1DKZA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 native crystals
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUBSTRATE BINDING DOMAIN OF DNAK
publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
molecule tags Complex (molecular chaperone/peptide)
total genus 62
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkzA01
5TKYA 4EZPA 4R5JA 4EZXA 2OP6A 3DQGA 1DKXA 3T46A 4R5LA 4EZSA 2KHOA 4JNFA 4H6IA 4R5IA 3DPPA 3DOBA 2WINM 4JWCA 3DPOA 3T4AG 4JWDA 4EZTA 4EZWA 4F01A 4F00A 2BPRA 4WV7A 4HYBA 2V7YA 4FL9A 3H0XA 3DPQA 3T49A 4EZYA 3C7NA 4HY9A 4EZOA 4EZQA 1CKRA 3T48A 4JWEA 4B9QA 4E81A 4EZUA 3QNJA 1Q5LA 4WV5A 7HSCA 3D2FA 4R5KA 4EZVA 3C7NB 1DG4A 1BPRA 2QXLA 3L3OM 1DKZA 3D2EA 3T47A 2QFFA 1YUWA 4EZRA 3OHXM 4H6HA 4JWIA 4JN4A 4JNEA 4R5GA 5E84A 4EZZA 4PO2A 1U00A 1DKYA 3N8EA 4EZNA
chains in the Genus database with same CATH superfamily
4FZOA 2Z0OA 4EZXA 1TQWA 3D50A 3EJSA 3DDFA 3T49A 3T48A 3PLTA 2YLAA 1O7DC 4R5KA 1LQ7A 2YLLA 1Y2OA 3ERCC 3EJUA 1DKXA 4EZSA 1JQKA 4JNFA 4H6IA 3DPPA 4EZWA 1QWUA 4FZPA 4DCNC 2OBLA 4EZOA 2C08A 1TQUA 1BPRA 2WYHA 4H8SA 1I4LA 1R33A 4JN4A 3LVTA 3O3NB 3I04A 2ND1A 5KBPA 1E2UA 2WINM 2OW6A 4F01A 3EJPA 3DX3A 4NQIA 4EZQA 4E81A 4IWPA 4WV5A 3CZNA 2OW7A 2GF4A 2QXLA 3ABHA 2QFFA 2F7RA 5E84A 3N8EA 1PS3A 4IM3A 1ZYLA 3D4YA 5C5BA 4IM0A 2EWFA 2YIAA 4WV7A 2RAJA 2BPRA 4AZGA 5FIGA 3C7NA 2X3VA 1Q5LA 3SBTB 3D52A 3B53X 1I4DA 4IW0A 2FICA 4WPEA 2F7QA 4R5JA 3ZEFA 4ILIA 3BUPA 1TQVA 2X3WA 1I4TA 3L3OM 4EZRA 1X04A 3DX4A 1HXKA 1YWMA 2QKWA 3B52X 4AZCA 4HR1A 2F18A 2JNKA 2X3XA 1HTYA 2F7OA 1DG4A 3RV0A 2JNSA 3T47A 3BLBA 3ER8C 3LLLA 1O7DB 3D51A 4ATMA 4PO2A 3SOGA 2YIBA 3BVUA 3KDRA 4EZPA 1R5EA 2KHOA 4JWCA 2RAIA 4IM2A 1TQTA 4EZUA 4EZVA 4ILGA 2EFLA 4NPHA 1ZWWA 4EZNA 2V0OA 2Q12A 1GN9A 4UDYX 2YL9A 1E1DA 1OAOA 3VEAA 2OP6A 3DQGA 3Q84A 4G6QA 3VKHA 5TKYA 3QWEA 1GNTA 4R5LA 5FLEX 4F00A 2Z8YA 4HYBA 4AVMA 4M0MA 2LM0A 1HWWA 