1DKZA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 native crystals
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
b'VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUBSTRATE BINDING DOMAIN OF DNAK
publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
molecule tags Complex (molecular chaperone/peptide)
total genus 62
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkzA01
4R5KA 4H6IA 4EZNA 4EZVA 3T46A 1DKXA 4JN4A 3T48A 4EZUA 4R5LA 4HYBA 4R5JA 3DPPA 3T4AG 1U00A 5TKYA 4EZPA 4EZOA 4EZQA 1Q5LA 3QNJA 2V7YA 2WINM 3DPQA 5E84A 4EZWA 4EZXA 3L3OM 2BPRA 3DQGA 4WV7A 4PO2A 3OHXM 4JWCA 3C7NA 4E81A 4FL9A 4R5IA 4R5GA 2KHOA 2OP6A 4JWDA 3T49A 4EZRA 4EZZA 3C7NB 3DOBA 4JWIA 1DKYA 4JWEA 3D2FA 1BPRA 1YUWA 2QXLA 7HSCA 1DKZA 4F01A 3D2EA 4EZYA 1DG4A 4JNFA 3H0XA 4WV5A 4F00A 3DPOA 4EZTA 4HY9A 2QFFA 3T47A 1CKRA 4JNEA 4EZSA 3N8EA 4H6HA 4B9QA
chains in the Genus database with same CATH superfamily
2YIBA 4HYBA 3T4AG 1Q5LA 2Z8YA 3DQGA 2RT6A 3D4ZA 4R5IA 4JWIA 2Z0NA 1DG4A 3D4YA 2F7PA 1TQWA 4E3CA 1HTYA 1I4DA 4EZUA 1E2UA 2PMRA 3OHXM 3I04A 4HR1A 3VEBA 3EJUA 3DDFA 3BUPA 3H0XA 1SUFA 1SU8A 4BNEA 3CV5A 3DX0A 2C08A 2KHOA 4EZNA 1R33A 1GNLA 1Y2OA 4IWOA 3ER8C 2NCZA 2EX3B 3I01A 2YKTA 1BPRA 3O3MB 3CAZA 1DKZA 4HY9A 4JL9A 3BUBA 1I4TA 3EJQA 1DKXA 3I2WA 2MI7A 1X03A 4WV7A 4EZXA 3FD9A 1UPXA 4AZ7A 2QKWA 2WYIA 3VKHA 3D2EA 3PLTA 3EJPA 2YL5A 2EWFA 1GNTA 2X3WA 4R5LA 2YIVX 3KDRA 2ALWA 1OAOA 3BLBA 2Z0VA 3Q84A 3LMFA 1TQVA 3HAHA 1HXKA 1OA0A 4JWDA 5FLEX 4I43A 1DKYA 1PS3A 4F01A 4AZGA 4FM3A 2Q12A 3ZEFA 2F1BA 2YI8A 2PY6A 4WPEA 4R5KA 3D52A 2WYHA 1R34A 2ND1A 4EZQA 2WINM 4IWQA 1GN9A 4DYLA 4FL9A 2YL6A 4NSWA 3LVTA 4DCNC 3VEAA 3BUQA 4F00A 3QE6A 2GAFD 1QWNA 3O3NB 4AZCB 4WPCA 4EZVA 3DDGA 3DX2A 3HAJA 4IW0A 3CZSA 3RPMA 1U00A 3EJSA 2RAIA 3ERCC 4AKVA 4JWCA 1QWUA 3RV1A 3CVRA 4R5GA 1YWMA 2ZXQA 2ND0A 1SU7A 4EZYA 2GA9D 2FYVA 2O0I1 3BVWA 3HAIA 1O7DC 4JNEA 2F7RA 3N8EA 2Q13A 1O7DB 3SBSA 3BVVA 5C5BA 4FZSA 2YIAA 3DYTA 4EZZA 