1DKZA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 native crystals
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUBSTRATE BINDING DOMAIN OF DNAK
publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
molecule tags Complex (molecular chaperone/peptide)
total genus 62
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkzA01
3C7NB 4R5KA 2V7YA 4F00A 2QXLA 4EZRA 4JNEA 1DKXA 4HYBA 1CKRA 4R5IA 1U00A 4EZWA 3D2EA 1DG4A 3T4AG 3DOBA 1DKZA 1BPRA 4H6HA 4EZPA 4JNFA 4R5JA 3T49A 1YUWA 4JWIA 4H6IA 4JWCA 4PO2A 4JN4A 4JWEA 4B9QA 2BPRA 3T47A 3DQGA 4EZXA 7HSCA 3H0XA 3OHXM 4EZNA 4FL9A 4EZVA 2OP6A 3D2FA 5TKYA 4EZYA 4EZOA 4F01A 4WV5A 4E81A 3DPQA 3C7NA 4R5GA 1Q5LA 4R5LA 4WV7A 3N8EA 4EZZA 2WINM 4JWDA 4EZUA 4EZSA 2QFFA 3T46A 3L3OM 1DKYA 2KHOA 4HY9A 4EZTA 4EZQA 3DPOA 5E84A 3T48A 3QNJA 3DPPA
chains in the Genus database with same CATH superfamily
3M3WA 1DKXA 3B51X 3CAZA 3SBSA 4IM3A 1DKZA 1BPRA 1TQWA 3BLBA 4JNFA 4AKVA 3BUQA 1X03A 2Z8YA 4EZVA 4EZOA 3ZEFA 2FYVA 1DKYA 3F7WA 3ZEDA 2D1LA 1O7DC 2LM0A 1U00A 4I43A 4IWQA 1TQSA 3BUIA 3RPMA 1HTYA 3ER8C 4EZNA 4AZCA 1URUA 3ABHA 3BUDA 3CKDA 3N8EA 1JQKA 2WINM 4EZTA 2KHOA 1E1DA 3QNJA 2PMRA 4HR1A 3Q0KA 2OBMA 3I04A 2EX3B 3KAVA 3A98A 2F7OA 4JL9A 4UDXX 5FLEX 4H8SA 3BUPA 2YLAA 4R5GA 3ERCC 1Y2OA 4EZQA 3DOBA 3D50A 4F00A 4AZ5A 3RV1A 2FICA 4AVMA 3D4YA 4ATMA 4JN4A 3I39X 2NCZA 3BVXA 2EFKA 3DX1A 1SU8A 4DCNC 4E81A 3C7NA 4E3CA 4EZUA 4WPCA 2V7YA 2PY6A 4HYBA 2ND1A 2EWFA 4AZIA 4FM3A 3LVTA 4JLCA 4JWCA 1TQVA 3H0XA 1R5EA 2OP6A 2YI9A 1UPXA 1OA0A 1I4TA 4AZCB 2V0OA 1DG4A 2GF4A 2JNSA 3T4AG 4HR1B 2OW7A 1HXKA 3PLTA 2MI7A 3EJSA 4G6QA 4ILIA 2OBLA 2YIBA 4JWDA 4AZBA 3DPPA 4FL9A 1CKRA 3I2WA 4IM0A 4H6HA 4ILGA 2RT6A 1TQUA 1YUWA 4H6IA 2BPRA 7HSCA 2WYIA 1SU7A 3DPQA 3BVWA 2JNKA 3DX3A 3CZSA 3DDGA 2YI8A 2QFFA 2X3XA 1YWMA 2Q13A 4UDYX 2X3VA 3SYVA 2YIVX 3QWEA 3HAIA 2F18A 3D4ZA 3EJPA 4FZPA 4NPHA 2F1AA 4EZYA 2ELBA 2YL9A 3RV0A 2YL8A 4WV7A 2QKWA 1QWNA 3L3OM 3B53X 3O3MB 4EZWA 