4JWIA

Crystal structure of the substrate binding domain of e.coli dnak in complex with sheep bac7(35-43)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone/antibiotic
total genus 61
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jwiA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jwiA01
3T47A 3C7NB 4JWIA 3DOBA 3DQGA 5TKYA 4EZTA 4R5LA 2OP6A 3T49A 3DPPA 4R5IA 3T4AG 4EZOA 2KHOA 3C7NA 2QXLA 3L3OM 4R5JA 4HY9A 4R5GA 4E81A 4EZUA 4EZVA 4EZXA 2BPRA 1U00A 3DPOA 4HYBA 4F00A 4EZNA 4JWEA 4EZWA 4H6HA 3D2EA 4EZYA 4H6IA 1DKYA 4JNFA 4JN4A 4JNEA 4PO2A 4EZSA 1YUWA 4FL9A 5E84A 3QNJA 4EZRA 1BPRA 3D2FA 3N8EA 7HSCA 4F01A 4JWDA 4EZQA 1Q5LA 2WINM 3T48A 4WV7A 2V7YA 1DKZA 4WV5A 2QFFA 4JWCA 4B9QA 1DKXA 3T46A 4EZZA 3OHXM 1DG4A 4R5KA 1CKRA 4EZPA 3H0XA 3DPQA
chains in the Genus database with same CATH superfamily
2FYVA 1OAOA 5TKYA 4EZVA 4AZ6A 4HR1B 2YL5A 3KAWA 2YL9A 3O3NB 4JL9A 2RAIA 4I1QA 7HSCA 3BUDA 4IW0A 4WV7A 4WV5A 2NCZA 3CZSA 4EZPA 3T47A 3KAVA 4NPHA 2QXLA 3L3OM 3DPOA 1W9MA 1ZYLA 3B53X 4JNEA 1CKRA 4FZOA 1URUA 1R34A 1E9VA 4KIKA 3I04A 1Q5LA 5FLEX 2LXYA 3HAHA 2GA9D 2X3XA 3D51A 3I39X 1Y2OA 2PY6A 3KDRA 4EZTA 2YLLA 3QE6A 2F18A 2F7QA 3C7NA 4E81A 1GN9A 3BUBA 2JNSA 1GNLA 4I43A 4PO2A 4AZ7A 4ILGA 4FM3A 2V7YA 1DG4A 2YI9A 4IWQA 4D8JA 2ALWA 2MI7A 3T49A 2WYHA 1X04A 3D50A 3BUIA 1E1DA 3ERCC 2YIVX 4F00A 4JLCA 1OA1A 2D4CA 2X3VA 2GF4A 3D4YA 2F7PA 3EJTA 4NQIA 2QFFA 4B9QA 4R5KA 4FZPA 3DPPA 4HYBA 1SU8A 2X5CA 2YKTA 2OW6A 3D2EA 4H6HA 4IWPA 4JNFA 1TQVA 3O3MB 3VEBA 4EZRA 3OK8A 4BNEA 3QWEA 3DX4A 4AZCA 3H0XA 2Z0OA 2FICA 2Z0NA 3BLBA 2OW7A 2KHOA 4H8SA 2YI8A 1WDZA 3SBTB 4KIKB 3OWGA 3Q0KA 2ELBA 3BUQA 2LM0A 2PMRA 4AZBA 3EJPA 4DCNC 3ER8C 2EFLA 4E3CA 3EJRA 2RAJA 4MQDA 2F1AA 3LVTA 2C08A 4R5LA 2OP6A 3DX2A 4EZXA 4AZ5A 2BPRA 3BVTA 1O7DC 3CV5A 3N8EA 3UITA 3CAZA 2Z0VA 4G6QA 3T48A 3DX0A 4AVMA 1TQSA 1OA0A 3F7WA 2F7OA 4EZYA 3LMFA 4ATMA 5E84A 3G9GA 3LLLA 2O0I1 3DDFA 1I49A 1DKZA 5FIGA 5C5BA 3DDGA 3RPMA 