3ABHA 4AZHA 1YUWA 1QX1A 5KBPA 4WV5A 3DPOA 4H8SA 2F7QA 3T47A 4B9QA 3DX4A 4R5JA 2V7YA 2D1LA 3O3OB 3L3OM 4PO2A 2RAJA 4E81A 4I1QA 2GF4A 3RV0A 2JNSA 5C5BB 5FIGA 4UDXX 1JQKA 7HSCA 2RAKA 4IM3A 3D50A 2OW7A 2EFKA 4JN4A 3T48A 1WDZA 3SYVA 1W9MA 1TQTA 3CKDA 4IM2A 2YI9A 2X5CA 2V0OA 1HWWA 3L3PA 3B53X 2N3KA 3M3WA 4EZTA 4AZBA 4D8JA 4AZCA 3I39X 4H6HA 3DPPA 3OK8A 4M0MA 2YL9A 4ATMA 5E84A 3UITA 2EFLA 3EJRA 4KIKA 2OO2A 4IM0A 3DOBA 4MQDA 3QA8A 3D2FA 2OW6A 2JNKA 1I49A 2OBLA 4JNFA 1MJGA 3BUIA 3F7WA 1URUA 5TKYA 4EZOA 2FICA 3BVTA 2LXYA 1TQUA 1I4LA 2BPRA 3C7NA 3DX3A 3B52X 1X04A 4KIKB 3LLLA 1TQSA 2F18A 3ACOA 2X3XA 1E1DA 1ZYLA 2LM0A 3GI7A 1R5EA 3BVXA 3DX1A 3OWGA 3ER9B 2Z0OA 4UDYX 4EZRA 3C7NB 1OA1A 2OBMA 2F7OA 4ILIA 2F1AA 4EZSA 4H6IA 3KAVA 3T46A 4NPHA 3EJTA 3QNJA 4EZWA 3QNIA 2X3VA 2OP6A 4HR1B 4FZOA 2QXLA 3D51A 4AVMA 2OZNB 3SBTB 3B51X 4IWPA 4EZPA 3KAWA 3G9GA 3CZNA 1SU6A 3T49A 1CKRA 3QWEA 1LQ7A 2YLAA 3BUDA 1ZWWA 2D4CA 3DPQA 4ILGA 3ZEDA 4FZPA 4JLCA 2YL8A 4ILHB 4AZ6A 4AZ5A 4AZIA 4JWEA 3BVUA 2ELBA 4G6QA 3Q0KA 3SOGA 1E9VA 4NQIA 2QFFA 2YLLA 3A98A
chains in the Genus database with same CATH topology
2EWFA 1GNTA 2LM0A 3GI7A 2YIBA 4R5LA 4HYBA 4R5JA 2YIVX 3T4AG 3KDRA 1Q5LA 2V7YA 2Z8YA 1OAOA 3O3OB 3L3OM 3DQGA 4PO2A 4E81A 3LMFA 2RT6A 4R5IA 3OWGA 3RV0A 1OA0A 2JNSA 4JWDA 4UDYX 5FLEX 4EZRA 3ER9B 3C7NB 4JWIA 4I43A 1DKYA 5FIGA 4UDXX 1JQKA 1OA1A 7HSCA 4F01A 1DG4A 2OBMA 4FM3A 3ZEFA 4IM3A 4ILIA 4EZSA 2YI8A 2PY6A 4E3CA 4R5KA 4H6IA 3KAVA 3T46A 4JN4A 4NPHA 3T48A 4EZUA 1E2UA 2ND1A 4EZQA 3QNJA 2WINM 4EZWA 4IWQA 1GN9A 3OHXM 3I04A 4FL9A 4HR1A 1W9MA 3VEBA 2OP6A 4HR1B 4IM2A 2YI9A 2X5CA 2QXLA 3VEAA 3H0XA 1SUFA 4F00A 3B53X 1SU8A 2N3KA 4EZTA 4D8JA 2GAFD 3I39X 3O3NB 2KHOA 4H6HA 4EZNA 3SBTB 4EZVA 1GNLA 3B51X 4IWPA 4IW0A 3DPPA 1U00A 4EZPA 4M0MA 4IWOA 3ER8C 5E84A 3KAWA 2NCZA 3UITA 3ERCC 4JWCA 2EX3B 3RV1A 3I01A 4KIKA 4R5GA 1SU6A 4IM0A 3T49A 3DOBA 4MQDA 3QA8A 3D2FA 1BPRA 3O3MB 2ND0A 1DKZA 1SU7A 4EZYA 2OBLA 2GA9D 4JNFA 4HY9A 1MJGA 1CKRA 