3KDRA 4KIKA 4EZPA 3UITA 4R5JA 2GAFD 4IW0A 2F7QA 2C08A 2Z0NA 2OZNB 4F01A 4WV5A 3BVVA 4EZZA 3DPOA 3T48A 4M0MA 4AZHA 2GA9D 3EJUA 1W9MA 1ZYLA 3CZNA 3QNIA 3DQGA 3SBTB 2Z0OA 5TKYA 1Q5LA 3FD9A 4R5LA 1X04A 4EZSA 3O3OB 4HY9A 5C5BA 4R5IA 1PS3A 4PO2A 3B52X 1O7DB 5KBPA 3I01A 3ER9B 2F7RA 2ND0A 3DX4A 2N3KA 3O3NB 1E2UA 3DYTA 3KAWA 2RAIA 4IM2A 2QXLA 5FIGA 1OAOA 3BUBA 3EJQA 2RAJA 2LXYA 1GNLA 1QX1A 3EJTA 3GI7A 3T47A 4KIKB 4DYLA 4NQIA 4IWOA 4FZSA 1I4LA 1WDZA 2YLLA 3T46A 4AZGA 2X3WA 1GN9A 4AZ6A 1OA1A 3C7NB 1QWUA 2YL6A 3T49A 4JWIA 1E9VA 3BVUA 2ZXQA 3OK8A 2RAKA 3L3PA 1SU6A 1LQ7A 4EZRA 1R33A 4MQDA 1TQTA 2EFLA 4FZOA 3DX2A 3Q84A 5C5BB 2F7PA 3ACOA 3CVRA 3QE6A 3SOGA 4EZXA 4AZ7A 3OHXM 2YIAA 1I49A 2D4CA 3VEBA 1SUFA 3BVTA 2X5CA 4ILHB 2Q12A 4R5KA 4NSWA 2YL5A 2O0I1 2ALWA 4I1QA 2Z0VA 2YKTA 1GNTA 1ZWWA 3VEAA 2F1BA 4B9QA 3D51A 4BNEA 1R34A 3D2FA 3DDFA 3LMFA 1HWWA 3QA8A 2OO2A 3DX0A 4JNEA 3D2EA 4IWPA 3D52A 3HAHA 3CV5A 3G9GA 3HAJA 4JWEA 2OW6A 1MJGA 2WYHA 3VKHA 3OWGA 4WPEA 4D8JA 3EJRA 5E84A 3LLLA 1I4DA
chains in the Genus database with same CATH topology
3C7NB 2V7YA 2PY6A 1DKXA 3O3MB 4HYBA 2ND1A 3B51X 4EZWA 3SBSA 2EWFA 4IM3A 3KDRA 1DKZA 4FM3A 1BPRA 4KIKA 4EZPA 1OA1A 4JNFA 4R5JA 4JLCA 3UITA 3T49A 2GAFD 4IW0A 4JWIA 4JWCA 1E9VA 3H0XA 2Z8YA 4EZVA 2OP6A 2YI9A 4EZOA 4F01A 4WV5A 1UPXA 1OA0A 4EZZA 3ZEFA 1DG4A 1SU6A 1DKYA 3F7WA 3DPOA 3ZEDA 3T48A 2LM0A 4M0MA 4EZRA 4MQDA 1U00A 4I43A 4IWQA 2JNSA 3T4AG 2GA9D 4HR1B 1W9MA 1ZYLA 3SBTB 3DQGA 4EZXA 3OHXM 4G6QA 3ER8C 4EZNA 2YIAA 5TKYA 4ILIA 3VEBA 1Q5LA 1SUFA 2OBLA 3FD9A 2YIBA 4R5LA 3N8EA 1JQKA 2WINM 2X5CA 4JWDA 4EZSA 4ILHB 4EZTA 2KHOA 3O3OB 4HY9A 3DPPA 1E1DA 3QNJA 4FL9A 1CKRA 4R5KA 4HR1A 4R5IA 4IM0A 4H6HA 4ILGA 2OBMA 2RT6A 3I04A 2EX3B 1GNTA 3KAVA 3VEAA 1YUWA 4H6IA 4PO2A 4B9QA 3A98A 2BPRA 3B52X 4JL9A 7HSCA 4UDXX 3I01A 5FLEX 3ER9B 3D2FA 1SU7A 2ND0A 3LMFA 3DPQA 4R5GA 2N3KA 3ERCC 3O3NB 1E2UA 3KAWA 3QA8A 2YI8A 2QFFA 4IM2A 4EZQA 3DOBA 4F00A 2QXLA 5FIGA 4JNEA 1OAOA 3D2EA 