4EZSA

Crystal structure of the substrate binding domain of e.coli dnak in complex with metchnikowin (residues 20 to 26)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
b'VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 65
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezsA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezsA01
1U00A 3T4AG 4R5LA 4JNFA 4WV5A 4JNEA 3D2EA 4R5IA 7HSCA 4R5JA 4E81A 4EZXA 2QFFA 4R5KA 4EZZA 3QNJA 3DPPA 4JWDA 4EZNA 4EZTA 3N8EA 1YUWA 4JWCA 2BPRA 1DG4A 3D2FA 4WV7A 4F00A 3T49A 1CKRA 4H6HA 4HY9A 3L3OM 4EZOA 2QXLA 4EZVA 3DOBA 3OHXM 2V7YA 4FL9A 4EZUA 4B9QA 2OP6A 1DKXA 4F01A 3T47A 4JWIA 5E84A 3C7NA 1DKZA 4EZPA 4EZSA 1Q5LA 4EZQA 3DPQA 4EZRA 3H0XA 3DPOA 3DQGA 1BPRA 3T48A 2WINM 4HYBA 5TKYA 4JWEA 4EZYA 2KHOA 4H6IA 4JN4A 4EZWA 4PO2A 4R5GA 3C7NB 3T46A 1DKYA
chains in the Genus database with same CATH superfamily
4ILIA 1E2UA 2ZXQA 3BUDA 4JWCA 4AZCA 5FLEX 1CKRA 2YL9A 4EZVA 2GF4A 2YIAA 3ZEFA 2GAFD 3B53X 2ALWA 2X3WA 2D1LA 3C7NB 1DKYA 3T4AG 4WV5A 1R34A 4R5KA 2PMRA 3HAJA 1DG4A 2F1AA 4G6QA 5C5BB 4AZ6A 3BVTA 2YIBA 3RPMA 3QA8A 1W9MA 1URUA 2QKWA 3ER8C 3I01A 2YLLA 2EFKA 3VKHA 2YI9A 3D50A 3CAZA 1I4TA 4JLCA 3DPPA 3DYTA 3ABHA 4AZBA 3BUIA 3DOBA 3LMFA 1DKZA 4AZ5A 3DPQA 3HAHA 4AVMA 3O3OB 2PY6A 3T49A 3M3WA 1HTYA 2OW6A 3PLTA 2JNKA 1SU7A 4WPEA 2V0OA 3CZNA 2F18A 3LLLA 3DX3A 3BUQA 2Z0VA 3EJRA 3DQGA 3I2WA 4H6IA 1TQWA 2WYIA 3CVRA 1R5EA 3ERCC 4NQIA 3GI7A 3BVWA 1OA1A 2ND0A 3D52A 4IWQA 3A98A 3BVXA 3ACOA 2YKTA 1JQKA 4B9QA 3DDGA 3C7NA 2NCZA 4JWEA 2C08A 3EJSA 5C5BA 4EZXA 2Q12A 3ZEDA 1QWUA 2EX3B 2OW7A 4FL9A 2V7YA 5KBPA 2YI8A 3DX4A 3D4ZA 2MI7A 2YL6A 3KAWA 2WINM 3D4YA 3QE6A 3RV1A 1TQVA 3BUPA 4FZOA 4AKVA 1TQTA 4JWDA 1TQSA 4IM3A 4F00A 1SU6A 3L3OM 2D4CA 4IM0A 2YL5A 4EZRA 3DPOA 1BPRA 3SOGA 1I4DA 4JL9A 3CZSA 1U00A 4KIKB 2OBLA 2F7PA 4ILGA 3DDFA 1TQUA 2F7QA 3EJUA 2EFLA 2JNSA 4WV7A 4DCNC 1E9VA 4IWOA 3I39X 5TKYA 2KHOA 3BUBA 4UDXX 1ZWWA 4BNEA 3BVUA 4E81A 1LQ7A 1E1DA 