1DKZA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 native crystals
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
molecule tags Complex (molecular chaperone/peptide)
molecule keywords SUBSTRATE BINDING DOMAIN OF DNAK
total genus 62
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkzA01
4EZPA 5TKYA 3T46A 4EZXA 4JWCA 4HYBA 4EZQA 1Q5LA 3D2FA 4R5LA 4EZSA 4F01A 4EZZA 3DOBA 1DG4A 3D2EA 3DPPA 4EZUA 4JNEA 4R5GA 1CKRA 4JNFA 3N8EA 3DPOA 1DKYA 4JWIA 4WV7A 4EZTA 3C7NB 3L3OM 1BPRA 4EZWA 2QFFA 3T48A 4WV5A 4B9QA 7HSCA 3OHXM 3C7NA 4H6HA 4R5IA 1DKXA 3T47A 4PO2A 4JWDA 3T4AG 1YUWA 1U00A 2OP6A 2BPRA 4FL9A 3DPQA 4R5KA 2V7YA 4EZYA 4EZNA 4EZVA 4EZRA 4F00A 3T49A 4H6IA 4R5JA 5E84A 3H0XA 4HY9A 3DQGA 1DKZA 4JN4A 2WINM 4JWEA 4E81A 4EZOA 2KHOA 3QNJA 2QXLA
chains in the Genus database with same CATH superfamily
1PS3A 4KIKA 1MJGA 4EZXA 4JWCA 3BUPA 3EJQA 1SU8A 4AZ6A 4EZQA 3RV1A 4AZGA 4AZ7A 2YI9A 4R5LA 4I1QA 3G9GA 4EZZA 2MI7A 2YIVX 3D2EA 1TQUA 1HWWA 4E3CA 4MQDA 3GI7A 4JNEA 5KBPA 2OW7A 4FZPA 3D4ZA 4JNFA 2O0I1 4R5GA 1DKYA 1W9MA 3FD9A 4JWIA 4UDXX 3BVUA 4AZIA 4EZTA 3ER8C 4WV7A 3SBSA 4HR1B 4AZCA 4AZ5A 3HAHA 4WV5A 3SYVA 2EFKA 1I4DA 1X03A 2YI8A 4M0MA 2OZNB 3ER9B 2OP6A 2F7QA 2ALWA 2OW6A 3T4AG 2Z8YA 1ZYLA 2F7OA 1TQTA 2X3VA 3BUBA 2ELBA 4EZYA 1TQSA 2YLLA 1SU7A 3OWGA 2D4CA 3KAVA 1I49A 2ND0A 3BVWA 4H6IA 3F7WA 3I39X 4NPHA 4HY9A 4R5JA 3RV0A 3T49A 3DQGA 3CVRA 2YLAA 2V0OA 1Y2OA 4JWEA 5C5BB 3LLLA 1HXKA 4FZOA 4EZPA 3UITA 5TKYA 3DDFA 3VEAA 1OAOA 2ND1A 2NCZA 3EJUA 3O3OB 4AZHA 4EZSA 4F01A 3HAJA 3SOGA 2F1BA 1SU6A 3DYTA 1OA0A 3QNIA 4NQIA 1SUFA 4EZUA 3O3NB 4DYLA 2EWFA 4IM3A 3C7NB 3L3OM 2Z0VA 2ZXQA 3I01A 3I2WA 5FLEX 3T48A 1URUA 3C7NA 2YL6A 2YKTA 3ZEFA 2Z0NA 3Q0KA 3BVVA 4HR1A 1I4LA 4AZCB 5C5BA 3LVTA 2RAKA 2JNSA 3DPQA 4IWOA 2V7YA 2GA9D 3LMFA 2Q12A 4EZNA 2F7PA 3KDRA 4I43A 3B52X 3DX3A 4JN4A 4JLCA 4EZOA 3QNJA 3Q84A 3T47A 1OA1A 3BLBA 2BPRA 3VEBA 2JNKA 3CV5A 1E9VA 2GAFD 4HYBA 4AZBA 2OBMA 3BUQA 