB 4JWDA 1DKZA 3ER9B 4R5GA 3T49A 4WV7A 3SBSA 4UDYX 3D2FA 2OBLA 2YIBA 4IWQA 4R5IA 1UPXA 3VEBA 4R5LA 2JNSA 2YI9A 3T46A 2ND1A 3C7NA 3LMFA 2YI8A 1GNLA 4JN4A 2OBMA 4IM0A 1CKRA 4B9QA 4F00A 2PY6A 2YIVX 1W9MA 3DPPA 4IM3A 3ER8C 5E84A 4E3CA 2V7YA 3VKHA 4JLCA 4JNEA 4M0MA 3ERCC 3I04A 1SU8A 2QXLA 4ILGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHO A;  4EZT A;  3D2F A;  2BPR A;  3T47 A;  4R5I A;  4JWE A;  4E81 A;  3DQG A;  4R5L A;  4JNF A;  3T46 A;  3C7N A;  3T4A G;  3OHX M;  3QNJ A;  3N8E A;  3H0X A;  4JWC A;  3DPQ A;  4JN4 A;  4EZP A;  4JWI A;  1CKR A;  4H6I A;  4H6H A;  4B9Q A;  4PO2 A;  2QFF A;  4EZX A;  4F00 A;  1BPR A;  2QXL A;  4WV7 A;  7HSC A;  4R5J A;  5TKY A;  1Q5L A;  4EZU A;  4EZY A;  4EZS A;  2WIN M;  3DPP A;  3DOB A;  1DKY A;  3T48 A;  1DKX A;  4EZR A;  4R5K A;  3D2E A;  1YUW A;  4FL9 A;  4EZN A;  4EZW A;  4EZV A;  3C7N B;  1U00 A;  5E84 A;  4EZQ A;  2OP6 A;  2V7Y A;  3DPO A;  4F01 A;  4WV5 A;  4HY9 A;  4EZZ A;  3T49 A;  3L3O M;  4JWD A;  4JNE A;  1DG4 A;  4HYB A;  1DKZ A;  4R5G A;  4EZO A; 
#chains in the Genus database with same CATH topology
 3QE6 A;  1LQ7 A;  3DQG A;  4MQD A;  3LVT A;  3QNI A;  4JNF A;  3KAW A;  2OW6 A;  1I49 A;  4IW0 A;  1TQS A;  3HAJ A;  3UIT A;  4R5J A;  4FZP A;  4EZS A;  2Q13 A;  4ILI A;  4AZH A;  2ND0 A;  1U00 A;  4EZQ A;  2GA9 D;  3O3O B;  3O3M B;  4HYB A;  3EJU A;  2GF4 A;  3VEA A;  3B53 X;  3OHX M;  3N8E A;  3SOG A;  4D8J A;  4AZB A;  3EJP A;  3ACO A;  3D2E A;  2C08 A;  3BVW A;  2X3W A;  3ZED A;  2Z0V A;  2EFK A;  2Z8Y A;  3OWG A;  2ZXQ A;  3EJT A;  1GNT A;  4AZC B;  1JQK A;  3EJQ A;  2QFF A;  1O7D C;  4FZS A;  1Q5L A;  4EZU A;  4EZY A;  4NQI A;  3D51 A;  3DOB A;  2F1A A;  2YL6 A;  1E9V A;  2F7P A;  3DX3 A;  4R5G A;  3D2F A;  4DCN C;  4AZ7 A;  4NSW A;  1PS3 A;  2F7R A;  4R5L A;  3VEB A;  3C7N A;  3DX4 A;  2D1L A;  1GNL A;  2YL5 A;  4JN4 A;  1I4D A;  4B9Q A;  2YLA A;  4F00 A;  2Z0O A;  3DDF A;  1YWM A;  3D4Y A;  3ER8 C;  4JLC A;  3BUB A;  1X03 A;  3I2W A;  3ERC C;  3QWE A;  3CV5 A;  3I04 A;  2QXL A;  1Y2O A;  2N3K A;  1O7D B;  3DX1 A;  4PO2 A;  4IWO A;  7HSC A;  3ZEF A;  3RV1 A;  3D50 A;  2OP6 A;  2YIA A;  1I4T A;  2RAK A;  4F01 A;  3A98 A;  1OA1 A;  3BUI A;  2LM0 A;  4ILH B;  3RV0 A;  4EZT A;  4KIK B;  4E81 A;  3RPM A;  2EX3 B;  1E2U A;  2OO2 A;  1ZYL A;  2MI7 A;  4HR1 A;  5FLE X;  4AKV A;  3PLT A;  4WV5 A;  4EZZ A;  4EZO A;  2GAF D;  4FZO A;  3BUP A;  4H8S A;  1WDZ A;  3BUQ A;  3DPQ A;  3CAZ A;  3KDR A;  1MJG A;  1I4L A;  3HAH A;  1DKY A;  3T48 A;  3FD9 A;  4AZ5 A;  4AVM A;  1E1D A;  2LXY A;  2F7O A;  4JWD A;  5C5B A;  1R34 A;  3SBS A;  1UPX A;  2JNS A;  2F7Q A;  2OBM A;  2YIV X;  1R33 A;  3OK8 A;  2F18 A;  2YL8 A;  1QWN A;  5E84 A;  4E3C A;  4I1Q A;  3VKH A;  4JNE A;  2RAJ A;  1SU8 A;  4DYL A;  4ILG A;  4FM3 A;  2EWF A;  5FIG A;  2V0O A;  3GI7 A;  3QA8 A;  4H6H A;  2YL9 A;  2QKW A;  3ABH A;  1TQW A;  3B51 X;  2BPR A;  1HWW A;  2WYI A;  3T47 A;  3F7W A;  2X5C A;  2Z0N A;  3DDG A;  3H0X A;  4JWI