4NSWA 3CZNA 1QX1A 2V0OA 3RV1A 2GAFD 2X3WA 4FL9A 4EZSA 2RAKA 4M0MA 4JWDA 2F1BA 4AZCB 4WPCA 1I4LA 3M3WA 3VKHA 4ILHB 4JWIA 3ZEFA 2OZNB 2OO2A 1E2UA 4AZIA 3ZEDA 3B52X 3BVVA 3QNJA 2OBMA 2EFKA 3T46A 3B51X 1O7DB 3DOBA 2YIAA 1LQ7A 1TQTA 3RV0A 4R5JA 2ZXQA 1YWMA 3EJUA 3DX3A 2N3KA 1I4TA 4EZNA 4JN4A 2D1LA 1SUFA 4WPEA 3O3OB 3Q84A 2ND1A 3DYTA 4EZZA 2YIBA 2Z8YA 3C7NB 2JNKA 4IM2A 3D4ZA 4R5IA 3L3PA 1DKYA 1TQWA 3HAIA 1TQUA 5C5BB 3SYVA 3QNIA 3DPQA 1I4DA 3ACOA 1HTYA 3CKDA 4R5GA 1JQKA 1QWNA 3HAJA 3DX1A 1X03A 2F7RA 2Q13A 3ABHA 4HR1A 4AKVA 3VEAA 4EZQA 1R5EA 1HXKA 5KBPA 4JWCA 1DKXA 3OHXM 1GNTA 4AZHA 4DYLA 3QA8A 3DQGA 4ILIA 3PLTA 3T4AG 2OBLA 1QWUA 3D52A 1U00A 4IM0A 3A98A 3SOGA 3SBSA 2WYIA 1MJGA 1R33A 1HWWA 2YL6A 4AZGA 2YL8A 3I01A 4EZOA 3I2WA 4EZUA 3EJSA 4JWEA 4EZWA 1YUWA 4H6IA 1SU7A 1PS3A 2EWFA 2Q12A 3BVUA 4IM3A 3CVRA 2ND0A 1UPXA 2RT6A 3BVXA 3EJQA 1ZWWA 3BVWA 4UDYX 3ER9B 4HY9A 2EX3B 2QKWA 3FD9A 2YLAA 1BPRA 3D2FA 3BUPA 4IWOA 4F01A 4UDXX 4FZSA 3GI7A 1SU6A 2WINM
chains in the Genus database with same CATH topology
1OAOA 5TKYA 3DPPA 3RV1A 4R5GA 4EZVA 1JQKA 2GAFD 4HR1B 3KAWA 4HYBA 1SU8A 2X5CA 4IWPA 4H6HA 3D2EA 3O3NB 4JNFA 4FL9A 4JL9A 4EZSA 3O3MB 3VEBA 4EZRA 4HR1A 7HSCA 4M0MA 4JWDA 3VEAA 4EZQA 4IW0A 4WV7A 4WV5A 4JWCA 1DKXA 3OHXM 2NCZA 3VKHA 1GNTA 4EZPA 3H0XA 3T47A 3KAVA 3QA8A 4ILHB 4JWIA 3DQGA 3ZEFA 4NPHA 4ILIA 3T4AG 2KHOA 2OBLA 2QXLA 2YI8A 3L3OM 1U00A 3DPOA 3SBTB 1E2UA 4IM0A 4KIKB 3A98A 3OWGA 1W9MA 1ZYLA 3ZEDA 3B52X 3B53X 4JNEA 1CKRA 3SBSA 3QNJA 1MJGA 1E9VA 4KIKA 2OBMA 3I04A 1Q5LA 2LM0A 5FLEX 2GA9D 3T46A 3B51X 3I39X 3ER8C 2PY6A 4E3CA 4MQDA 3KDRA 3DOBA 2YIAA 4EZTA 4R5LA 2OP6A 3I01A 4EZOA 3RV0A 3C7NA 4R5JA 4EZXA 4EZUA 4E81A 1GN9A 2BPRA 2JNSA 2N3KA 1GNLA 4EZNA 4JWEA 4EZWA 1YUWA 4H6IA 4I43A 4JN4A 1SU7A 4PO2A 1SUFA 3N8EA 3UITA 3O3OB 2EWFA 4ILGA 2ND1A 4G6QA 4IM3A 4FM3A 3T48A 2V7YA 2ND0A 4EZZA 1DG4A 1UPXA 2YI9A 2YIBA 4IWQA 4D8JA 2RT6A 2Z8YA 1OA0A 3C7NB 4IM2A 3F7WA 3T49A 4R5IA 4UDYX 3ER9B 