4UDYX 3RV1A 4IWPA 2YIVX 1GNLA 3GI7A 4JN4A 4JWEA 3I39X 2NCZA 1MJGA 4KIKB 3T47A 4NPHA 3VKHA 1SU8A 4EZYA 4E81A 3C7NA 3OWGA 3RV0A 4IWOA 4E3CA 4WV7A 4D8JA 4EZUA 3T46A 3L3OM 1GN9A 5E84A 3B53X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7N B;  4R5K A;  2V7Y A;  4F00 A;  2QXL A;  4EZR A;  4JNE A;  1DKX A;  4HYB A;  1CKR A;  4R5I A;  1U00 A;  4EZW A;  3D2E A;  1DG4 A;  3T4A G;  3DOB A;  1DKZ A;  1BPR A;  4H6H A;  4EZP A;  4JNF A;  4R5J A;  3T49 A;  1YUW A;  4JWI A;  4H6I A;  4JWC A;  4PO2 A;  4JN4 A;  4JWE A;  4B9Q A;  2BPR A;  3T47 A;  3DQG A;  4EZX A;  7HSC A;  3H0X A;  3OHX M;  4EZN A;  4FL9 A;  4EZV A;  2OP6 A;  3D2F A;  5TKY A;  4EZY A;  4EZO A;  4F01 A;  4WV5 A;  4E81 A;  3DPQ A;  3C7N A;  4R5G A;  1Q5L A;  4R5L A;  4WV7 A;  3N8E A;  4EZZ A;  2WIN M;  4JWD A;  4EZU A;  4EZS A;  2QFF A;  3T46 A;  3L3O M;  1DKY A;  2KHO A;  4HY9 A;  4EZT A;  4EZQ A;  3DPO A;  5E84 A;  3T48 A;  3QNJ A;  3DPP A; 
#chains in the Genus database with same CATH topology
 3M3W A;  1DKX A;  3B51 X;  3CAZ A;  3SBS A;  4IM3 A;  1DKZ A;  1BPR A;  1TQW A;  3BLB A;  4JNF A;  4AKV A;  3BUQ A;  1X03 A;  2Z8Y A;  4EZV A;  4EZO A;  3ZEF A;  2FYV A;  1DKY A;  3F7W A;  3ZED A;  2D1L A;  1O7D C;  2LM0 A;  1U00 A;  4I43 A;  4IWQ A;  1TQS A;  3BUI A;  3RPM A;  1HTY A;  3ER8 C;  4EZN A;  4AZC A;  1URU A;  3ABH A;  3BUD A;  3CKD A;  3N8E A;  1JQK A;  2WIN M;  4EZT A;  2KHO A;  1E1D A;  3QNJ A;  2PMR A;  4HR1 A;  3Q0K A;  2OBM A;  3I04 A;  2EX3 B;  3KAV A;  3A98 A;  2F7O A;  4JL9 A;  4UDX X;  5FLE X;  4H8S A;  3BUP A;  2YLA A;  4R5G A;  3ERC C;  1Y2O A;  4EZQ A;  3DOB A;  3D50 A;  4F00 A;  4AZ5 A;  3RV1 A;  2FIC A;  4AVM A;  3D4Y A;  4ATM A;  4JN4 A;  3I39 X;  2NCZ A;  3BVX A;  2EFK A;  3DX1 A;  1SU8 A;  4DCN C;  4E81 A;  3C7N A;  4E3C A;  4EZU A;  4WPC A;  2V7Y A;  2PY6 A;  4HYB A;  2ND1 A;  2EWF A;  4AZI A;  4FM3 A;  3LVT A;  4JLC A;  4JWC A;  1TQV A;  3H0X A;  1R5E A;  2OP6 A;  2YI9 A;  1UPX