3D2FA 4ILHB 1CKRA 2FYVA 1GN9A 3BUIA 3KAWA 3O3MB 4G6QA 1E1DA 3ABHA 3DPOA 1UPXA 3BUDA 3A98A 3QE6A 2Z0OA 3CZSA 2F18A 2X3WA 3BVTA 2QFFA 3EJSA 3D51A 3OK8A 3ZEDA 2YIBA 4AVMA 3EJTA 3OHXM 4IM2A 4R5IA 1YUWA 1WDZA 2WYHA 3I04A 3PLTA 1U00A 4DCNC 4PO2A 2F7RA 2WYIA 3ACOA 4R5KA 4ATMA 3DX0A 4H8SA 4IM0A 1QWNA 4FZSA 1LQ7A 4EZVA 1R5EA 3D4YA 3L3PA 5E84A 1JQKA 2YL5A 3VKHA 4E81A 4WPEA 4D8JA 2KHOA 2PY6A 4BNEA 2QXLA 4WPCA 2GF4A 3CKDA 3RPMA 3T46A 3DDGA 3EJPA 2LM0A 2YIAA 1R34A 1HTYA 1Q5LA 3D52A 4EZRA 3DOBA 2C08A 2PMRA 3D50A 2X5CA 2YL8A 3DX4A 5FIGA 2Q13A 1DG4A 1I4TA 1TQWA 2N3KA 3B51X 3DPPA 3M3WA 1O7DC 3CZNA 2EX3B 3N8EA 4ILGA 1QWUA 1R33A 2FICA 3EJRA 4KIKB 4AKVA 3ERCC 3SBTB 1BPRA 3DX1A 2X3XA 3DX2A 2RT6A 3HAIA 4IW0A 2RAIA 4EZWA 3B53X 2D1LA 4B9QA 7HSCA 2OO2A 4H6HA 1DKXA 2F1AA 1ZWWA 1YWMA 2QKWA 4JWDA 4FL9A 4ILIA 2EFLA 2LXYA 1X04A 2YL9A 4JL9A 4UDYX 1QX1A 2RAJA 3BVXA 3QA8A 2OBLA 3QWEA 4FM3A 1TQVA 4IWPA 4IWQA 1E2UA 4NSWA 1GNLA 3CAZA 3H0XA 1DKZA 2WINM 4F00A 1GNTA 1O7DB
chains in the Genus database with same CATH topology
4KIKA 1MJGA 4EZXA 4JWCA 1SU8A 4EZQA 3RV1A 2YI9A 4R5LA 4EZZA 2YIVX 3D2EA 4E3CA 4MQDA 3GI7A 4JNEA 3ERCC 4R5GA 3SBTB 1CKRA 4JNFA 1DKYA 1W9MA 3FD9A 4JWIA 4UDXX 3ER8C 4EZTA 4WV7A 3SBSA 4HR1B 4WV5A 2YI8A 4M0MA 3ER9B 2OP6A 3T4AG 2Z8YA 1ZYLA 4EZYA 1SU7A 3OWGA 3KAVA 2ND0A 3RV0A 4H6IA 3F7WA 3I39X 4NPHA 4HY9A 4R5JA 3T49A 3DQGA 4JWEA 4EZPA 3UITA 5TKYA 3VEAA 1OAOA 2ND1A 2NCZA 3O3OB 4EZSA 4F01A 1SU6A 1OA0A 4EZUA 1SUFA 3O3NB 2EWFA 4IM3A 3C7NB 3L3OM 3I01A 5FLEX 3T48A 3C7NA 3ZEFA 4HR1A 3DPQA 2JNSA 4IWOA 2V7YA 2GA9D 3LMFA 4EZNA 3KDRA 4I43A 3B52X 4JN4A 4JLCA 4EZOA 3QNJA 3T47A 1OA1A 2BPRA 3VEBA 1E9VA 2GAFD 4HYBA 2OBMA 3D2FA 4ILHB 3KAWA 1GN9A 4G6QA 3O3MB 1E1DA 3DPOA 1UPXA 3A98A 2QFFA 3ZEDA 2YIBA 4IM2A 3OHXM 4R5IA 1YUWA 4PO2A 3I04A 1U00A 4R5KA 4IM0A 4EZVA 5E84A 1JQKA 3VKHA 4E81A 4D8JA 2KHOA 2PY6A 2QXLA 3T46A 2LM0A 1Q5LA 3DOBA 1DG4A 2X5CA 5FIGA 3B51X 2N3KA 3DPPA 2EX3B 3N8EA 4ILGA 4KIKB 