4JWIA

Crystal structure of the substrate binding domain of e.coli dnak in complex with sheep bac7(35-43)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone/antibiotic
total genus 61
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jwiA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jwiA01
4EZVA 4JWDA 1CKRA 7HSCA 2V7YA 4R5KA 4WV5A 4WV7A 4H6IA 2WINM 3DPOA 4R5GA 3T49A 2BPRA 4PO2A 4HY9A 5E84A 3OHXM 4JWCA 4EZUA 4EZZA 3N8EA 4EZQA 1YUWA 4F01A 4JNFA 3C7NB 2KHOA 3DPPA 4JN4A 1DKXA 4EZPA 3T4AG 4JWIA 4EZXA 1BPRA 1U00A 4JWEA 3C7NA 4H6HA 4EZOA 2OP6A 3D2EA 4R5JA 1DKYA 3D2FA 3T47A 4EZYA 3QNJA 4R5IA 3T48A 3DQGA 4JNEA 3T46A 4B9QA 5TKYA 4F00A 1DKZA 1Q5LA 4EZRA 3DPQA 3L3OM 4HYBA 4EZNA 4R5LA 3DOBA 4EZWA 4EZTA 3H0XA 4E81A 4FL9A 2QFFA 2QXLA 4EZSA 1DG4A
chains in the Genus database with same CATH superfamily
4EZVA 3OWGA 4IM0A 4WV5A 1SU6A 2RAIA 3BVVA 4JWEA 3C7NA 4H6HA 3DX1A 3SBTB 4IW0A 3L3OM 2OZNB 4FZPA 1QX1A 2F7QA 1LQ7A 3QA8A 3RV0A 4D8JA 1UPXA 3BUDA 2PY6A 4EZUA 3D52A 4NQIA 4R5IA 2YIAA 2X3XA 2PMRA 4EZWA 3DDFA 3O3MB 3DX2A 3KAVA 1OA0A 3SBSA 1QWUA 4KIKA 1URUA 4JNFA 1BPRA 2ND1A 4AZ7A 1SU7A 1DKZA 4FZSA 2YIBA 4MQDA 3Q0KA 1GN9A 3SYVA 3VEAA 1TQVA 1QWNA 4R5KA 2X3WA 4WPCA 2BPRA 3HAHA 3EJRA 1Y2OA 3Q84A 2WYIA 1HWWA 1SU8A 4DCNC 4UDXX 2X5CA 4E81A 2OW7A 3G9GA 2D4CA 1I4TA 2OW6A 2Z0NA 4PO2A 2N3KA 3QWEA 3B52X 4EZPA 4EZXA 2Z0OA 2YL6A 2YKTA 3I01A 1OAOA 1GNTA 2Q12A 7HSCA 2V7YA 4WPEA 3CV5A 3EJSA 3LVTA 4AZ6A 1I49A 5C5BA 4EZQA 4IWPA 3C7NB 4JL9A 2LXYA 4JWIA 1U00A 3D2EA 2ZXQA 2F7RA 3D4ZA 3DX0A 3T47A 3O3OB 4HR1B 3CZNA 3F7WA 3BUIA 2YL8A 2GF4A 5FIGA 1CKRA 2OBMA 1I4LA 3ZEDA 1E1DA 4HY9A 2F18A 2YL9A 3OHXM 3EJQA 3ERCC 2Z8YA 4R5JA 2WYHA 3M3WA 2JNSA 3LLLA 3DX4A 2YLLA 1DG4A 1ZYLA 4WV7A 2D1LA 3T49A 2RAJA 1TQWA 3I39X 3KDRA 3T4AG 2OP6A 2YL5A 3D2FA 3RV1A 3D4YA 3QNJA 2Q13A 5TKYA 2FYVA 4EZNA 2QKWA 4EZSA 4IWOA 4AZCA 2WINM 4E3CA 2RAKA 3B53X 3DYTA 1R33A 4JWCA 3QE6A 1MJGA 1TQTA 4EZYA 4ILHB 4ATMA 3DPQA 