4HY9A 2EX3B 1E1DA 3ERCC 2YIVX 4F00A 4EZYA 3FD9A 3LMFA 4JLCA 1DKYA 1OA1A 5E84A 1BPRA 3D2FA 4IWOA 4F01A 4UDXX 3GI7A 1SU6A 2WINM 1DKZA 2QFFA 4B9QA 5FIGA 4R5KA 3DPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T47 A;  3C7N B;  4JWI A;  3DOB A;  3DQG A;  5TKY A;  4EZT A;  4R5L A;  2OP6 A;  3T49 A;  3DPP A;  4R5I A;  3T4A G;  4EZO A;  2KHO A;  3C7N A;  2QXL A;  3L3O M;  4R5J A;  4HY9 A;  4R5G A;  4E81 A;  4EZU A;  4EZV A;  4EZX A;  2BPR A;  1U00 A;  3DPO A;  4HYB A;  4F00 A;  4EZN A;  4JWE A;  4EZW A;  4H6H A;  3D2E A;  4EZY A;  4H6I A;  1DKY A;  4JNF A;  4JN4 A;  4JNE A;  4PO2 A;  4EZS A;  1YUW A;  4FL9 A;  5E84 A;  3QNJ A;  4EZR A;  1BPR A;  3D2F A;  3N8E A;  7HSC A;  4F01 A;  4JWD A;  4EZQ A;  1Q5L A;  2WIN M;  3T48 A;  4WV7 A;  2V7Y A;  1DKZ A;  4WV5 A;  2QFF A;  4JWC A;  4B9Q A;  1DKX A;  3T46 A;  4EZZ A;  3OHX M;  1DG4 A;  4R5K A;  1CKR A;  4EZP A;  3H0X A;  3DPQ A; 
#chains in the Genus database with same CATH topology
 2FYV A;  1OAO A;  5TKY A;  4EZV A;  4AZ6 A;  4HR1 B;  2YL5 A;  3KAW A;  2YL9 A;  3O3N B;  4JL9 A;  2RAI A;  4I1Q A;  7HSC A;  3BUD A;  4IW0 A;  4WV7 A;  4WV5 A;  2NCZ A;  3CZS A;  4EZP A;  3T47 A;  3KAV A;  4NPH A;  2QXL A;  3L3O M;  3DPO A;  1W9M A;  1ZYL A;  3B53 X;  4JNE A;  1CKR A;  4FZO A;  1URU A;  1R34 A;  1E9V A;  4KIK A;  3I04 A;  1Q5L A;  5FLE X;  2LXY A;  3HAH A;  2GA9 D;  2X3X A;  3D51 A;  3I39 X;  1Y2O A;  2PY6 A;  3KDR A;  4EZT A;  2YLL A;  3QE6 A;  2F18 A;  2F7Q A;  3C7N A;  4E81 A;  1GN9 A;  3BUB A;  2JNS A;  1GNL A;  4I43 A;  4PO2 A;  4AZ7 A;  4ILG A;  4FM3 A;  2V7Y A;  1DG4 A;  2YI9 A;  4IWQ A;  4D8J A;  2ALW A;  2MI7 A;  3T49 A;  2WYH A;  1X04 A;  3D50 A;  3BUI A;  1E1D A;  3ERC C;  2YIV X;  4F00 A;  4JLC A;  1OA1 A;  2D4C A;  2X3V A;  2GF4 A;  3D4Y A;  2F7P A;  3EJT A;  4NQI A;  2QFF A;  4B9Q A;  4R5K A;  4FZP A;  3DPP A;  4HYB A;  1SU8 A;  2X5C A;  2YKT A;  2OW6 A;  3D2E A;  4H6H A;  4IWP A;  4JNF A;  