1BPRA 4IW0A 4EZWA 2RT6A 3B53X 4B9QA 7HSCA 4H6HA 1DKXA 4FL9A 4JWDA 4ILIA 4JL9A 4UDYX 3QA8A 4IWPA 4IWQA 2OBLA 4FM3A 4EZRA 3H0XA 1E2UA 1GNLA 1DKZA 2WINM 4F00A 1GNTA 2YIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZP A;  5TKY A;  3T46 A;  4EZX A;  4JWC A;  4HYB A;  4EZQ A;  1Q5L A;  3D2F A;  4R5L A;  4EZS A;  4F01 A;  4EZZ A;  3DOB A;  1DG4 A;  3D2E A;  3DPP A;  4EZU A;  4JNE A;  4R5G A;  1CKR A;  4JNF A;  3N8E A;  3DPO A;  1DKY A;  4JWI A;  4WV7 A;  4EZT A;  3C7N B;  3L3O M;  1BPR A;  4EZW A;  2QFF A;  3T48 A;  4WV5 A;  4B9Q A;  7HSC A;  3OHX M;  3C7N A;  4H6H A;  4R5I A;  1DKX A;  3T47 A;  4PO2 A;  4JWD A;  3T4A G;  1YUW A;  1U00 A;  2OP6 A;  2BPR A;  4FL9 A;  3DPQ A;  4R5K A;  2V7Y A;  4EZY A;  4EZN A;  4EZV A;  4EZR A;  4F00 A;  3T49 A;  4H6I A;  4R5J A;  5E84 A;  3H0X A;  4HY9 A;  3DQG A;  1DKZ A;  4JN4 A;  2WIN M;  4JWE A;  4E81 A;  4EZO A;  2KHO A;  3QNJ A;  2QXL A; 
#chains in the Genus database with same CATH topology
 1PS3 A;  4KIK A;  1MJG A;  4EZX A;  4JWC A;  3BUP A;  3EJQ A;  1SU8 A;  4AZ6 A;  4EZQ A;  3RV1 A;  4AZG A;  4AZ7 A;  2YI9 A;  4R5L A;  4I1Q A;  3G9G A;  4EZZ A;  2MI7 A;  2YIV X;  3D2E A;  1TQU A;  1HWW A;  4E3C A;  4MQD A;  3GI7 A;  4JNE A;  5KBP A;  2OW7 A;  4FZP A;  3D4Z A;  4JNF A;  2O0I 1;  4R5G A;  1DKY A;  1W9M A;  3FD9 A;  4JWI A;  4UDX X;  3BVU A;  4AZI A;  4EZT A;  3ER8 C;  4WV7 A;  3SBS A;  4HR1 B;  4AZC A;  4AZ5 A;  3HAH A;  4WV5 A;  3SYV A;  2EFK A;  1I4D A;  1X03 A;  2YI8 A;  4M0M A;  2OZN B;  3ER9 B;  2OP6 A;  2F7Q A;  2ALW A;  2OW6 A;  3T4A G;  2Z8Y A;  1ZYL A;  2F7O A;  1TQT A;  2X3V A;  3BUB A;  2ELB A;  4EZY A;  1TQS A;  2YLL A;  1SU7 A;  3OWG A;  2D4C A;  3KAV A;  1I49 A;  2ND0 A;  3BVW A;  4H6I A;  3F7W A;  3I39 X;  4NPH A;  4HY9 A;  4R5J A;  3RV0 A;  3T49 A;  3DQG A;  3CVR A;  2YLA A;  2V0O A;  1Y2O A;  4JWE A;  5C5B B;  3LLL A;  1HXK A;  4FZO A;  4EZP A;  3UIT A;  5TKY A;  3DDF A;  3VEA A;  1OAO A;  