4JNEA 4JL9A 3N8EA 3F7WA 1DKXA 5TKYA 4EZOA 3DPQA 4ILGA 4EZXA 4WV7A 3ZEDA 3FD9A 2BPRA 3SBSA 4JLCA 4ILHB 1UPXA 3C7NA 3B52X 2YIAA 4EZZA 4JWEA 4KIKB 3VKHA 1YUWA 4G6QA 3D2EA 4WV5A 1E9VA 3DPOA 2QFFA 3T47A 1E1DA 1ZYLA 3A98A 4B9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5K A;  4H6I A;  4EZN A;  4EZV A;  3T46 A;  1DKX A;  4JN4 A;  3T48 A;  4EZU A;  4R5L A;  4HYB A;  4R5J A;  3DPP A;  3T4A G;  1U00 A;  5TKY A;  4EZP A;  4EZO A;  4EZQ A;  1Q5L A;  3QNJ A;  2V7Y A;  2WIN M;  3DPQ A;  5E84 A;  4EZW A;  4EZX A;  3L3O M;  2BPR A;  3DQG A;  4WV7 A;  4PO2 A;  3OHX M;  4JWC A;  3C7N A;  4E81 A;  4FL9 A;  4R5I A;  4R5G A;  2KHO A;  2OP6 A;  4JWD A;  3T49 A;  4EZR A;  4EZZ A;  3C7N B;  3DOB A;  4JWI A;  1DKY A;  4JWE A;  3D2F A;  1BPR A;  1YUW A;  2QXL A;  7HSC A;  1DKZ A;  4F01 A;  3D2E A;  4EZY A;  1DG4 A;  4JNF A;  3H0X A;  4WV5 A;  4F00 A;  3DPO A;  4EZT A;  4HY9 A;  2QFF A;  3T47 A;  1CKR A;  4JNE A;  4EZS A;  3N8E A;  4H6H A;  4B9Q A; 
#chains in the Genus database with same CATH topology
 2YIB A;  4HYB A;  3T4A G;  1Q5L A;  2Z8Y A;  3DQG A;  2RT6 A;  3D4Z A;  4R5I A;  4JWI A;  2Z0N A;  1DG4 A;  3D4Y A;  2F7P A;  1TQW A;  4E3C A;  1HTY A;  1I4D A;  4EZU A;  1E2U A;  2PMR A;  3OHX M;  3I04 A;  4HR1 A;  3VEB A;  3EJU A;  3DDF A;  3BUP A;  3H0X A;  1SUF A;  1SU8 A;  4BNE A;  3CV5 A;  3DX0 A;  2C08 A;  2KHO A;  4EZN A;  1R33 A;  1GNL A;  1Y2O A;  4IWO A;  3ER8 C;  2NCZ A;  2EX3 B;  3I01 A;  2YKT A;  1BPR A;  3O3M B;  3CAZ A;  1DKZ A;  4HY9 A;  4JL9 A;  3BUB A;  1I4T A;  3EJQ A;  1DKX A;  3I2W A;  2MI7 A;  1X03 A;  4WV7 A;  4EZX A;  3FD9 A;  1UPX A;  4AZ7 A;  2QKW A;  2WYI A;  3VKH A;  3D2E A;  3PLT A;  3EJP A;  2YL5 A;  2EWF A;  1GNT A;  2X3W A;  4R5L A;  2YIV X;  3KDR A;  2ALW A;  1OAO A;  3BLB A;  2Z0V A;  3Q84 A;  3LMF A;  1TQV A;  3HAH A;  1HXK A;  1OA0 A;  4JWD A;  5FLE X;  4I43 A;  1DKY A;  1PS3 A;  4F01 A;  4AZG A;  4FM3 A;  2Q12 A;  3ZEF A;  2F1B A;  2YI8 A;  2PY6 