4JWIA

Crystal structure of the substrate binding domain of e.coli dnak in complex with sheep bac7(35-43)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/antibiotic
molecule keywords Chaperone protein DnaK
publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
source organism Escherichia coli
total genus 61
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jwiA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jwiA01
4FL9A 4EZZA 4E81A 1YUWA 4JNFA 2WINM 3D2FA 4H6IA 4B9QA 4WV7A 4R5KA 1DKXA 3QNJA 4EZOA 4EZQA 4R5LA 4EZRA 1BPRA 3DQGA 4F01A 3N8EA 3C7NA 4EZVA 4EZWA 4EZYA 1U00A 4EZUA 2BPRA 3L3OM 4H6HA 3DPOA 4PO2A 4JN4A 5E84A 4EZNA 7HSCA 1DKYA 3T46A 3DPQA 3T4AG 4JNEA 3DOBA 2QXLA 3T48A 1DKZA 4EZSA 1CKRA 3T47A 4WV5A 4JWDA 4HYBA 4JWEA 4EZPA 4EZXA 2OP6A 2V7YA 2KHOA 4R5IA 4EZTA 3T49A 4F00A 1Q5LA 5TKYA 3C7NB 3D2EA 4R5GA 1DG4A 4JWCA 2QFFA 3DPPA 4R5JA 3H0XA 4HY9A 4JWIA 3OHXM
chains in the Genus database with same CATH superfamily
2YI8A 3CZNA 4FZSA 4EZRA 2OBMA 4AZBA 4EZWA 1OA0A 4IW0A 2ZXQA 1X03A 2OBLA 3PLTA 4AZ5A 4EZTA 3T49A 4AZCB 1O7DC 2ALWA 4HY9A 4IM3A 4NSWA 3BVVA 1YUWA 1OAOA 3DX4A 2RAKA 4ILGA 2OO2A 3CVRA 3ACOA 3DPQA 2GA9D 2QXLA 4WV5A 4IWOA 3EJUA 3BUBA 2FYVA 3Q84A 4NPHA 4FZPA 4JLCA 4AZIA 4R5LA 4EZUA 2BPRA 2N3KA 1R34A 2PY6A 1SU8A 2YI9A 2OP6A 3HAJA 1E1DA 5TKYA 3BUIA 1GNTA 4WPEA 4KIKA 3H0XA 2YIBA 3RPMA 4IWPA 2Z0NA 4AKVA 3SOGA 3OK8A 2V0OA 3QE6A 3VEBA 4MQDA 2Q12A 1TQSA 3CAZA 2C08A 3LLLA 4IM2A 4FL9A 1W9MA 2WINM 3Q0KA 2YIAA 3I04A 4NQIA 1SU7A 4KIKB 3KAWA 3UITA 3T48A 3QNIA 4EZXA 3I2WA 3BUPA 3DPPA 2Z0VA 2RAIA 2YKTA 1TQTA 4EZZA 4M0MA 4H6IA 2X5CA 4F01A 4AZHA 4BNEA 3KAVA 3DPOA 1YWMA 5E84A 2MI7A 4JNEA 3SBSA 1I4TA 2YIVX 4F00A 3OWGA 2ND1A 3EJRA 3ER8C 2YL5A 3LVTA 3QWEA 2QFFA 4E3CA 4HR1B 1JQKA 3I39X 2D4CA 3GI7A 1Y2OA 3DX0A 3D4ZA 2QKWA 4EZNA 2ND0A 1DKYA 4DYLA 1OA1A 1ZYLA 4FM3A 1CKRA 4WPCA 4HYBA 3DX1A 4R5IA 2GF4A 1ZWWA 3DYTA 4JWIA 4I43A 3LMFA 4JNFA 1QWNA 2WYIA 4R5KA 4EZOA 4IM0A 4AZ7A 3L3OM 3ZEDA 