1TQV A;  3O3M B;  3VEB A;  4EZR A;  3OK8 A;  4BNE A;  3QWE A;  3DX4 A;  4AZC A;  3H0X A;  2Z0O A;  2FIC A;  2Z0N A;  3BLB A;  2OW7 A;  2KHO A;  4H8S A;  2YI8 A;  1WDZ A;  3SBT B;  4KIK B;  3OWG A;  3Q0K A;  2ELB A;  3BUQ A;  2LM0 A;  2PMR A;  4AZB A;  3EJP A;  4DCN C;  3ER8 C;  2EFL A;  4E3C A;  3EJR A;  2RAJ A;  4MQD A;  2F1A A;  3LVT A;  2C08 A;  4R5L A;  2OP6 A;  3DX2 A;  4EZX A;  4AZ5 A;  2BPR A;  3BVT A;  1O7D C;  3CV5 A;  3N8E A;  3UIT A;  3CAZ A;  2Z0V A;  4G6Q A;  3T48 A;  3DX0 A;  4AVM A;  1TQS A;  1OA0 A;  3F7W A;  2F7O A;  4EZY A;  3LMF A;  4ATM A;  5E84 A;  3G9G A;  3LLL A;  2O0I 1;  3DDF A;  1I49 A;  1DKZ A;  5FIG A;  5C5B A;  3DDG A;  3RPM A;  4NSW A;  3CZN A;  1QX1 A;  2V0O A;  3RV1 A;  2GAF D;  2X3W A;  4FL9 A;  4EZS A;  2RAK A;  4M0M A;  4JWD A;  2F1B A;  4AZC B;  4WPC A;  1I4L A;  3M3W A;  3VKH A;  4ILH B;  4JWI A;  3ZEF A;  2OZN B;  2OO2 A;  1E2U A;  4AZI A;  3ZED A;  3B52 X;  3BVV A;  3QNJ A;  2OBM A;  2EFK A;  3T46 A;  3B51 X;  1O7D B;  3DOB A;  2YIA A;  1LQ7 A;  1TQT A;  3RV0 A;  4R5J A;  2ZXQ A;  1YWM A;  3EJU A;  3DX3 A;  2N3K A;  1I4T A;  4EZN A;  4JN4 A;  2D1L A;  1SUF A;  4WPE A;  3O3O B;  3Q84 A;  2ND1 A;  3DYT A;  4EZZ A;  2YIB A;  2Z8Y A;  3C7N B;  2JNK A;  4IM2 A;  3D4Z A;  4R5I A;  3L3P A;  1DKY A;  1TQW A;  3HAI A;  1TQU A;  5C5B B;  3SYV A;  3QNI A;  3DPQ A;  1I4D A;  3ACO A;  1HTY A;  3CKD A;  4R5G A;  1JQK A;  1QWN A;  3HAJ A;  3DX1 A;  1X03 A;  2F7R A;  2Q13 A;  3ABH A;  4HR1 A;  4AKV A;  3VEA A;  4EZQ A;  1R5E A;  1HXK A;  5KBP A;  4JWC A;  1DKX A;  3OHX M;  1GNT A;  4AZH A;  4DYL A;  3QA8 A;  3DQG A;  4ILI A;  3PLT A;  3T4A G;  2OBL A;  1QWU A;  3D52 A;  1U00 A;  4IM0 A;  3A98 A;  3SOG A;  3SBS A;  2WYI A;  1MJG A;  1R33 A;  1HWW A;  2YL6 A;  4AZG A;  2YL8 A;  3I01 A;  4EZO A;  3I2W A;  4EZU A;  3EJS A;  4JWE A;  4EZW A;  1YUW A;  4H6I A;  1SU7 A;  1PS3 A;  2EWF A;  2Q12 A;  3BVU A;  4IM3 A;  3CVR A;  2ND0 A;  1UPX A;  2RT6 A;  3BVX A;  3EJQ A;  1ZWW A;  3BVW A;  4UDY X;  3ER9 B;  4HY9 A;  2EX3 B;  2QKW A;  3FD9 A;  2YLA A;  1BPR A;  3D2F A;  3BUP A;  4IWO A;  4F01 A;  4UDX X;  4FZS A;  3GI7 A;  1SU6 A;  2WIN M; 
