1DKZA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 native crystals
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (molecular chaperone/peptide)
molecule keywords SUBSTRATE BINDING DOMAIN OF DNAK
publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
total genus 62
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkzA01
4EZNA 5E84A 4R5LA 4EZQA 4PO2A 1Q5LA 4EZXA 2V7YA 3DPOA 1DKZA 3T46A 2QXLA 1BPRA 4EZYA 4EZTA 3T49A 2KHOA 4EZUA 4HY9A 3DPPA 3T48A 4EZZA 3C7NA 4JWEA 4JN4A 4EZSA 4FL9A 3QNJA 3L3OM 1YUWA 4H6IA 5TKYA 4H6HA 4R5IA 1CKRA 3D2EA 2WINM 2QFFA 3DQGA 3H0XA 4B9QA 7HSCA 3DOBA 4JWDA 4EZOA 4JWCA 2BPRA 4WV7A 3C7NB 4R5KA 1DKYA 4JNEA 4EZPA 4WV5A 3OHXM 4JWIA 4EZVA 2OP6A 4JNFA 4R5JA 4EZRA 4EZWA 4R5GA 3T47A 1DKXA 4HYBA 4E81A 3DPQA 3D2FA 4F01A 1DG4A 3N8EA 1U00A 3T4AG 4F00A
chains in the Genus database with same CATH superfamily
1E2UA 4R5LA 3QE6A 4DYLA 2QXLA 3BUBA 2LXYA 1E1DA 1ZYLA 2YLAA 4IM3A 2D4CA 4NQIA 2X3WA 1R33A 3CKDA 2FICA 3D2FA 3ZEDA 5C5BB 1Q5LA 3CAZA 2OZNB 3Q0KA 4NPHA 3DPOA 1X04A 4ILHB 4JWEA 3CV5A 3ZEFA 4KIKA 2YI8A 2YIAA 3C7NB 3SBSA 4R5GA 2ELBA 3OK8A 4UDYX 1X03A 1TQUA 4PO2A 3F7WA 4BNEA 1E9VA 3RV1A 3T49A 2OBLA 4EZZA 2MI7A 5TKYA 3A98A 3KAWA 2OBMA 2V0OA 3T47A 1W9MA 1GNLA 3DX2A 1U00A 4EZQA 2V7YA 3M3WA 3ABHA 1TQTA 2YL6A 2O0I1 3T48A 3BVVA 2X5CA 4H6IA 3O3MB 4IWQA 3QWEA 4R5IA 4WPCA 2Z0OA 4G6QA 2ND0A 2YLLA 1R34A 2OO2A 4AZBA 1I4TA 4FM3A 1MJGA 5E84A 2NCZA 4EZXA 3KDRA 1OA1A 2F1BA 3ERCC 4EZUA 4JN4A 1YWMA 1R5EA 1YUWA 4AZIA 1HTYA 2Q13A 5C5BA 4JWIA 2ALWA 1SU6A 2YL5A 3B52X 2EFLA 1TQSA 3N8EA 1I49A 2ND1A 3VKHA 2EWFA 3EJTA 4AZCA 3HAIA 3CZSA 3DYTA 2YI9A 2FYVA 3C7NA 1PS3A 1JQKA 2GF4A 4JWCA 2YL8A 1OAOA 4EZVA 3O3OB 4F01A 1OA0A 3O3NB 1HXKA 4ILGA 4AZHA 3T4AG 4F00A 4UDXX 2X3XA 3D4ZA 1O7DC 2RAJA 4EZSA 3DPPA 2YIBA 3QNJA 1TQWA 3BVUA 3EJRA 4AZCB 4EZPA 4JNEA 2F7RA 3B53X 2OW6A 2OP6A 2D1LA 3FD9A 4EZWA 4JL9A 1QWUA 2GA9D 2ZXQA 1GNTA 3DX0A 3DX3A 4EZNA 4EZTA 3VEBA 3DDFA 3UITA 