A;  1OA0 A;  1I4T A;  4AZC B;  2V0O A;  1DG4 A;  2GF4 A;  2JNS A;  3T4A G;  4HR1 B;  2OW7 A;  1HXK A;  3PLT A;  2MI7 A;  3EJS A;  4G6Q A;  4ILI A;  2OBL A;  2YIB A;  4JWD A;  4AZB A;  3DPP A;  4FL9 A;  1CKR A;  3I2W A;  4IM0 A;  4H6H A;  4ILG A;  2RT6 A;  1TQU A;  1YUW A;  4H6I A;  2BPR A;  7HSC A;  2WYI A;  1SU7 A;  3DPQ A;  3BVW A;  2JNK A;  3DX3 A;  3CZS A;  3DDG A;  2YI8 A;  2QFF A;  2X3X A;  1YWM A;  2Q13 A;  4UDY X;  2X3V A;  3SYV A;  2YIV X;  3QWE A;  3HAI A;  2F18 A;  3D4Z A;  3EJP A;  4FZP A;  4NPH A;  2F1A A;  4EZY A;  2ELB A;  2YL9 A;  3RV0 A;  2YL8 A;  4WV7 A;  2QKW A;  1QWN A;  3L3O M;  3B53 X;  3O3M B;  4EZW A;  3KDR A;  4KIK A;  4EZP A;  3UIT A;  4R5J A;  2GAF D;  4IW0 A;  2F7Q A;  2C08 A;  2Z0N A;  2OZN B;  4F01 A;  4WV5 A;  3BVV A;  4EZZ A;  3DPO A;  3T48 A;  4M0M A;  4AZH A;  2GA9 D;  3EJU A;  1W9M A;  1ZYL A;  3CZN A;  3QNI A;  3DQG A;  3SBT B;  2Z0O A;  5TKY A;  1Q5L A;  3FD9 A;  4R5L A;  1X04 A;  4EZS A;  3O3O B;  4HY9 A;  5C5B A;  4R5I A;  1PS3 A;  4PO2 A;  3B52 X;  1O7D B;  5KBP A;  3I01 A;  3ER9 B;  2F7R A;  2ND0 A;  3DX4 A;  2N3K A;  3O3N B;  1E2U A;  3DYT A;  3KAW A;  2RAI A;  4IM2 A;  2QXL A;  5FIG A;  1OAO A;  3BUB A;  3EJQ A;  2RAJ A;  2LXY A;  1GNL A;  1QX1 A;  3EJT A;  3GI7 A;  3T47 A;  4KIK B;  4DYL A;  4NQI A;  4IWO A;  4FZS A;  1I4L A;  1WDZ A;  2YLL A;  3T46 A;  4AZG A;  2X3W A;  1GN9 A;  4AZ6 A;  1OA1 A;  3C7N B;  1QWU A;  2YL6 A;  3T49 A;  4JWI A;  1E9V A;  3BVU A;  2ZXQ A;  3OK8 A;  2RAK A;  3L3P A;  1SU6 A;  1LQ7 A;  4EZR A;  1R33 A;  4MQD A;  1TQT A;  2EFL A;  4FZO A;  3DX2 A;  3Q84 A;  5C5B B;  2F7P A;  3ACO A;  3CVR A;  3QE6 A;  3SOG A;  4EZX A;  4AZ7 A;  3OHX M;  2YIA A;  1I49 A;  2D4C A;  3VEB A;  1SUF A;  3BVT A;  2X5C A;  4ILH B;  2Q12 A;  4R5K A;  4NSW A;  2YL5 A;  2O0I 1;  2ALW A;  4I1Q A;  2Z0V A;  2YKT A;  1GNT A;  1ZWW A;  3VEA A;  2F1B A;  4B9Q A;  3D51 A;  4BNE A;  1R34 A;  3D2F A;  3DDF A;  3LMF A;  1HWW A;  3QA8 A;  2OO2 A;  3DX0 A;  4JNE A;  3D2E A;  4IWP A;  3D52 A;  3HAH A;  3CV5 A;  3G9G A;  3HAJ A;  4JWE A;  2OW6 A;  1MJG A;  2WYH A;  3VKH A;  3OWG A;  4WPE A;  4D8J A;  3EJR A;  5E84 A;  3LLL A;  1I4D A; 