#chains in the Genus database with same CATH homology
 1OAO A;  5TKY A;  3DPP A;  3RV1 A;  4R5G A;  4EZV A;  1JQK A;  2GAF D;  4HR1 B;  3KAW A;  4HYB A;  1SU8 A;  2X5C A;  4IWP A;  4H6H A;  3D2E A;  3O3N B;  4JNF A;  4FL9 A;  4JL9 A;  4EZS A;  3O3M B;  3VEB A;  4EZR A;  4HR1 A;  7HSC A;  4M0M A;  4JWD A;  3VEA A;  4EZQ A;  4IW0 A;  4WV7 A;  4WV5 A;  4JWC A;  1DKX A;  3OHX M;  2NCZ A;  3VKH A;  1GNT A;  4EZP A;  3H0X A;  3T47 A;  3KAV A;  3QA8 A;  4ILH B;  4JWI A;  3DQG A;  3ZEF A;  4NPH A;  4ILI A;  3T4A G;  2KHO A;  2OBL A;  2QXL A;  2YI8 A;  3L3O M;  1U00 A;  3DPO A;  3SBT B;  1E2U A;  4IM0 A;  4KIK B;  3A98 A;  3OWG A;  1W9M A;  1ZYL A;  3ZED A;  3B52 X;  3B53 X;  4JNE A;  1CKR A;  3SBS A;  3QNJ A;  1MJG A;  1E9V A;  4KIK A;  2OBM A;  3I04 A;  1Q5L A;  2LM0 A;  5FLE X;  2GA9 D;  3T46 A;  3B51 X;  3I39 X;  3ER8 C;  2PY6 A;  4E3C A;  4MQD A;  3KDR A;  3DOB A;  2YIA A;  4EZT A;  4R5L A;  2OP6 A;  3I01 A;  4EZO A;  3RV0 A;  3C7N A;  4R5J A;  4EZX A;  4EZU A;  4E81 A;  1GN9 A;  2BPR A;  2JNS A;  2N3K A;  1GNL A;  4EZN A;  4JWE A;  4EZW A;  1YUW A;  4H6I A;  4I43 A;  4JN4 A;  1SU7 A;  4PO2 A;  1SUF A;  3N8E A;  3UIT A;  3O3O B;  2EWF A;  4ILG A;  2ND1 A;  4G6Q A;  4IM3 A;  4FM3 A;  3T48 A;  2V7Y A;  2ND0 A;  4EZZ A;  1DG4 A;  1UPX A;  2YI9 A;  2YIB A;  4IWQ A;  4D8J A;  2RT6 A;  2Z8Y A;  1OA0 A;  3C7N B;  4IM2 A;  3F7W A;  3T49 A;  4R5I A;  4UDY X;  3ER9 B;  4HY9 A;  2EX3 B;  1E1D A;  3ERC C;  2YIV X;  4F00 A;  4EZY A;  3FD9 A;  3LMF A;  4JLC A;  1DKY A;  1OA1 A;  5E84 A;  1BPR A;  3D2F A;  4IWO A;  4F01 A;  4UDX X;  3GI7 A;  1SU6 A;  2WIN M;  1DKZ A;  2QFF A;  4B9Q A;  5FIG A;  4R5K A;  3DPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...