2ND1 A;  2NCZ A;  3EJU A;  3O3O B;  4AZH A;  4EZS A;  4F01 A;  3HAJ A;  3SOG A;  2F1B A;  1SU6 A;  3DYT A;  1OA0 A;  3QNI A;  4NQI A;  1SUF A;  4EZU A;  3O3N B;  4DYL A;  2EWF A;  4IM3 A;  3C7N B;  3L3O M;  2Z0V A;  2ZXQ A;  3I01 A;  3I2W A;  5FLE X;  3T48 A;  1URU A;  3C7N A;  2YL6 A;  2YKT A;  3ZEF A;  2Z0N A;  3Q0K A;  3BVV A;  4HR1 A;  1I4L A;  4AZC B;  5C5B A;  3LVT A;  2RAK A;  2JNS A;  3DPQ A;  4IWO A;  2V7Y A;  2GA9 D;  3LMF A;  2Q12 A;  4EZN A;  2F7P A;  3KDR A;  4I43 A;  3B52 X;  3DX3 A;  4JN4 A;  4JLC A;  4EZO A;  3QNJ A;  3Q84 A;  3T47 A;  1OA1 A;  3BLB A;  2BPR A;  3VEB A;  2JNK A;  3CV5 A;  1E9V A;  2GAF D;  4HYB A;  4AZB A;  2OBM A;  3BUQ A;  3D2F A;  4ILH B;  1CKR A;  2FYV A;  1GN9 A;  3BUI A;  3KAW A;  3O3M B;  4G6Q A;  1E1D A;  3ABH A;  3DPO A;  1UPX A;  3BUD A;  3A98 A;  3QE6 A;  2Z0O A;  3CZS A;  2F18 A;  2X3W A;  3BVT A;  2QFF A;  3EJS A;  3D51 A;  3OK8 A;  3ZED A;  2YIB A;  4AVM A;  3EJT A;  3OHX M;  4IM2 A;  4R5I A;  1YUW A;  1WDZ A;  2WYH A;  3I04 A;  3PLT A;  1U00 A;  4DCN C;  4PO2 A;  2F7R A;  2WYI A;  3ACO A;  4R5K A;  4ATM A;  3DX0 A;  4H8S A;  4IM0 A;  1QWN A;  4FZS A;  1LQ7 A;  4EZV A;  1R5E A;  3D4Y A;  3L3P A;  5E84 A;  1JQK A;  2YL5 A;  3VKH A;  4E81 A;  4WPE A;  4D8J A;  2KHO A;  2PY6 A;  4BNE A;  2QXL A;  4WPC A;  2GF4 A;  3CKD A;  3RPM A;  3T46 A;  3DDG A;  3EJP A;  2LM0 A;  2YIA A;  1R34 A;  1HTY A;  1Q5L A;  3D52 A;  4EZR A;  3DOB A;  2C08 A;  2PMR A;  3D50 A;  2X5C A;  2YL8 A;  3DX4 A;  5FIG A;  2Q13 A;  1DG4 A;  1I4T A;  1TQW A;  2N3K A;  3B51 X;  3DPP A;  3M3W A;  1O7D C;  3CZN A;  2EX3 B;  3N8E A;  4ILG A;  1QWU A;  1R33 A;  2FIC A;  3EJR A;  4KIK B;  4AKV A;  3ERC C;  3SBT B;  1BPR A;  3DX1 A;  2X3X A;  3DX2 A;  2RT6 A;  3HAI A;  4IW0 A;  2RAI A;  4EZW A;  3B53 X;  2D1L A;  4B9Q A;  7HSC A;  2OO2 A;  4H6H A;  1DKX A;  2F1A A;  1ZWW A;  1YWM A;  2QKW A;  4JWD A;  4FL9 A;  4ILI A;  2EFL A;  2LXY A;  1X04 A;  2YL9 A;  4JL9 A;  4UDY X;  1QX1 A;  2RAJ A;  3BVX A;  3QA8 A;  2OBL A;  3QWE A;  4FM3 A;  1TQV A;  4IWP A;  4IWQ A;  1E2U A;  4NSW A;  1GNL A;  3CAZ A;  3H0X A;  1DKZ A;  2WIN M;  4F00 A;  1GNT A;  1O7D B; 