1E9VA 3GI7A 2OBLA 1X04A 3I04A 3ACOA 4M0MA 3ER9B 3DPPA 2OO2A 4NPHA 3BVXA 3FD9A 3ER8C 1R34A 3L3PA 1WDZA 3EJUA 4HYBA 3DOBA 1O7DC 2EFLA 4G6QA 5C5BB 3DDGA 1DKYA 1JQKA 3BUQA 3A98A 2NCZA 3CZSA 1I4DA 4NSWA 4IM3A 3EJPA 1TQUA 4JWDA 3BVTA 1TQSA 1W9MA 4BNEA 3N8EA 2V0OA 4F01A 3LMFA 3D51A 4EZOA 3T48A 2YLAA 1HXKA 4HR1A 1X03A 4I43A 2C08A 3DX3A 3H0XA 4ILGA 3PLTA 4KIKB 2MI7A 4AZHA 1O7DB 2YI9A 2FICA 1HTYA 1R5EA 3RPMA 1PS3A 2GA9D 4UDYX 3QNIA 3HAJA 2ALWA 2Z0VA 3HAIA 4EZTA 4FL9A 3BVUA 2QFFA 2LM0A 4AVMA 4AZCB 4AZIA 2ELBA 3D50A 1ZWWA 3SOGA 2JNKA 4R5GA 2EX3B 2YI8A 3CKDA 4FM3A 5E84A 4EZZA 2X3VA 4JN4A 1DKXA 3BUPA 4IM2A 4AKVA 1YWMA 2ND0A 3DQGA 2F1AA 3B51X 1E2UA 4R5LA 2EWFA 3KAWA 3VEBA 3EJTA 3UITA 2QXLA 4AZGA 4DYLA 4IWQA 4H6IA 2EFKA 1YUWA 3BLBA 4AZ5A 2GAFD 3ABHA 2F7PA 5KBPA 3I2WA 4JNEA 5FLEX 3T46A 4B9QA 3CVRA 3CAZA 4H8SA 2RT6A 3DPOA 3O3NB 1SUFA 3VKHA 3BUBA 2F1BA 2YIVX 4I1QA 4ILIA 1OA1A 2KHOA 4FZOA 2O0I1 2F7OA 1GNLA 4JLCA 4F00A 4AZBA 1Q5LA 4EZRA 3ZEFA 3OK8A 3BVWA
chains in the Genus database with same CATH topology
4EZVA 3OWGA 4IWOA 4IM0A 4WV5A 4KIKB 2WINM 4E3CA 1SU6A 4PO2A 2N3KA 3B53X 4JWCA 3B52X 4EZPA 4EZXA 2YI9A 1MJGA 4JWEA 3C7NA 4H6HA 4EZYA 4ILHB 3SBTB 2GA9D 3I01A 1OAOA 4IW0A 4UDYX 3DPQA 3L3OM 4EZTA 4FL9A 1E9VA 2QFFA 2LM0A 3QA8A 1GNTA 3RV0A 7HSCA 3GI7A 2V7YA 2OBLA 4D8JA 1UPXA 3I04A 4M0MA 4R5GA 2EX3B 2YI8A 4FM3A 3ER9B 2PY6A 5E84A 4EZUA 4EZZA 4EZQA 4IWPA 3C7NB 4JL9A 3DPPA 4JN4A 1DKXA 4IM2A 4JWIA 1U00A 3D2EA 4NPHA 3T47A 2ND0A 3FD9A 3O3OB 4HR1B 4R5IA 3ER8C 3DQGA 2YIAA 3F7WA 3B51X 4HYBA 1E2UA 4R5LA 3DOBA 4EZWA 2EWFA 3KAWA 3VEBA 3O3MB 3UITA 2QXLA 3KAVA 5FIGA 1OA0A 2OBMA 1CKRA 4G6QA 3SBSA 4IWQA 4H6IA 4KIKA 3ZEDA 1E1DA 4HY9A 3OHXM 1YUWA 4JNFA 2GAFD 3ERCC 1BPRA 2Z8YA 4R5JA 1DKYA 1JQKA 3A98A 2ND1A 4JNEA 5FLEX 3T46A 4B9QA 2NCZA 1SU7A 1DKZA 2JNSA 4IM3A 2YIBA 4MQDA 1GN9A 1DG4A 1ZYLA 4JWDA 3VEAA 2RT6A 4R5KA 4WV7A 3DPOA 3O3NB 1SUFA 3T49A 1W9MA 3VKHA 2BPRA 2YIVX 4ILIA 3N8EA 4F01A 3LMFA 