3ERCC 4ILHB 3EJQA 2YL8A 1E2UA 2F1BA 3ZEFA 1QX1A 2EFLA 3QA8A 1DG4A 4R5GA 2OW7A 3BVUA 3F7WA 3DX2A 3D51A 1I4DA 1DKXA 3N8EA 3SBTB 2F7QA 3RV0A 3ABHA 2YLLA 2F7OA 4D8JA 2X3XA 3VKHA 3ER9B 3A98A 3D4YA 3EJPA 4FZOA 4HR1A 4IWQA 1E9VA 4UDXX 4JWEA 3O3MB 1Q5LA 4JWCA 3O3OB 1LQ7A 2YL9A 4AZ6A 3DQGA 3CV5A 3DDGA 1GN9A 4EZVA 4EZYA 1HTYA 3BVWA 7HSCA 3CZSA 3EJTA 5KBPA 3DOBA 1SUFA 2YL6A 1UPXA 5C5BA 4R5JA 3OHXM 3HAIA 2JNKA 2D1LA 1GNLA 3L3PA 4PO2A 1HWWA 3D52A 2JNSA 2OW6A 3EJSA 2GAFD 4JWDA 2F18A 1TQVA 2LM0A 2Z8YA 1TQWA 3B53X 1BPRA 3QNJA 2YLAA 4G6QA 5C5BB 4H6HA 3DDFA 1URUA 1R33A 2EX3B 3T46A 2F7PA 4AZGA 2X3VA 2KHOA 3G9GA 1MJGA 2EFKA 5FIGA 2ELBA 2EWFA 2RAJA 4H8SA 2Q13A 4E81A 2PMRA 3M3WA 4AVMA 4I1QA 3BUDA 3VEAA 3DX3A 3B52X 3I01A 3HAHA 3RV1A 2Z0OA 3T4AG 3BUQA 2X3WA 3T47A 4EZPA 3KDRA 2V7YA 1I49A 1TQUA 2O0I1 4DCNC 3BVTA 1HXKA 2F1AA 2F7RA 3D2FA 4JL9A 3B51X 4EZQA 1QWUA 1SU6A 2NCZA 3C7NA 3BVXA 2FICA 3FD9A 4JN4A 2LXYA 1DKZA 1O7DB 1X04A 3D2EA 3D50A 1I4LA 4ATMA 2WYHA 3CKDA 5FLEX 4B9QA 4WV7A 3SYVA 1U00A 4ILIA 4AZCA 2RT6A 1PS3A 1R5EA 4EZSA 1WDZA 2OZNB 4UDYX 3BLBA 3C7NB 3O3NB
chains in the Genus database with same CATH topology
4FL9A 2YI8A 1W9MA 2WINM 3B53X 2YIAA 1BPRA 1DKXA 3QNJA 2OBMA 4EZRA 4G6QA 3N8EA 3SBTB 3I04A 4EZWA 1OA0A 4IW0A 1SU7A 4H6HA 3RV0A 4KIKB 2EX3B 3KAWA 3T46A 3UITA 2OBLA 3T48A 4EZXA 4D8JA 2KHOA 1MJGA 4EZTA 3T49A 5FIGA 3DPPA 2EWFA 4IM3A 4HY9A 3VKHA 4EZZA 3ER9B 4E81A 3A98A 1YUWA 1OAOA 4M0MA 4H6IA 2X5CA 3VEAA 4ILGA 4F01A 3B52X 3I01A 3KAVA 3DPOA 3RV1A 5E84A 4HR1A 4IWQA 1E9VA 4UDXX 3DPQA 3T4AG 4JNEA 3SBSA 2GA9D 2QXLA 3T47A 4WV5A 4JWEA 4EZPA 2YIVX 3KDRA 2V7YA 4IWOA 4F00A 3O3MB 3OWGA 1Q5LA 2ND1A 3ER8C 4JWCA 2QFFA 3O3OB 4E3CA 4HR1B 4NPHA 1JQKA 3I39X 3GI7A 4JLCA 3D2FA 4JL9A 3B51X 4EZQA 3DQGA 1SU6A 4R5LA 1GN9A 2NCZA 3C7NA 4EZVA 4EZYA 4EZUA 2BPRA 2N3KA 3FD9A 4JN4A 4EZNA 2ND0A 7HSCA 1DKYA 2PY6A 3DOBA 1OA1A 1SU8A 1SUFA 1ZYLA 2YI9A 1DKZA 4FM3A 1CKRA 1UPXA 4HYBA 2OP6A 4R5IA 1E1DA 5TKYA 3D2EA 1GNTA 4KIKA 4R5JA 3H0XA 