3Q84A 3RV0A 1GN9A 4HY9A 1WDZA 3OWGA 4HR1B 4NPHA 4UDYX 3VEBA 3EJTA 1Q5LA 3B51X 3FD9A 3OK8A 3SBTB 2YIVX 3DX0A 4DYLA 1GNTA 2YLAA 4EZZA 3N8EA 2ELBA 3BVVA 4NSWA 3OHXM 3Q0KA 1DKXA 3QWEA 4JWIA 3QNIA 4EZSA 4JN4A 4JNEA 2WYHA 2RAIA 1GNLA 2FYVA 3I04A 2F7OA 1UPXA 4EZNA 1YWMA 4AZ7A 1HXKA 1HWWA 1PS3A 4EZUA 4F01A 1O7DB 2Q13A 2N3KA 1OA0A 4KIKA 1OAOA 3T48A 2RAJA 4IWPA 4R5GA 4D8JA 2Z8YA 4M0MA 4R5LA 2X5CA 4IM2A 2LM0A 3HAIA 4R5JA 4WPCA 3KAVA 2YL8A 3UITA 3D51A 3T47A 3DX2A 2RAKA 3F7WA 3EJPA 4FZPA 2EWFA 1ZYLA 2GA9D 4H8SA 3SBSA 2Z0OA 4JNFA 2FICA 3EJQA 4ATMA 3O3NB 3QNJA 4EZTA 1YUWA 2BPRA 3LVTA 4MQDA 4HR1A 2F7RA 3CV5A 4AZCB 2X3XA 1MJGA 4FM3A 4EZPA 3VEAA 4HYBA 2LXYA 4EZYA 3H0XA 3D2EA 3DX1A 5FIGA 7HSCA 2ND1A 4ILHB 4IW0A 1SUFA 1Y2OA 1QWNA 3SYVA 1I4LA 2OP6A 4I1QA 4FZSA 2OO2A 2RT6A 1X03A 4EZWA 1X04A 1SU8A 2X3VA 3O3MB 3KDRA 2QFFA 1R33A 3G9GA 1O7DC 3D2FA 2OBMA 2OZNB 2QXLA 4I43A 3CKDA 1I49A 4AZGA 3L3PA 4AZHA 2Z0NA 4PO2A 3B52X 1QX1A 4R5IA 4H6HA 4EZOA 2O0I1 3ER9B 2F1BA 4AZIA 5E84A 4E3CA 4EZQA 3BLBA 3T46A
chains in the Genus database with same CATH topology
4UDXX 3SBSA 4JNFA 3ERCC 4ILIA 4E81A 3GI7A 1E1DA 3O3NB 3QNJA 1E2UA 4EZTA 1YUWA 4JWCA 2BPRA 1OA1A 2ND0A 4IWQA 4MQDA 3A98A 4HR1A 5FLEX 3RV0A 1CKRA 1GN9A 4HY9A 4EZVA 1JQKA 4B9QA 2YIAA 3OWGA 4HR1B 4NPHA 4UDYX 3C7NA 1MJGA 3VEBA 3ZEFA 4FM3A 4EZPA 1Q5LA 2NCZA 2GAFD 3B53X 3VEAA 4HYBA 3B51X 4JWEA 3FD9A 4EZYA 3C7NB 3SBTB 2YIVX 3H0XA 1DKYA 3T4AG 4WV5A 3D2EA 5FIGA 7HSCA 1GNTA 4EZXA 4R5KA 2ND1A 4EZZA 1DG4A 3N8EA 4ILHB 4IW0A 4G6QA 3ZEDA 1SUFA 2EX3B 3OHXM 2V7YA 4FL9A 2OP6A 1DKXA 2YI8A 2YIBA 4JWIA 3QA8A 3KAWA 1W9MA 4EZSA 2RT6A 2WINM 4JN4A 4EZWA 3ER8C 1SU8A 3I01A 3RV1A 3O3MB 4JNEA 3VKHA 1GNLA 2YI9A 3KDRA 3I04A 2QFFA 4JLCA 1UPXA 3DPPA 4JWDA 4EZNA 4IM3A 3D2FA 2OBMA 4F00A 1SU6A 3L3OM 2QXLA 4IM0A 3DOBA 3LMFA 4EZUA 4F01A 4I43A 2N3KA 1DKZA 3DPQA 1OA0A 4EZRA 3DPOA 4KIKA 1OAOA 3T48A 4PO2A 1BPRA 4IWPA 4R5GA 3O3OB 4D8JA 3B52X 2Z8YA 2PY6A 4JL9A 4M0MA 1U00A 4KIKB 3T49A 