4M0MA 2BPRA 4WV5A 2PY6A 3BUPA 4JNFA 2QKWA 2EX3B 4AKVA 3I2WA 2C08A 3EJUA 1URUA 4HY9A 3QA8A 2Z0VA 2N3KA 2F1AA 1TQVA 2F7OA 3H0XA 4IM2A 4B9QA 3DOBA 1I4DA 3EJSA 3VEAA 2PMRA 3DPQA 2YIVX 3CVRA 4IW0A 3BVWA 2LM0A 1SUFA 1CKRA 2QFFA 3ER8C 3SYVA 4JWDA 4IWPA 4DCNC 1HWWA 2JNKA 4R5JA 4EZRA 4HYBA 4E81A 1Y2OA 3BLBA 2KHOA 3LVTA 3DX1A 7HSCA 4HR1B 3BUQA 4H8SA 4FZSA 3CZNA 2GAFD 2WYIA 1O7DB 3D4YA 3D50A 5FIGA 3QNIA 1BPRA 2Z8YA 4ATMA 3BVTA 3I39X 2F7PA 5KBPA 4I43A 2OW7A 3OWGA 1WDZA 4WV7A 3EJPA 4NSWA 3SOGA 3G9GA 2YKTA 2RT6A 3L3OM 1ZWWA 4H6HA 3BUIA 2EFKA 4IM0A 3KAVA 3LMFA 5FLEX 2RAIA 1SU7A 3OHXM 2F7QA 3D52A 3T46A 3EJQA 4ILIA 4IWOA 3LLLA 2Z0NA 3D2EA 3DX4A 4I1QA 2Q12A 2WYHA 3RPMA 4AZ5A 1SU8A 3SBTB 3PLTA 1I4LA 1DKYA 1DKXA 2YL9A 4WPEA 4KIKB 1LQ7A 4AZ7A 3BVXA 4HR1A 4EZYA 3B51X 1GN9A 4AZGA 2RAKA 4FZOA 4JLCA 3DDGA 3RV0A 4AVMA 3DQGA 3HAHA 1UPXA 3ACOA 2X3VA 2F18A 4D8JA 3L3PA 1QWNA 3BUDA 3D51A 1DKZA 3I04A 2JNSA 4AZ6A 3GI7A 4FL9A 3ER9B 2WINM 4EZOA 4R5KA 3Q84A 3I01A 4FZPA 4E3CA 1QX1A 3HAJA 1DG4A 4MQDA
chains in the Genus database with same CATH topology
1E2UA 5E84A 2NCZA 4R5LA 4EZXA 3KDRA 1OA1A 2QXLA 3ERCC 4EZUA 4HY9A 3QA8A 4JN4A 2N3KA 1E1DA 1ZYLA 3L3OM 1YUWA 4H6HA 4IM0A 4IM3A 3H0XA 3KAVA 4IM2A 4B9QA 3DOBA 3LMFA 5FLEX 1SU7A 3OHXM 3VEAA 4JWIA 3DPQA 1SU6A 3D2FA 3ZEDA 3B52X 3N8EA 2YIVX 2ND1A 3VKHA 1MJGA 1Q5LA 2EWFA 4NPHA 3DPOA 4IW0A 3T46A 4ILHB 2LM0A 4ILIA 2YI9A 4IWOA 3C7NA 4JWEA 1SUFA 1JQKA 1CKRA 3D2EA 2QFFA 3ER8C 3ZEFA 4JWDA 1SU8A 3SBTB 4JWCA 4KIKA 2YI8A 1OAOA 2YIAA 3C7NB 1DKYA 4EZVA 3O3OB 4IWPA 4R5JA 4EZRA 3SBSA 4R5GA 1OA0A 1DKXA 3O3NB 4HYBA 4E81A 4F01A 4ILGA 4UDYX 3T4AG 4KIKB 4F00A 4UDXX 4PO2A 3F7WA 1E9VA 4HR1A 3RV1A 3T49A 2OBLA 4EZYA 2KHOA 4EZSA 3DPPA 3B51X 4EZZA 1GN9A 2YIBA 3QNJA 4JLCA 5TKYA 3A98A 3RV0A 3DQGA 7HSCA 4HR1B 1UPXA 3KAWA 2OBMA 4EZPA 4JNEA 2GAFD 3B53X 2OP6A 3FD9A 4EZWA 3T47A 4JL9A 1W9MA 1GNLA 2GA9D 1U00A 1GNTA 5FIGA 4EZNA 4EZQA 4D8JA 2V7YA 1DKZA 3I04A 2JNSA 1BPRA 4EZTA 2Z8YA 3T48A 