4JWIA 3OHXM 2YIBA 4I43A 3LMFA 4IWPA 4JNFA 5FLEX 4B9QA 4WV7A 4R5KA 4EZOA 4IM0A 1GNLA 1U00A 4ILIA 3L3OM 4PO2A 3ZEDA 2RT6A 3ERCC 2JNSA 4ILHB 4MQDA 3VEBA 1E2UA 3ZEFA 4EZSA 2GAFD 4JWDA 4UDYX 3QA8A 3C7NB 1DG4A 3O3NB 4R5GA 2LM0A 4IM2A 2Z8YA 3F7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FL9 A;  4EZZ A;  4E81 A;  1YUW A;  4JNF A;  2WIN M;  3D2F A;  4H6I A;  4B9Q A;  4WV7 A;  4R5K A;  1DKX A;  3QNJ A;  4EZO A;  4EZQ A;  4R5L A;  4EZR A;  1BPR A;  3DQG A;  4F01 A;  3N8E A;  3C7N A;  4EZV A;  4EZW A;  4EZY A;  1U00 A;  4EZU A;  2BPR A;  3L3O M;  4H6H A;  3DPO A;  4PO2 A;  4JN4 A;  5E84 A;  4EZN A;  7HSC A;  1DKY A;  3T46 A;  3DPQ A;  3T4A G;  4JNE A;  3DOB A;  2QXL A;  3T48 A;  1DKZ A;  4EZS A;  1CKR A;  3T47 A;  4WV5 A;  4JWD A;  4HYB A;  4JWE A;  4EZP A;  4EZX A;  2OP6 A;  2V7Y A;  2KHO A;  4R5I A;  4EZT A;  3T49 A;  4F00 A;  1Q5L A;  5TKY A;  3C7N B;  3D2E A;  4R5G A;  1DG4 A;  4JWC A;  2QFF A;  3DPP A;  4R5J A;  3H0X A;  4HY9 A;  4JWI A;  3OHX M; 
#chains in the Genus database with same CATH topology
 2YI8 A;  3CZN A;  4FZS A;  4EZR A;  2OBM A;  4AZB A;  4EZW A;  1OA0 A;  4IW0 A;  2ZXQ A;  1X03 A;  2OBL A;  3PLT A;  4AZ5 A;  4EZT A;  3T49 A;  4AZC B;  1O7D C;  2ALW A;  4HY9 A;  4IM3 A;  4NSW A;  3BVV A;  1YUW A;  1OAO A;  3DX4 A;  2RAK A;  4ILG A;  2OO2 A;  3CVR A;  3ACO A;  3DPQ A;  2GA9 D;  2QXL A;  4WV5 A;  4IWO A;  3EJU A;  3BUB A;  2FYV A;  3Q84 A;  4NPH A;  4FZP A;  4JLC A;  4AZI A;  4R5L A;  4EZU A;  2BPR A;  2N3K A;  1R34 A;  2PY6 A;  1SU8 A;  2YI9 A;  2OP6 A;  3HAJ A;  1E1D A;  5TKY A;  3BUI A;  1GNT A;  4WPE A;  4KIK A;  3H0X A;  2YIB A;  3RPM A;  4IWP A;  2Z0N A;  4AKV A;  3SOG A;  3OK8 A;  2V0O A;  3QE6 A;  3VEB A;  4MQD A;  2Q12 A;  1TQS A;  3CAZ A;  2C08 A;  3LLL A;  4IM2 A;  4FL9 A;  1W9M A;  2WIN M;  3Q0K A;  2YIA A;  3I04 A;  4NQI A;  1SU7 A;  4KIK B;  3KAW A;  3UIT A;  3T48 A;  3QNI A;  4EZX A;  3I2W A;  3BUP A;  3DPP A;  2Z0V A;  2RAI A;  2YKT A;  