3DOBA

Peptide-binding domain of heat shock 70 kda protein f44e5.5 from c.elegans.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
145
Chain Sequence
DVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFNIDANGILNVSAEDKSTGKSNRITIQNETQSDIDRMVHEAKQFEKEDGEQRERVQARNQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein F44E5.5
publication title X-ray crystal structure of Peptide-binding domain of Heat shock 70 kDa protein F44E5.5 from C.elegans.
rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 37
structure length 145
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3dobA00
1DKZA 4R5LA 5E84A 3C7NB 4F01A 4WV5A 5TKYA 4JNFA 1Q5LA 4EZYA 4R5JA 1YUWA 3DQGA 4EZUA 4JN4A 4HYBA 4EZRA 4EZSA 1CKRA 4F00A 4JWEA 4R5IA 4EZQA 4WV7A 2OP6A 2V7YA 3QNJA 4EZTA 4E81A 3C7NA 3D2EA 3D2FA 3DPQA 3N8EA 1BPRA 4JWCA 4R5KA 4EZVA 1DKXA 4EZZA 4EZOA 3DOBA 4PO2A 1DG4A 1U00A 2QXLA 4EZWA 2KHOA 4FL9A 4EZNA 4EZXA 3H0XA 3DPOA 7HSCA 1DKYA 4EZPA 4B9QA 4JWIA 4JNEA 4R5GA 3DPPA 2BPRA 4JWDA 4HY9A
chains in the Genus database with same CATH superfamily
1DKZA 4R5LA 5E84A 3C7NB 4ILGA 4F01A 4WV5A 5TKYA 4JNFA 1Q5LA 4EZYA 4R5JA 1YUWA 3DQGA 4EZUA 4JN4A 4HYBA 4EZRA 4EZSA 1CKRA 4F00A 3ZEFA 4JWEA 4ILHB 4R5IA 4EZQA 4WV7A 2OP6A 2V7YA 3QNJA 4EZTA 4E81A 3C7NA 3D2EA 3D2FA 3DPQA 3N8EA 1BPRA 4JWCA 4R5KA 4EZVA 1DKXA 4EZZA 3SBTB 3DOBA 4EZOA 4PO2A 1DG4A 1U00A 2QXLA 4MQDA 2KHOA 4FL9A 4EZNA 4EZWA 3H0XA 4EZXA 3DPOA 3SBSA 1DKYA 7HSCA 4EZPA 4I43A 4B9QA 4JWIA 4JNEA 4R5GA 3DPPA 2BPRA 4JWDA 4ILIA 4HY9A
chains in the Genus database with same CATH topology
1DKZA 4R5LA 5E84A 3C7NB 4ILGA 4F01A 4WV5A 5TKYA 4JNFA 1Q5LA 4EZYA 4R5JA 1YUWA 3DQGA 4EZUA 4JN4A 4HYBA 4EZRA 4EZSA 1CKRA 4F00A 3ZEFA 4JWEA 4ILHB 4R5IA 4EZQA 4WV7A 2OP6A 2V7YA 3QNJA 4EZTA 4E81A 3C7NA 3D2EA 3D2FA 3DPQA 3N8EA 1BPRA 4JWCA 4R5KA 4EZVA 1DKXA 4EZZA 3SBTB 3DOBA 4EZOA 4PO2A 1DG4A 1U00A 2QXLA 4MQDA 2KHOA 4FL9A 4EZNA 4EZWA 3H0XA 4EZXA 3DPOA 3SBSA 1DKYA 7HSCA 4EZPA 4I43A 4B9QA 4JWIA 4JNEA 4R5GA 3DPPA 2BPRA 4JWDA 4ILIA 4HY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKZ A;  4R5L A;  5E84 A;  3C7N B;  4F01 A;  4WV5 A;  5TKY A;  4JNF A;  1Q5L A;  4EZY A;  4R5J A;  1YUW A;  3DQG A;  4EZU A;  4JN4 A;  4HYB A;  4EZR A;  4EZS A;  1CKR A;  4F00 A;  4JWE A;  4R5I A;  4EZQ A;  4WV7 A;  2OP6 A;  2V7Y A;  3QNJ A;  4EZT A;  4E81 A;  3C7N A;  3D2E A;  3D2F A;  3DPQ A;  3N8E A;  1BPR A;  4JWC A;  4R5K A;  4EZV A;  1DKX A;  4EZZ A;  4EZO A;  3DOB A;  4PO2 A;  1DG4 A;  1U00 A;  2QXL A;  4EZW A;  2KHO A;  4FL9 A;  4EZN A;  4EZX A;  3H0X A;  3DPO A;  7HSC A;  1DKY A;  4EZP A;  4B9Q A;  4JWI A;  4JNE A;  4R5G A;  3DPP A;  2BPR A;  4JWD A;  4HY9 A; 
#chains in the Genus database with same CATH topology
 1DKZ A;  4R5L A;  5E84 A;  3C7N B;  4ILG A;  4F01 A;  4WV5 A;  5TKY A;  4JNF A;  1Q5L A;  4EZY A;  4R5J A;  1YUW A;  3DQG A;  4EZU A;  4JN4 A;  4HYB A;  4EZR A;  4EZS A;  1CKR A;  4F00 A;  3ZEF A;  4JWE A;  4ILH B;  4R5I A;  4EZQ A;  4WV7 A;  2OP6 A;  2V7Y A;  3QNJ A;  4EZT A;  4E81 A;  3C7N A;  3D2E A;  3D2F A;  3DPQ A;  3N8E A;  1BPR A;  4JWC A;  4R5K A;  4EZV A;  1DKX A;  4EZZ A;  3SBT B;  3DOB A;  4EZO A;  4PO2 A;  1DG4 A;  1U00 A;  2QXL A;  4MQD A;  2KHO A;  4FL9 A;  4EZN A;  4EZW A;  3H0X A;  4EZX A;  3DPO A;  3SBS A;  1DKY A;  7HSC A;  4EZP A;  4I43 A;  4B9Q A;  4JWI A;  4JNE A;  4R5G A;  3DPP A;  2BPR A;  4JWD A;  4ILI A;  4HY9 A; 
#chains in the Genus database with same CATH homology
 1DKZ A;  4R5L A;  5E84 A;  3C7N B;  4ILG A;  4F01 A;  4WV5 A;  5TKY A;  4JNF A;  1Q5L A;  4EZY A;  4R5J A;  1YUW A;  3DQG A;  4EZU A;  4JN4 A;  4HYB A;  4EZR A;  4EZS A;  1CKR A;  4F00 A;  3ZEF A;  4JWE A;  4ILH B;  4R5I A;  4EZQ A;  4WV7 A;  2OP6 A;  2V7Y A;  3QNJ A;  4EZT A;  4E81 A;  3C7N A;  3D2E A;  3D2F A;  3DPQ A;  3N8E A;  1BPR A;  4JWC A;  4R5K A;  4EZV A;  1DKX A;  4EZZ A;  3SBT B;  3DOB A;  4EZO A;  4PO2 A;  1DG4 A;  1U00 A;  2QXL A;  4MQD A;  2KHO A;  4FL9 A;  4EZN A;  4EZW A;  3H0X A;  4EZX A;  3DPO A;  3SBS A;  1DKY A;  7HSC A;  4EZP A;  4I43 A;  4B9Q A;  4JWI A;  4JNE A;  4R5G A;  3DPP A;  2BPR A;  4JWD A;  4ILI A;  4HY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...