3VEBA 3I39X 3GI7A 4FL9A 3UITA 2X5CA 3ER9B 4H6IA 3O3MB 4IWQA 4R5IA 2WINM 4I43A 3OWGA 4M0MA 4G6QA 4EZOA 2BPRA 4WV7A 4R5KA 4WV5A 3I01A 2PY6A 4JNFA 2ND0A 4E3CA 2RT6A 1DG4A 4MQDA 4FM3A 2EX3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZN A;  5E84 A;  4R5L A;  4EZQ A;  4PO2 A;  1Q5L A;  4EZX A;  2V7Y A;  3DPO A;  1DKZ A;  3T46 A;  2QXL A;  1BPR A;  4EZY A;  4EZT A;  3T49 A;  2KHO A;  4EZU A;  4HY9 A;  3DPP A;  3T48 A;  4EZZ A;  3C7N A;  4JWE A;  4JN4 A;  4EZS A;  4FL9 A;  3QNJ A;  3L3O M;  1YUW A;  4H6I A;  5TKY A;  4H6H A;  4R5I A;  1CKR A;  3D2E A;  2WIN M;  2QFF A;  3DQG A;  3H0X A;  4B9Q A;  7HSC A;  3DOB A;  4JWD A;  4EZO A;  4JWC A;  2BPR A;  4WV7 A;  3C7N B;  4R5K A;  1DKY A;  4JNE A;  4EZP A;  4WV5 A;  3OHX M;  4JWI A;  4EZV A;  2OP6 A;  4JNF A;  4R5J A;  4EZR A;  4EZW A;  4R5G A;  3T47 A;  1DKX A;  4HYB A;  4E81 A;  3DPQ A;  3D2F A;  4F01 A;  1DG4 A;  3N8E A;  1U00 A;  3T4A G;  4F00 A; 
#chains in the Genus database with same CATH topology
 1E2U A;  4R5L A;  3QE6 A;  4DYL A;  2QXL A;  3BUB A;  2LXY A;  1E1D A;  1ZYL A;  2YLA A;  4IM3 A;  2D4C A;  4NQI A;  2X3W A;  1R33 A;  3CKD A;  2FIC A;  3D2F A;  3ZED A;  5C5B B;  1Q5L A;  3CAZ A;  2OZN B;  3Q0K A;  4NPH A;  3DPO A;  1X04 A;  4ILH B;  4JWE A;  3CV5 A;  3ZEF A;  4KIK A;  2YI8 A;  2YIA A;  3C7N B;  3SBS A;  4R5G A;  2ELB A;  3OK8 A;  4UDY X;  1X03 A;  1TQU A;  4PO2 A;  3F7W A;  4BNE A;  1E9V A;  3RV1 A;  3T49 A;  2OBL A;  4EZZ A;  2MI7 A;  5TKY A;  3A98 A;  3KAW A;  2OBM A;  2V0O A;  3T47 A;  1W9M A;  1GNL A;  3DX2 A;  1U00 A;  4EZQ A;  2V7Y A;  3M3W A;  3ABH A;  1TQT A;  2YL6 A;  2O0I 1;  3T48 A;  3BVV A;  2X5C A;  4H6I A;  3O3M B;  4IWQ A;  3QWE A;  4R5I A;  4WPC A;  2Z0O A;  4G6Q A;  2ND0 A;  2YLL A;  1R34 A;  2OO2 A;  4AZB A;  1I4T A;  4FM3 A;  1MJG A;  5E84 A;  2NCZ A;  4EZX A;  3KDR A;  1OA1 A;  2F1B A;  3ERC C;  4EZU A;  4JN4 A;  1YWM A;  1R5E A;  1YUW A;  4AZI A;  1HTY A;  2Q13 A;  5C5B