1TQT A;  4EZZ A;  4M0M A;  4H6I A;  2X5C A;  4F01 A;  4AZH A;  4BNE A;  3KAV A;  3DPO A;  1YWM A;  5E84 A;  2MI7 A;  4JNE A;  3SBS A;  1I4T A;  2YIV X;  4F00 A;  3OWG A;  2ND1 A;  3EJR A;  3ER8 C;  2YL5 A;  3LVT A;  3QWE A;  2QFF A;  4E3C A;  4HR1 B;  1JQK A;  3I39 X;  2D4C A;  3GI7 A;  1Y2O A;  3DX0 A;  3D4Z A;  2QKW A;  4EZN A;  2ND0 A;  1DKY A;  4DYL A;  1OA1 A;  1ZYL A;  4FM3 A;  1CKR A;  4WPC A;  4HYB A;  3DX1 A;  4R5I A;  2GF4 A;  1ZWW A;  3DYT A;  4JWI A;  4I43 A;  3LMF A;  4JNF A;  1QWN A;  2WYI A;  4R5K A;  4EZO A;  4IM0 A;  4AZ7 A;  3L3O M;  3ZED A;  3ERC C;  4ILH B;  3EJQ A;  2YL8 A;  1E2U A;  2F1B A;  3ZEF A;  1QX1 A;  2EFL A;  3QA8 A;  1DG4 A;  4R5G A;  2OW7 A;  3BVU A;  3F7W A;  3DX2 A;  3D51 A;  1I4D A;  1DKX A;  3N8E A;  3SBT B;  2F7Q A;  3RV0 A;  3ABH A;  2YLL A;  2F7O A;  4D8J A;  2X3X A;  3VKH A;  3ER9 B;  3A98 A;  3D4Y A;  3EJP A;  4FZO A;  4HR1 A;  4IWQ A;  1E9V A;  4UDX X;  4JWE A;  3O3M B;  1Q5L A;  4JWC A;  3O3O B;  1LQ7 A;  2YL9 A;  4AZ6 A;  3DQG A;  3CV5 A;  3DDG A;  1GN9 A;  4EZV A;  4EZY A;  1HTY A;  3BVW A;  7HSC A;  3CZS A;  3EJT A;  5KBP A;  3DOB A;  1SUF A;  2YL6 A;  1UPX A;  5C5B A;  4R5J A;  3OHX M;  3HAI A;  2JNK A;  2D1L A;  1GNL A;  3L3P A;  4PO2 A;  1HWW A;  3D52 A;  2JNS A;  2OW6 A;  3EJS A;  2GAF D;  4JWD A;  2F18 A;  1TQV A;  2LM0 A;  2Z8Y A;  1TQW A;  3B53 X;  1BPR A;  3QNJ A;  2YLA A;  4G6Q A;  5C5B B;  4H6H A;  3DDF A;  1URU A;  1R33 A;  2EX3 B;  3T46 A;  2F7P A;  4AZG A;  2X3V A;  2KHO A;  3G9G A;  1MJG A;  2EFK A;  5FIG A;  2ELB A;  2EWF A;  2RAJ A;  4H8S A;  2Q13 A;  4E81 A;  2PMR A;  3M3W A;  4AVM A;  4I1Q A;  3BUD A;  3VEA A;  3DX3 A;  3B52 X;  3I01 A;  3HAH A;  3RV1 A;  2Z0O A;  3T4A G;  3BUQ A;  2X3W A;  3T47 A;  4EZP A;  3KDR A;  2V7Y A;  1I49 A;  1TQU A;  2O0I 1;  4DCN C;  3BVT A;  1HXK A;  2F1A A;  2F7R A;  3D2F A;  4JL9 A;  3B51 X;  4EZQ A;  1QWU A;  1SU6 A;  2NCZ A;  3C7N A;  3BVX A;  2FIC A;  3FD9 A;  4JN4 A;  2LXY A;  1DKZ A;  1O7D B;  1X04 A;  3D2E A;  3D50 A;  1I4L A;  4ATM A;  2WYH A;  3CKD A;  5FLE X;  4B9Q A;  4WV7 A;  3SYV A;  1U00 A;  4ILI A;  4AZC A;  2RT6 A;  1PS3 A;  1R5E A;  4EZS A;  1WDZ A;  2OZN B;  4UDY X;  3BLB A;  3C7N B;  3O3N B; 