1OA1A 2KHOA 3I39X 3KDRA 3T4AG 2OP6A 4EZOA 3D2FA 3RV1A 3QNJA 3T48A 1SU8A 1GNLA 4JLCA 5TKYA 4F00A 4HR1A 1Q5LA 4EZRA 4I43A 3ZEFA 4EZNA 4UDXX 3H0XA 2X5CA 4E81A 4ILGA 4EZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZV A;  4JWD A;  1CKR A;  7HSC A;  2V7Y A;  4R5K A;  4WV5 A;  4WV7 A;  4H6I A;  2WIN M;  3DPO A;  4R5G A;  3T49 A;  2BPR A;  4PO2 A;  4HY9 A;  5E84 A;  3OHX M;  4JWC A;  4EZU A;  4EZZ A;  3N8E A;  4EZQ A;  1YUW A;  4F01 A;  4JNF A;  3C7N B;  2KHO A;  3DPP A;  4JN4 A;  1DKX A;  4EZP A;  3T4A G;  4JWI A;  4EZX A;  1BPR A;  1U00 A;  4JWE A;  3C7N A;  4H6H A;  4EZO A;  2OP6 A;  3D2E A;  4R5J A;  1DKY A;  3D2F A;  3T47 A;  4EZY A;  3QNJ A;  4R5I A;  3T48 A;  3DQG A;  4JNE A;  3T46 A;  4B9Q A;  5TKY A;  4F00 A;  1DKZ A;  1Q5L A;  4EZR A;  3DPQ A;  3L3O M;  4HYB A;  4EZN A;  4R5L A;  3DOB A;  4EZW A;  4EZT A;  3H0X A;  4E81 A;  4FL9 A;  2QFF A;  2QXL A;  4EZS A;  1DG4 A; 
#chains in the Genus database with same CATH topology
 4EZV A;  3OWG A;  4IM0 A;  4WV5 A;  1SU6 A;  2RAI A;  3BVV A;  4JWE A;  3C7N A;  4H6H A;  3DX1 A;  3SBT B;  4IW0 A;  3L3O M;  2OZN B;  4FZP A;  1QX1 A;  2F7Q A;  1LQ7 A;  3QA8 A;  3RV0 A;  4D8J A;  1UPX A;  3BUD A;  2PY6 A;  4EZU A;  3D52 A;  4NQI A;  4R5I A;  2YIA A;  2X3X A;  2PMR A;  4EZW A;  3DDF A;  3O3M B;  3DX2 A;  3KAV A;  1OA0 A;  3SBS A;  1QWU A;  4KIK A;  1URU A;  4JNF A;  1BPR A;  2ND1 A;  4AZ7 A;  1SU7 A;  1DKZ A;  4FZS A;  2YIB A;  4MQD A;  3Q0K A;  1GN9 A;  3SYV A;  3VEA A;  1TQV A;  1QWN A;  4R5K A;  2X3W A;  4WPC A;  2BPR A;  3HAH A;  3EJR A;  1Y2O A;  3Q84 A;  2WYI A;  1HWW A;  1SU8 A;  4DCN C;  4UDX X;  2X5C A;  4E81 A;  2OW7 A;  3G9G A;  2D4C A;  1I4T A;  2OW6 A;  2Z0N A;  4PO2 A;  2N3K A;  3QWE A;  3B52 X;  4EZP A;  4EZX A;  2Z0O A;  2YL6 A;  2YKT A;  3I01 A;  1OAO A;  1GNT A;  2Q12 A;  7HSC A;  2V7Y A;  4WPE A;  3CV5 A;  3EJS A;  3LVT A;  4AZ6 A;  1I49 A;  5C5B A;  4EZQ A;  4IWP A;  3C7N B;  4JL9 A;  