A;  4JWI A;  2ALW A;  1SU6 A;  2YL5 A;  3B52 X;  2EFL A;  1TQS A;  3N8E A;  1I49 A;  2ND1 A;  3VKH A;  2EWF A;  3EJT A;  4AZC A;  3HAI A;  3CZS A;  3DYT A;  2YI9 A;  2FYV A;  3C7N A;  1PS3 A;  1JQK A;  2GF4 A;  4JWC A;  2YL8 A;  1OAO A;  4EZV A;  3O3O B;  4F01 A;  1OA0 A;  3O3N B;  1HXK A;  4ILG A;  4AZH A;  3T4A G;  4F00 A;  4UDX X;  2X3X A;  3D4Z A;  1O7D C;  2RAJ A;  4EZS A;  3DPP A;  2YIB A;  3QNJ A;  1TQW A;  3BVU A;  3EJR A;  4AZC B;  4EZP A;  4JNE A;  2F7R A;  3B53 X;  2OW6 A;  2OP6 A;  2D1L A;  3FD9 A;  4EZW A;  4JL9 A;  1QWU A;  2GA9 D;  2ZXQ A;  1GNT A;  3DX0 A;  3DX3 A;  4EZN A;  4EZT A;  3VEB A;  3DDF A;  3UIT A;  4M0M A;  2BPR A;  4WV5 A;  2PY6 A;  3BUP A;  4JNF A;  2QKW A;  2EX3 B;  4AKV A;  3I2W A;  2C08 A;  3EJU A;  1URU A;  4HY9 A;  3QA8 A;  2Z0V A;  2N3K A;  2F1A A;  1TQV A;  2F7O A;  3H0X A;  4IM2 A;  4B9Q A;  3DOB A;  1I4D A;  3EJS A;  3VEA A;  2PMR A;  3DPQ A;  2YIV X;  3CVR A;  4IW0 A;  3BVW A;  2LM0 A;  1SUF A;  1CKR A;  2QFF A;  3ER8 C;  3SYV A;  4JWD A;  4IWP A;  4DCN C;  1HWW A;  2JNK A;  4R5J A;  4EZR A;  4HYB A;  4E81 A;  1Y2O A;  3BLB A;  2KHO A;  3LVT A;  3DX1 A;  7HSC A;  4HR1 B;  3BUQ A;  4H8S A;  4FZS A;  3CZN A;  2GAF D;  2WYI A;  1O7D B;  3D4Y A;  3D50 A;  5FIG A;  3QNI A;  1BPR A;  2Z8Y A;  4ATM A;  3BVT A;  3I39 X;  2F7P A;  5KBP A;  4I43 A;  2OW7 A;  3OWG A;  1WDZ A;  4WV7 A;  3EJP A;  4NSW A;  3SOG A;  3G9G A;  2YKT A;  2RT6 A;  3L3O M;  1ZWW A;  4H6H A;  3BUI A;  2EFK A;  4IM0 A;  3KAV A;  3LMF A;  5FLE X;  2RAI A;  1SU7 A;  3OHX M;  2F7Q A;  3D52 A;  3T46 A;  3EJQ A;  4ILI A;  4IWO A;  3LLL A;  2Z0N A;  3D2E A;  3DX4 A;  4I1Q A;  2Q12 A;  2WYH A;  3RPM A;  4AZ5 A;  1SU8 A;  3SBT B;  3PLT A;  1I4L A;  1DKY A;  1DKX A;  2YL9 A;  4WPE A;  4KIK B;  1LQ7 A;  4AZ7 A;  3BVX A;  4HR1 A;  4EZY A;  3B51 X;  1GN9 A;  4AZG A;  2RAK A;  4FZO A;  4JLC A;  3DDG A;  3RV0 A;  4AVM A;  3DQG A;  3HAH A;  1UPX A;  3ACO A;  2X3V A;  2F18 A;  4D8J A;  3L3P A;  1QWN A;  3BUD A;  3D51 A;  1DKZ A;  3I04 A;  2JNS A;  4AZ6 A;  3GI7 A;  4FL9 A;  3ER9 B;  2WIN M;  4EZO A;  4R5K A;  3Q84 A;  3I01 A;  4FZP A;  4E3C A;  1QX1 A;  3HAJ A;  1DG4 A;  4MQD A; 