#chains in the Genus database with same CATH homology
 4FL9 A;  2YI8 A;  1W9M A;  2WIN M;  3B53 X;  2YIA A;  1BPR A;  1DKX A;  3QNJ A;  2OBM A;  4EZR A;  4G6Q A;  3N8E A;  3SBT B;  3I04 A;  4EZW A;  1OA0 A;  4IW0 A;  1SU7 A;  4H6H A;  3RV0 A;  4KIK B;  2EX3 B;  3KAW A;  3T46 A;  3UIT A;  2OBL A;  3T48 A;  4EZX A;  4D8J A;  2KHO A;  1MJG A;  4EZT A;  3T49 A;  5FIG A;  3DPP A;  2EWF A;  4IM3 A;  4HY9 A;  3VKH A;  4EZZ A;  3ER9 B;  4E81 A;  3A98 A;  1YUW A;  1OAO A;  4M0M A;  4H6I A;  2X5C A;  3VEA A;  4ILG A;  4F01 A;  3B52 X;  3I01 A;  3KAV A;  3DPO A;  3RV1 A;  5E84 A;  4HR1 A;  4IWQ A;  1E9V A;  4UDX X;  3DPQ A;  3T4A G;  4JNE A;  3SBS A;  2GA9 D;  2QXL A;  3T47 A;  4WV5 A;  4JWE A;  4EZP A;  2YIV X;  3KDR A;  2V7Y A;  4IWO A;  4F00 A;  3O3M B;  3OWG A;  1Q5L A;  2ND1 A;  3ER8 C;  4JWC A;  2QFF A;  3O3O B;  4E3C A;  4HR1 B;  4NPH A;  1JQK A;  3I39 X;  3GI7 A;  4JLC A;  3D2F A;  4JL9 A;  3B51 X;  4EZQ A;  3DQG A;  1SU6 A;  4R5L A;  1GN9 A;  2NCZ A;  3C7N A;  4EZV A;  4EZY A;  4EZU A;  2BPR A;  2N3K A;  3FD9 A;  4JN4 A;  4EZN A;  2ND0 A;  7HSC A;  1DKY A;  2PY6 A;  3DOB A;  1OA1 A;  1SU8 A;  1SUF A;  1ZYL A;  2YI9 A;  1DKZ A;  4FM3 A;  1CKR A;  1UPX A;  4HYB A;  2OP6 A;  4R5I A;  1E1D A;  5TKY A;  3D2E A;  1GNT A;  4KIK A;  4R5J A;  3H0X A;  4JWI A;  3OHX M;  2YIB A;  4I43 A;  3LMF A;  4IWP A;  4JNF A;  5FLE X;  4B9Q A;  4WV7 A;  4R5K A;  4EZO A;  4IM0 A;  1GNL A;  1U00 A;  4ILI A;  3L3O M;  4PO2 A;  3ZED A;  2RT6 A;  3ERC C;  2JNS A;  4ILH B;  4MQD A;  3VEB A;  1E2U A;  3ZEF A;  4EZS A;  2GAF D;  4JWD A;  4UDY X;  3QA8 A;  3C7N B;  1DG4 A;  3O3N B;  4R5G A;  2LM0 A;  4IM2 A;  2Z8Y A;  3F7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...