#chains in the Genus database with same CATH homology
 3C7N B;  2V7Y A;  2PY6 A;  1DKX A;  3O3M B;  4HYB A;  2ND1 A;  3B51 X;  4EZW A;  3SBS A;  2EWF A;  4IM3 A;  3KDR A;  1DKZ A;  4FM3 A;  1BPR A;  4KIK A;  4EZP A;  1OA1 A;  4JNF A;  4R5J A;  4JLC A;  3UIT A;  3T49 A;  2GAF D;  4IW0 A;  4JWI A;  4JWC A;  1E9V A;  3H0X A;  2Z8Y A;  4EZV A;  2OP6 A;  2YI9 A;  4EZO A;  4F01 A;  4WV5 A;  1UPX A;  1OA0 A;  4EZZ A;  3ZEF A;  1DG4 A;  1SU6 A;  1DKY A;  3F7W A;  3DPO A;  3ZED A;  3T48 A;  2LM0 A;  4M0M A;  4EZR A;  4MQD A;  1U00 A;  4I43 A;  4IWQ A;  2JNS A;  3T4A G;  2GA9 D;  4HR1 B;  1W9M A;  1ZYL A;  3SBT B;  3DQG A;  4EZX A;  3OHX M;  4G6Q A;  3ER8 C;  4EZN A;  2YIA A;  5TKY A;  4ILI A;  3VEB A;  1Q5L A;  1SUF A;  2OBL A;  3FD9 A;  2YIB A;  4R5L A;  3N8E A;  1JQK A;  2WIN M;  2X5C A;  4JWD A;  4EZS A;  4ILH B;  4EZT A;  2KHO A;  3O3O B;  4HY9 A;  3DPP A;  1E1D A;  3QNJ A;  4FL9 A;  1CKR A;  4R5K A;  4HR1 A;  4R5I A;  4IM0 A;  4H6H A;  4ILG A;  2OBM A;  2RT6 A;  3I04 A;  2EX3 B;  1GNT A;  3KAV A;  3VEA A;  1YUW A;  4H6I A;  4PO2 A;  4B9Q A;  3A98 A;  2BPR A;  3B52 X;  4JL9 A;  7HSC A;  4UDX X;  3I01 A;  5FLE X;  3ER9 B;  3D2F A;  1SU7 A;  2ND0 A;  3LMF A;  3DPQ A;  4R5G A;  2N3K A;  3ERC C;  3O3N B;  1E2U A;  3KAW A;  3QA8 A;  2YI8 A;  2QFF A;  4IM2 A;  4EZQ A;  3DOB A;  4F00 A;  2QXL A;  5FIG A;  4JNE A;  1OAO A;  3D2E A;  4UDY X;  3RV1 A;  4IWP A;  2YIV X;  1GNL A;  3GI7 A;  4JN4 A;  4JWE A;  3I39 X;  2NCZ A;  1MJG A;  4KIK B;  3T47 A;  4NPH A;  3VKH A;  1SU8 A;  4EZY A;  4E81 A;  3C7N A;  3OWG A;  3RV0 A;  4IWO A;  4E3C A;  4WV7 A;  4D8J A;  4EZU A;  3T46 A;  3L3O M;  1GN9 A;  5E84 A;  3B53 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...