#chains in the Genus database with same CATH homology
 4KIK A;  1MJG A;  4EZX A;  4JWC A;  1SU8 A;  4EZQ A;  3RV1 A;  2YI9 A;  4R5L A;  4EZZ A;  2YIV X;  3D2E A;  4E3C A;  4MQD A;  3GI7 A;  4JNE A;  3ERC C;  4R5G A;  3SBT B;  1CKR A;  4JNF A;  1DKY A;  1W9M A;  3FD9 A;  4JWI A;  4UDX X;  3ER8 C;  4EZT A;  4WV7 A;  3SBS A;  4HR1 B;  4WV5 A;  2YI8 A;  4M0M A;  3ER9 B;  2OP6 A;  3T4A G;  2Z8Y A;  1ZYL A;  4EZY A;  1SU7 A;  3OWG A;  3KAV A;  2ND0 A;  3RV0 A;  4H6I A;  3F7W A;  3I39 X;  4NPH A;  4HY9 A;  4R5J A;  3T49 A;  3DQG A;  4JWE A;  4EZP A;  3UIT A;  5TKY A;  3VEA A;  1OAO A;  2ND1 A;  2NCZ A;  3O3O B;  4EZS A;  4F01 A;  1SU6 A;  1OA0 A;  4EZU A;  1SUF A;  3O3N B;  2EWF A;  4IM3 A;  3C7N B;  3L3O M;  3I01 A;  5FLE X;  3T48 A;  3C7N A;  3ZEF A;  4HR1 A;  3DPQ A;  2JNS A;  4IWO A;  2V7Y A;  2GA9 D;  3LMF A;  4EZN A;  3KDR A;  4I43 A;  3B52 X;  4JN4 A;  4JLC A;  4EZO A;  3QNJ A;  3T47 A;  1OA1 A;  2BPR A;  3VEB A;  1E9V A;  2GAF D;  4HYB A;  2OBM A;  3D2F A;  4ILH B;  3KAW A;  1GN9 A;  4G6Q A;  3O3M B;  1E1D A;  3DPO A;  1UPX A;  3A98 A;  2QFF A;  3ZED A;  2YIB A;  4IM2 A;  3OHX M;  4R5I A;  1YUW A;  4PO2 A;  3I04 A;  1U00 A;  4R5K A;  4IM0 A;  4EZV A;  5E84 A;  1JQK A;  3VKH A;  4E81 A;  4D8J A;  2KHO A;  2PY6 A;  2QXL A;  3T46 A;  2LM0 A;  1Q5L A;  3DOB A;  1DG4 A;  2X5C A;  5FIG A;  3B51 X;  2N3K A;  3DPP A;  2EX3 B;  3N8E A;  4ILG A;  4KIK B;  1BPR A;  4IW0 A;  4EZW A;  2RT6 A;  3B53 X;  4B9Q A;  7HSC A;  4H6H A;  1DKX A;  4FL9 A;  4JWD A;  4ILI A;  4JL9 A;  4UDY X;  3QA8 A;  4IWP A;  4IWQ A;  2OBL A;  4FM3 A;  4EZR A;  3H0X A;  1E2U A;  1GNL A;  1DKZ A;  2WIN M;  4F00 A;  1GNT A;  2YIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...