A;  4WPE A;  4R5K A;  3D52 A;  2WYH A;  1R34 A;  2ND1 A;  4EZQ A;  2WIN M;  4IWQ A;  1GN9 A;  4DYL A;  4FL9 A;  2YL6 A;  4NSW A;  3LVT A;  4DCN C;  3VEA A;  3BUQ A;  4F00 A;  3QE6 A;  2GAF D;  1QWN A;  3O3N B;  4AZC B;  4WPC A;  4EZV A;  3DDG A;  3DX2 A;  3HAJ A;  4IW0 A;  3CZS A;  3RPM A;  1U00 A;  3EJS A;  2RAI A;  3ERC C;  4AKV A;  4JWC A;  1QWU A;  3RV1 A;  3CVR A;  4R5G A;  1YWM A;  2ZXQ A;  2ND0 A;  1SU7 A;  4EZY A;  2GA9 D;  2FYV A;  2O0I 1;  3BVW A;  3HAI A;  1O7D C;  4JNE A;  2F7R A;  3N8E A;  2Q13 A;  1O7D B;  3SBS A;  3BVV A;  5C5B A;  4FZS A;  2YIA A;  3DYT A;  4EZZ A;  3ABH A;  4AZH A;  1YUW A;  1QX1 A;  5KBP A;  4WV5 A;  3DPO A;  4H8S A;  2F7Q A;  3T47 A;  4B9Q A;  3DX4 A;  4R5J A;  2V7Y A;  2D1L A;  3O3O B;  3L3O M;  4PO2 A;  2RAJ A;  4E81 A;  4I1Q A;  2GF4 A;  3RV0 A;  2JNS A;  5C5B B;  5FIG A;  4UDX X;  1JQK A;  7HSC A;  2RAK A;  4IM3 A;  3D50 A;  2OW7 A;  2EFK A;  4JN4 A;  3T48 A;  1WDZ A;  3SYV A;  1W9M A;  1TQT A;  3CKD A;  4IM2 A;  2YI9 A;  2X5C A;  2V0O A;  1HWW A;  3L3P A;  3B53 X;  2N3K A;  3M3W A;  4EZT A;  4AZB A;  4D8J A;  4AZC A;  3I39 X;  4H6H A;  3DPP A;  3OK8 A;  4M0M A;  2YL9 A;  4ATM A;  5E84 A;  3UIT A;  2EFL A;  3EJR A;  4KIK A;  2OO2 A;  4IM0 A;  3DOB A;  4MQD A;  3QA8 A;  3D2F A;  2OW6 A;  2JNK A;  1I49 A;  2OBL A;  4JNF A;  1MJG A;  3BUI A;  3F7W A;  1URU A;  5TKY A;  4EZO A;  2FIC A;  3BVT A;  2LXY A;  1TQU A;  1I4L A;  2BPR A;  3C7N A;  3DX3 A;  3B52 X;  1X04 A;  4KIK B;  3LLL A;  1TQS A;  2F18 A;  3ACO A;  2X3X A;  1E1D A;  1ZYL A;  2LM0 A;  3GI7 A;  1R5E A;  3BVX A;  3DX1 A;  3OWG A;  3ER9 B;  2Z0O A;  4UDY X;  4EZR A;  3C7N B;  1OA1 A;  2OBM A;  2F7O A;  4ILI A;  2F1A A;  4EZS A;  4H6I A;  3KAV A;  3T46 A;  4NPH A;  3EJT A;  3QNJ A;  4EZW A;  3QNI A;  2X3V A;  2OP6 A;  4HR1 B;  4FZO A;  2QXL A;  3D51 A;  4AVM A;  2OZN B;  3SBT B;  3B51 X;  4IWP A;  4EZP A;  3KAW A;  3G9G A;  3CZN A;  1SU6 A;  3T49 A;  1CKR A;  3QWE A;  1LQ7 A;  2YLA A;  3BUD A;  1ZWW A;  2D4C A;  3DPQ A;  4ILG A;  3ZED A;  4FZP A;  4JLC A;  2YL8 A;  4ILH B;  4AZ6 A;  4AZ5 A;  4AZI A;  4JWE A;  3BVU A;  2ELB A;  4G6Q A;  3Q0K A;  3SOG A;  1E9V A;  4NQI A;  2QFF A;  2YLL A;  3A98 A; 