4R5LA 2X5CA 4IM2A 2LM0A 2OBLA 4R5IA 4R5JA 4ILGA 3KAVA 3UITA 2JNSA 1SU7A 4WV7A 4H6HA 4EZOA 3ER9B 3T47A 1E9VA 5E84A 4IWOA 4E3CA 4EZQA 3F7WA 3DQGA 2EWFA 3I39X 5TKYA 2KHOA 4H6IA 1ZYLA 2GA9D 3T46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U00 A;  3T4A G;  4R5L A;  4JNF A;  4WV5 A;  4JNE A;  3D2E A;  4R5I A;  7HSC A;  4R5J A;  4E81 A;  4EZX A;  2QFF A;  4R5K A;  4EZZ A;  3QNJ A;  3DPP A;  4JWD A;  4EZN A;  4EZT A;  3N8E A;  1YUW A;  4JWC A;  2BPR A;  1DG4 A;  3D2F A;  4WV7 A;  4F00 A;  3T49 A;  1CKR A;  4H6H A;  4HY9 A;  3L3O M;  4EZO A;  2QXL A;  4EZV A;  3DOB A;  3OHX M;  2V7Y A;  4FL9 A;  4EZU A;  4B9Q A;  2OP6 A;  1DKX A;  4F01 A;  3T47 A;  4JWI A;  5E84 A;  3C7N A;  1DKZ A;  4EZP A;  4EZS A;  1Q5L A;  4EZQ A;  3DPQ A;  4EZR A;  3H0X A;  3DPO A;  3DQG A;  1BPR A;  3T48 A;  2WIN M;  4HYB A;  5TKY A;  4JWE A;  4EZY A;  2KHO A;  4H6I A;  4JN4 A;  4EZW A;  4PO2 A;  4R5G A;  3C7N B;  3T46 A;  1DKY A; 
#chains in the Genus database with same CATH topology
 4ILI A;  1E2U A;  2ZXQ A;  3BUD A;  4JWC A;  4AZC A;  5FLE X;  1CKR A;  2YL9 A;  4EZV A;  2GF4 A;  2YIA A;  3ZEF A;  2GAF D;  3B53 X;  2ALW A;  2X3W A;  2D1L A;  3C7N B;  1DKY A;  3T4A G;  4WV5 A;  1R34 A;  4R5K A;  2PMR A;  3HAJ A;  1DG4 A;  2F1A A;  4G6Q A;  5C5B B;  4AZ6 A;  3BVT A;  2YIB A;  3RPM A;  3QA8 A;  1W9M A;  1URU A;  2QKW A;  3ER8 C;  3I01 A;  2YLL A;  2EFK A;  3VKH A;  2YI9 A;  3D50 A;  3CAZ A;  1I4T A;  4JLC A;  3DPP A;  3DYT A;  3ABH A;  4AZB A;  3BUI A;  3DOB A;  3LMF A;  1DKZ A;  4AZ5 A;  3DPQ A;  3HAH A;  4AVM A;  3O3O B;  2PY6 A;  3T49 A;  3M3W A;  1HTY A;  2OW6 A;  3PLT A;  2JNK A;  1SU7 A;  4WPE A;  2V0O A;  3CZN A;  2F18 A;  3LLL A;  3DX3 A;  3BUQ A;  2Z0V A;  3EJR A;  3DQG A;  3I2W A;  4H6I A;  1TQW A;  2WYI A;  3CVR A;  1R5E A;  3ERC C;  4NQI A;  3GI7 A;  3BVW A;  1OA1 A;  2ND0 A;  3D52 A;  4IWQ A;  3A98 A;  3BVX A;  3ACO A;  2YKT A;  1JQK A;  4B9Q A;  3DDG A;  3C7N A;  2NCZ A;  