2LXY A;  4JWI A;  1U00 A;  3D2E A;  2ZXQ A;  2F7R A;  3D4Z A;  3DX0 A;  3T47 A;  3O3O B;  4HR1 B;  3CZN A;  3F7W A;  3BUI A;  2YL8 A;  2GF4 A;  5FIG A;  1CKR A;  2OBM A;  1I4L A;  3ZED A;  1E1D A;  4HY9 A;  2F18 A;  2YL9 A;  3OHX M;  3EJQ A;  3ERC C;  2Z8Y A;  4R5J A;  2WYH A;  3M3W A;  2JNS A;  3LLL A;  3DX4 A;  2YLL A;  1DG4 A;  1ZYL A;  4WV7 A;  2D1L A;  3T49 A;  2RAJ A;  1TQW A;  3I39 X;  3KDR A;  3T4A G;  2OP6 A;  2YL5 A;  3D2F A;  3RV1 A;  3D4Y A;  3QNJ A;  2Q13 A;  5TKY A;  2FYV A;  4EZN A;  2QKW A;  4EZS A;  4IWO A;  4AZC A;  2WIN M;  4E3C A;  2RAK A;  3B53 X;  3DYT A;  1R33 A;  4JWC A;  3QE6 A;  1MJG A;  1TQT A;  4EZY A;  4ILH B;  4ATM A;  3DPQ A;  1E9V A;  3GI7 A;  2OBL A;  1X04 A;  3I04 A;  3ACO A;  4M0M A;  3ER9 B;  3DPP A;  2OO2 A;  4NPH A;  3BVX A;  3FD9 A;  3ER8 C;  1R34 A;  3L3P A;  1WDZ A;  3EJU A;  4HYB A;  3DOB A;  1O7D C;  2EFL A;  4G6Q A;  5C5B B;  3DDG A;  1DKY A;  1JQK A;  3BUQ A;  3A98 A;  2NCZ A;  3CZS A;  1I4D A;  4NSW A;  4IM3 A;  3EJP A;  1TQU A;  4JWD A;  3BVT A;  1TQS A;  1W9M A;  4BNE A;  3N8E A;  2V0O A;  4F01 A;  3LMF A;  3D51 A;  4EZO A;  3T48 A;  2YLA A;  1HXK A;  4HR1 A;  1X03 A;  4I43 A;  2C08 A;  3DX3 A;  3H0X A;  4ILG A;  3PLT A;  4KIK B;  2MI7 A;  4AZH A;  1O7D B;  2YI9 A;  2FIC A;  1HTY A;  1R5E A;  3RPM A;  1PS3 A;  2GA9 D;  4UDY X;  3QNI A;  3HAJ A;  2ALW A;  2Z0V A;  3HAI A;  4EZT A;  4FL9 A;  3BVU A;  2QFF A;  2LM0 A;  4AVM A;  4AZC B;  4AZI A;  2ELB A;  3D50 A;  1ZWW A;  3SOG A;  2JNK A;  4R5G A;  2EX3 B;  2YI8 A;  3CKD A;  4FM3 A;  5E84 A;  4EZZ A;  2X3V A;  4JN4 A;  1DKX A;  3BUP A;  4IM2 A;  4AKV A;  1YWM A;  2ND0 A;  3DQG A;  2F1A A;  3B51 X;  1E2U A;  4R5L A;  2EWF A;  3KAW A;  3VEB A;  3EJT A;  3UIT A;  2QXL A;  4AZG A;  4DYL A;  4IWQ A;  4H6I A;  2EFK A;  1YUW A;  3BLB A;  4AZ5 A;  2GAF D;  3ABH A;  2F7P A;  5KBP A;  3I2W A;  4JNE A;  5FLE X;  3T46 A;  4B9Q A;  3CVR A;  3CAZ A;  4H8S A;  2RT6 A;  3DPO A;  3O3N B;  1SUF A;  3VKH A;  3BUB A;  2F1B A;  2YIV X;  4I1Q A;  4ILI A;  1OA1 A;  2KHO A;  4FZO A;  2O0I 1;  2F7O A;  1GNL A;  4JLC A;  4F00 A;  4AZB A;  1Q5L A;  4EZR A;  3ZEF A;  3OK8 A;  3BVW A; 