#chains in the Genus database with same CATH homology
 2EWF A;  1GNT A;  2LM0 A;  3GI7 A;  2YIB A;  4R5L A;  4HYB A;  4R5J A;  2YIV X;  3T4A G;  3KDR A;  1Q5L A;  2V7Y A;  2Z8Y A;  1OAO A;  3O3O B;  3L3O M;  3DQG A;  4PO2 A;  4E81 A;  3LMF A;  2RT6 A;  4R5I A;  3OWG A;  3RV0 A;  1OA0 A;  2JNS A;  4JWD A;  4UDY X;  5FLE X;  4EZR A;  3ER9 B;  3C7N B;  4JWI A;  4I43 A;  1DKY A;  5FIG A;  4UDX X;  1JQK A;  1OA1 A;  7HSC A;  4F01 A;  1DG4 A;  2OBM A;  4FM3 A;  3ZEF A;  4IM3 A;  4ILI A;  4EZS A;  2YI8 A;  2PY6 A;  4E3C A;  4R5K A;  4H6I A;  3KAV A;  3T46 A;  4JN4 A;  4NPH A;  3T48 A;  4EZU A;  1E2U A;  2ND1 A;  4EZQ A;  3QNJ A;  2WIN M;  4EZW A;  4IWQ A;  1GN9 A;  3OHX M;  3I04 A;  4FL9 A;  4HR1 A;  1W9M A;  3VEB A;  2OP6 A;  4HR1 B;  4IM2 A;  2YI9 A;  2X5C A;  2QXL A;  3VEA A;  3H0X A;  1SUF A;  4F00 A;  3B53 X;  1SU8 A;  2N3K A;  4EZT A;  4D8J A;  2GAF D;  3I39 X;  3O3N B;  2KHO A;  4H6H A;  4EZN A;  3SBT B;  4EZV A;  1GNL A;  3B51 X;  4IWP A;  4IW0 A;  3DPP A;  1U00 A;  4EZP A;  4M0M A;  4IWO A;  3ER8 C;  5E84 A;  3KAW A;  2NCZ A;  3UIT A;  3ERC C;  4JWC A;  2EX3 B;  3RV1 A;  3I01 A;  4KIK A;  4R5G A;  1SU6 A;  4IM0 A;  3T49 A;  3DOB A;  4MQD A;  3QA8 A;  3D2F A;  1BPR A;  3O3M B;  2ND0 A;  1DKZ A;  1SU7 A;  4EZY A;  2OBL A;  2GA9 D;  4JNF A;  4HY9 A;  1MJG A;  1CKR A;  4JNE A;  4JL9 A;  3N8E A;  3F7W A;  1DKX A;  5TKY A;  4EZO A;  3DPQ A;  4ILG A;  4EZX A;  4WV7 A;  3ZED A;  3FD9 A;  2BPR A;  3SBS A;  4JLC A;  4ILH B;  1UPX A;  3C7N A;  3B52 X;  2YIA A;  4EZZ A;  4JWE A;  4KIK B;  3VKH A;  1YUW A;  4G6Q A;  3D2E A;  4WV5 A;  1E9V A;  3DPO A;  2QFF A;  3T47 A;  1E1D A;  1ZYL A;  3A98 A;  4B9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...