4JWE A;  2C08 A;  3EJS A;  5C5B A;  4EZX A;  2Q12 A;  3ZED A;  1QWU A;  2EX3 B;  2OW7 A;  4FL9 A;  2V7Y A;  5KBP A;  2YI8 A;  3DX4 A;  3D4Z A;  2MI7 A;  2YL6 A;  3KAW A;  2WIN M;  3D4Y A;  3QE6 A;  3RV1 A;  1TQV A;  3BUP A;  4FZO A;  4AKV A;  1TQT A;  4JWD A;  1TQS A;  4IM3 A;  4F00 A;  1SU6 A;  3L3O M;  2D4C A;  4IM0 A;  2YL5 A;  4EZR A;  3DPO A;  1BPR A;  3SOG A;  1I4D A;  4JL9 A;  3CZS A;  1U00 A;  4KIK B;  2OBL A;  2F7P A;  4ILG A;  3DDF A;  1TQU A;  2F7Q A;  3EJU A;  2EFL A;  2JNS A;  4WV7 A;  4DCN C;  1E9V A;  4IWO A;  3I39 X;  5TKY A;  2KHO A;  3BUB A;  4UDX X;  1ZWW A;  4BNE A;  3BVU A;  4E81 A;  1LQ7 A;  1E1D A;  3Q84 A;  3RV0 A;  1GN9 A;  4HY9 A;  1WDZ A;  3OWG A;  4HR1 B;  4NPH A;  4UDY X;  3VEB A;  3EJT A;  1Q5L A;  3B51 X;  3FD9 A;  3OK8 A;  3SBT B;  2YIV X;  3DX0 A;  4DYL A;  1GNT A;  2YLA A;  4EZZ A;  3N8E A;  2ELB A;  3BVV A;  4NSW A;  3OHX M;  3Q0K A;  1DKX A;  3QWE A;  4JWI A;  3QNI A;  4EZS A;  4JN4 A;  4JNE A;  2WYH A;  2RAI A;  1GNL A;  2FYV A;  3I04 A;  2F7O A;  1UPX A;  4EZN A;  1YWM A;  4AZ7 A;  1HXK A;  1HWW A;  1PS3 A;  4EZU A;  4F01 A;  1O7D B;  2Q13 A;  2N3K A;  1OA0 A;  4KIK A;  1OAO A;  3T48 A;  2RAJ A;  4IWP A;  4R5G A;  4D8J A;  2Z8Y A;  4M0M A;  4R5L A;  2X5C A;  4IM2 A;  2LM0 A;  3HAI A;  4R5J A;  4WPC A;  3KAV A;  2YL8 A;  3UIT A;  3D51 A;  3T47 A;  3DX2 A;  2RAK A;  3F7W A;  3EJP A;  4FZP A;  2EWF A;  1ZYL A;  2GA9 D;  4H8S A;  3SBS A;  2Z0O A;  4JNF A;  2FIC A;  3EJQ A;  4ATM A;  3O3N B;  3QNJ A;  4EZT A;  1YUW A;  2BPR A;  3LVT A;  4MQD A;  4HR1 A;  2F7R A;  3CV5 A;  4AZC B;  2X3X A;  1MJG A;  4FM3 A;  4EZP A;  3VEA A;  4HYB A;  2LXY A;  4EZY A;  3H0X A;  3D2E A;  3DX1 A;  5FIG A;  7HSC A;  2ND1 A;  4ILH B;  4IW0 A;  1SUF A;  1Y2O A;  1QWN A;  3SYV A;  1I4L A;  2OP6 A;  4I1Q A;  4FZS A;  2OO2 A;  2RT6 A;  1X03 A;  4EZW A;  1X04 A;  1SU8 A;  2X3V A;  3O3M B;  3KDR A;  2QFF A;  1R33 A;  3G9G A;  1O7D C;  3D2F A;  2OBM A;  2OZN B;  2QXL A;  4I43 A;  3CKD A;  1I49 A;  4AZG A;  3L3P A;  4AZH A;  2Z0N A;  4PO2 A;  3B52 X;  1QX1 A;  4R5I A;  4H6H A;  4EZO A;  2O0I 1;  3ER9 B;  2F1B A;  4AZI A;  5E84 A;  4E3C A;  4EZQ A;  3BLB A;  3T46 A; 