#chains in the Genus database with same CATH homology
 1E2U A;  5E84 A;  2NCZ A;  4R5L A;  4EZX A;  3KDR A;  1OA1 A;  2QXL A;  3ERC C;  4EZU A;  4HY9 A;  3QA8 A;  4JN4 A;  2N3K A;  1E1D A;  1ZYL A;  3L3O M;  1YUW A;  4H6H A;  4IM0 A;  4IM3 A;  3H0X A;  3KAV A;  4IM2 A;  4B9Q A;  3DOB A;  3LMF A;  5FLE X;  1SU7 A;  3OHX M;  3VEA A;  4JWI A;  3DPQ A;  1SU6 A;  3D2F A;  3ZED A;  3B52 X;  3N8E A;  2YIV X;  2ND1 A;  3VKH A;  1MJG A;  1Q5L A;  2EWF A;  4NPH A;  3DPO A;  4IW0 A;  3T46 A;  4ILH B;  2LM0 A;  4ILI A;  2YI9 A;  4IWO A;  3C7N A;  4JWE A;  1SUF A;  1JQK A;  1CKR A;  3D2E A;  2QFF A;  3ER8 C;  3ZEF A;  4JWD A;  1SU8 A;  3SBT B;  4JWC A;  4KIK A;  2YI8 A;  1OAO A;  2YIA A;  3C7N B;  1DKY A;  4EZV A;  3O3O B;  4IWP A;  4R5J A;  4EZR A;  3SBS A;  4R5G A;  1OA0 A;  1DKX A;  3O3N B;  4HYB A;  4E81 A;  4F01 A;  4ILG A;  4UDY X;  3T4A G;  4KIK B;  4F00 A;  4UDX X;  4PO2 A;  3F7W A;  1E9V A;  4HR1 A;  3RV1 A;  3T49 A;  2OBL A;  4EZY A;  2KHO A;  4EZS A;  3DPP A;  3B51 X;  4EZZ A;  1GN9 A;  2YIB A;  3QNJ A;  4JLC A;  5TKY A;  3A98 A;  3RV0 A;  3DQG A;  7HSC A;  4HR1 B;  1UPX A;  3KAW A;  2OBM A;  4EZP A;  4JNE A;  2GAF D;  3B53 X;  2OP6 A;  3FD9 A;  4EZW A;  3T47 A;  4JL9 A;  1W9M A;  1GNL A;  2GA9 D;  1U00 A;  1GNT A;  5FIG A;  4EZN A;  4EZQ A;  4D8J A;  2V7Y A;  1DKZ A;  3I04 A;  2JNS A;  1BPR A;  4EZT A;  2Z8Y A;  3T48 A;  3VEB A;  3I39 X;  3GI7 A;  4FL9 A;  3UIT A;  2X5C A;  3ER9 B;  4H6I A;  3O3M B;  4IWQ A;  4R5I A;  2WIN M;  4I43 A;  3OWG A;  4M0M A;  4G6Q A;  4EZO A;  2BPR A;  4WV7 A;  4R5K A;  4WV5 A;  3I01 A;  2PY6 A;  4JNF A;  2ND0 A;  4E3C A;  2RT6 A;  1DG4 A;  4MQD A;  4FM3 A;  2EX3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...