A;  1HTY A;  1X04 A;  3EJR A;  2FYV A;  1DKX A;  2JNK A;  4R5K A;  3SYV A;  4EZV A;  4G6Q A;  3LLL A;  1SUF A;  4JWE A;  2F1B A;  3T4A G;  2O0I 1;  4JWC A;  3O3N B;  3BLB A;  2FIC A;  4AZ6 A;  4NPH A;  4I43 A;  1R5E A;  3G9G A;  3C7N B;  4AZC A;  3ER9 B;  4UDY X;  2YIB A;  3CZN A;  2WYH A;  3HAI A;  1URU A;  3T46 A;  2Q12 A;  2YI8 A;  1CKR A;  2PY6 A;  1W9M A;  3DPP A;  2D4C A;  3D52 A;  2V7Y A;  4WPC A;  2X3X A;  2NCZ A;  1HXK A;  4UDX X;  1OAO A;  2ELB A;  3QNJ A;  1QWU A;  2OW7 A;  2PMR A;  4H6I A;  3B52 X;  1BPR A;  4JL9 A;  5TKY A;  3CZS A;  3Q0K A;  4EZR A;  4EZN A;  2RAI A;  1DG4 A;  4HR1 B;  3I39 X;  2EFL A;  2KHO A;  4IWP A;  3KAV A;  4AZI A;  3BUD A;  3Q84 A;  3BVT A;  3D4Z A;  1ZWW A;  1SU6 A;  1SU7 A;  1QX1 A;  1GN9 A;  4KIK A;  2ALW A;  4ATM A;  1YUW A;  4FL9 A;  2YLL A;  4EZW A;  1OA0 A;  3M3W A;  3DPO A;  5KBP A;  4HY9 A;  1TQU A;  3L3O M;  3SBT B;  3BVX A;  3DYT A;  3L3P A;  4AZG A;  3I01 A;  3BVU A;  4EZP A;  2RT6 A;  4BNE A;  3CKD A;  4EZX A;  5C5B B;  2WIN M;  4IM2 A;  3BVV A;  4WPE A;  3CVR A;  1DKZ A;  3T49 A;  2X3V A;  4WV7 A;  2OBL A;  4IWQ A;  4R5I A;  2YI9 A;  2ND1 A;  1TQT A;  3LMF A;  2OZN B;  4IM0 A;  1TQV A;  3EJS A;  3DX2 A;  3DX0 A;  4IM3 A;  4M0M A;  2YKT A; 
#chains in the Genus database with same CATH homology
 4FM3 A;  2NCZ A;  4UDX X;  2EWF A;  3DQG A;  4MQD A;  1OAO A;  4JNF A;  3KAW A;  3QNJ A;  2N3K A;  5FIG A;  3GI7 A;  3QA8 A;  4IW0 A;  4H6I A;  3B52 X;  4H6H A;  3UIT A;  4PO2 A;  1BPR A;  4IWO A;  4JL9 A;  4R5J A;  5TKY A;  7HSC A;  4EZS A;  4EZR A;  3ZEF A;  3RV1 A;  4EZN A;  4ILI A;  2ND0 A;  1U00 A;  2OP6 A;  4EZQ A;  2YIA A;  4F01 A;  2GA9 D;  3A98 A;  1OA1 A;  3O3O B;  2LM0 A;  3O3M B;  3B51 X;  3I39 X;  4HR1 B;  4HYB A;  4ILH B;  1DG4 A;  2KHO A;  4IWP A;  3RV0 A;  4EZT A;  4KIK B;  2BPR A;  3KAV A;  3T47 A;  4E81 A;  3F7W A;  3VEA A;  2EX3 B;  1E2U A;  2X5C A;  1ZYL A;  3B53 X;  3OHX M;  3N8E A;  3H0X A;  4JWI A;  4D8J A;  4HR1 A;  5FLE X;  1SU7 A;  1SU6 A;  1GN9 A;  4KIK A;  1DKX A;  4R5K A;  3D2E A;  1YUW A;  4FL9 A;  4EZW A;  1OA0 A;  4EZV A;  3ZED A;  4G6Q A;  3DPO A;  4WV5 A;  4HY9 A;  4EZZ A;  3SBT B;  3L3O M;  2Z8Y A;  4EZO A;  2GAF D;  3OWG A;  1SUF A;  4JWE A;  3I01 A;  3T4A G;  1GNT A;  4JWC A;  1JQK A;  3DPQ A;  3O3N B;  4EZP A;  2RT6 A;  3KDR A;  2QFF A;  4EZX A;  1MJG A;  1Q5L A;  4EZU A;  4EZY A;  2WIN M;  4IM2 A;  3DOB A;  1DKY A;  3T48 A;  3FD9 A;  4NPH A;  4I43 A;  1E1D A;  1E9V A;  3C7N B;  4JWD A;  1DKZ A;  3ER9 B;  4R5G A;  3T49 A;  4WV7 A;  3SBS A;  4UDY X;  3D2F A;  2OBL A;  2YIB A;  4IWQ A;  4R5I A;  1UPX A;  3VEB A;  4R5L A;  2JNS A;  2YI9 A;  3T46 A;  2ND1 A;  3C7N A;  3LMF A;  2YI8 A;  1GNL A;  4JN4 A;  2OBM A;  4IM0 A;  1CKR A;  4B9Q A;  4F00 A;  2PY6 A;  2YIV X;  1W9M A;  3DPP A;  4IM3 A;  3ER8 C;  5E84 A;  4E3C A;  2V7Y A;  3VKH A;  4JLC A;  4JNE A;  4M0M A;  3ERC C;  3I04 A;  1SU8 A;  2QXL A;  4ILG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...