#chains in the Genus database with same CATH homology
 4EZV A;  3OWG A;  4IWO A;  4IM0 A;  4WV5 A;  4KIK B;  2WIN M;  4E3C A;  1SU6 A;  4PO2 A;  2N3K A;  3B53 X;  4JWC A;  3B52 X;  4EZP A;  4EZX A;  2YI9 A;  1MJG A;  4JWE A;  3C7N A;  4H6H A;  4EZY A;  4ILH B;  3SBT B;  2GA9 D;  3I01 A;  1OAO A;  4IW0 A;  4UDY X;  3DPQ A;  3L3O M;  4EZT A;  4FL9 A;  1E9V A;  2QFF A;  2LM0 A;  3QA8 A;  1GNT A;  3RV0 A;  7HSC A;  3GI7 A;  2V7Y A;  2OBL A;  4D8J A;  1UPX A;  3I04 A;  4M0M A;  4R5G A;  2EX3 B;  2YI8 A;  4FM3 A;  3ER9 B;  2PY6 A;  5E84 A;  4EZU A;  4EZZ A;  4EZQ A;  4IWP A;  3C7N B;  4JL9 A;  3DPP A;  4JN4 A;  1DKX A;  4IM2 A;  4JWI A;  1U00 A;  3D2E A;  4NPH A;  3T47 A;  2ND0 A;  3FD9 A;  3O3O B;  4HR1 B;  4R5I A;  3ER8 C;  3DQG A;  2YIA A;  3F7W A;  3B51 X;  4HYB A;  1E2U A;  4R5L A;  3DOB A;  4EZW A;  2EWF A;  3KAW A;  3VEB A;  3O3M B;  3UIT A;  2QXL A;  3KAV A;  5FIG A;  1OA0 A;  2OBM A;  1CKR A;  4G6Q A;  3SBS A;  4IWQ A;  4H6I A;  4KIK A;  3ZED A;  1E1D A;  4HY9 A;  3OHX M;  1YUW A;  4JNF A;  2GAF D;  3ERC C;  1BPR A;  2Z8Y A;  4R5J A;  1DKY A;  1JQK A;  3A98 A;  2ND1 A;  4JNE A;  5FLE X;  3T46 A;  4B9Q A;  2NCZ A;  1SU7 A;  1DKZ A;  2JNS A;  4IM3 A;  2YIB A;  4MQD A;  1GN9 A;  1DG4 A;  1ZYL A;  4JWD A;  3VEA A;  2RT6 A;  4R5K A;  4WV7 A;  3DPO A;  3O3N B;  1SUF A;  3T49 A;  1W9M A;  3VKH A;  2BPR A;  2YIV X;  4ILI A;  3N8E A;  4F01 A;  3LMF A;  1OA1 A;  2KHO A;  3I39 X;  3KDR A;  3T4A G;  2OP6 A;  4EZO A;  3D2F A;  3RV1 A;  3QNJ A;  3T48 A;  1SU8 A;  1GNL A;  4JLC A;  5TKY A;  4F00 A;  4HR1 A;  1Q5L A;  4EZR A;  4I43 A;  3ZEF A;  4EZN A;  4UDX X;  3H0X A;  2X5C A;  4E81 A;  4ILG A;  4EZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...