#chains in the Genus database with same CATH homology
 4UDX X;  3SBS A;  4JNF A;  3ERC C;  4ILI A;  4E81 A;  3GI7 A;  1E1D A;  3O3N B;  3QNJ A;  1E2U A;  4EZT A;  1YUW A;  4JWC A;  2BPR A;  1OA1 A;  2ND0 A;  4IWQ A;  4MQD A;  3A98 A;  4HR1 A;  5FLE X;  3RV0 A;  1CKR A;  1GN9 A;  4HY9 A;  4EZV A;  1JQK A;  4B9Q A;  2YIA A;  3OWG A;  4HR1 B;  4NPH A;  4UDY X;  3C7N A;  1MJG A;  3VEB A;  3ZEF A;  4FM3 A;  4EZP A;  1Q5L A;  2NCZ A;  2GAF D;  3B53 X;  3VEA A;  4HYB A;  3B51 X;  4JWE A;  3FD9 A;  4EZY A;  3C7N B;  3SBT B;  2YIV X;  3H0X A;  1DKY A;  3T4A G;  4WV5 A;  3D2E A;  5FIG A;  7HSC A;  1GNT A;  4EZX A;  4R5K A;  2ND1 A;  4EZZ A;  1DG4 A;  3N8E A;  4ILH B;  4IW0 A;  4G6Q A;  3ZED A;  1SUF A;  2EX3 B;  3OHX M;  2V7Y A;  4FL9 A;  2OP6 A;  1DKX A;  2YI8 A;  2YIB A;  4JWI A;  3QA8 A;  3KAW A;  1W9M A;  4EZS A;  2RT6 A;  2WIN M;  4JN4 A;  4EZW A;  3ER8 C;  1SU8 A;  3I01 A;  3RV1 A;  3O3M B;  4JNE A;  3VKH A;  1GNL A;  2YI9 A;  3KDR A;  3I04 A;  2QFF A;  4JLC A;  1UPX A;  3DPP A;  4JWD A;  4EZN A;  4IM3 A;  3D2F A;  2OBM A;  4F00 A;  1SU6 A;  3L3O M;  2QXL A;  4IM0 A;  3DOB A;  3LMF A;  4EZU A;  4F01 A;  4I43 A;  2N3K A;  1DKZ A;  3DPQ A;  1OA0 A;  4EZR A;  3DPO A;  4KIK A;  1OAO A;  3T48 A;  4PO2 A;  1BPR A;  4IWP A;  4R5G A;  3O3O B;  4D8J A;  3B52 X;  2Z8Y A;  2PY6 A;  4JL9 A;  4M0M A;  1U00 A;  4KIK B;  3T49 A;  4R5L A;  2X5C A;  4IM2 A;  2LM0 A;  2OBL A;  4R5I A;  4R5J A;  4ILG A;  3KAV A;  3UIT A;  2JNS A;  1SU7 A;  4WV7 A;  4H6H A;  4EZO A;  3ER9 B;  3T47 A;  1E9V A;  5E84 A;  4IWO A;  4E3C A;  4EZQ A;  3F7W A;  3DQG A;  2EWF A;  3I39 X;  5TKY A;  2KHO A;  4H6I A;  1ZYL A;  2GA9 D;  3T46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...