1URUA 3SBSA 3I2WA 1YUWA 2FYVA 2X5CA 3KAVA 3QE6A 4NSWA 3EJQA 3T46A 2F1BA 4AZ5A 3ER9B 4ILHB 2Z0NA 2OZNB 3M3WA 3QNJA 2YL5A 2F7PA 4AKVA 3O3OB 2NCZA 2YL8A 1U00A 3BUBA 2D1LA 4JLCA 4AZHA 4JL9A 3T4AG 3DPOA 4JWDA 3CKDA 3FD9A 4MQDA 3DYTA 3DX0A 5C5BB 2EX3B 2RT6A 3F7WA 3D2FA 4IWOA 4AZ6A 3UITA 3C7NB 3DDGA 3Q0KA 2N3KA 3ZEDA 3GI7A 3HAJA 2WYIA 4EZTA 3RPMA 1SU6A 3D4ZA 4B9QA 4I43A 4KIKB 3DX2A 2OO2A 3BVWA 1DKZA 3D2EA 4JWIA 4R5GA 4UDXX 2OBMA 3CZSA 4AZ7A 2YI9A 2ND0A 3EJTA 4AZIA 4R5IA 3BUQA 2V7YA 2ELBA 1CKRA 1SUFA 4EZYA 4HY9A 1SU7A 2Q13A 3OK8A 2GAFD 3SYVA 2PMRA 4AZCB 3BVXA 2O0I1 2ZXQA 4WPCA 1R34A 4HR1B 4H6HA 4JNEA 4E3CA 1DKYA 1TQSA 2YKTA 1X03A 4AZBA 3CVRA 3DX1A 2F1AA 1QX1A 3G9GA 4FZSA 3DPQA 3RV1A 4FM3A 3B51X 2YL6A 1UPXA 3L3PA 3BVTA 2ALWA 2RAKA 3BUIA 3HAHA 3CAZA 4DYLA 3A98A 2Z0VA 1GNLA 4D8JA 3KAWA 7HSCA 1W9MA 2MI7A 3I39X 3BUDA 3I01A 4EZZA 1I49A 1SU8A 2YI8A 1WDZA 3BVVA 2YIVX 4KIKA 3DOBA 3VEBA 1QWNA 3O3MB 1OA1A 2GA9D 1OA0A 4FL9A 4I1QA 3QA8A 2LXYA 2PY6A 2EFKA 3HAIA 4JWEA 3CV5A 4BNEA 3OWGA 3QNIA 3EJRA 3ACOA 2D4CA 1MJGA 1E9VA 4IWQA 3OHXM 3LMFA 3H0XA
chains in the Genus database with same CATH topology
2OBMA 5TKYA 4R5JA 4EZXA 1GNTA 2YI9A 3ZEFA 4R5LA 4ILIA 2ND0A 4R5IA 5FLEX 4F00A 2Z8YA 4HYBA 2V7YA 4M0MA 3T49A 1SUFA 4EZYA 2LM0A 4HY9A 1SU7A 1CKRA 3T48A 2GAFD 3SBSA 4R5KA 3L3OM 1YUWA 4EZRA 4HR1B 4H6HA 4JNEA 4E3CA 2X5CA 1DKYA 3KAVA 3ERCC 3DQGA 1DKXA 3B52X 3T46A 4EZSA 1JQKA 4JNFA 4H6IA 3DPPA 4EZWA 3ER9B 4ILHB 3DPQA 2OBLA 4EZOA 4HR1A 3RV1A 3QNJA 4FM3A 3B51X 1DG4A 3RV0A 1BPRA 1UPXA 2JNSA 3O3OB 3T47A 4JN4A 3ER8C 2NCZA 4PO2A 1U00A 4JLCA 2YIBA 3KDRA 3O3NB 4EZPA 3I04A 2ND1A 2OP6A 4JL9A 2KHOA 1E2UA 2WINM 3DPOA 4JWCA 4JWDA 3T4AG 4F01A 3FD9A 3A98A 4IM2A 4MQDA 1GNLA 4EZQA 4D8JA 2EX3B 2RT6A 3F7WA 3KAWA 4IWPA 4E81A 4EZUA 4WV5A 7HSCA 3D2FA 1W9MA 4EZVA 4IWOA 4ILGA 3I39X 3UITA 3VKHA 2QXLA 4NPHA 3C7NB 2QFFA 3I01A 5E84A 4EZZA 1SU8A 3N8EA 2N3KA 2YI8A 4IM3A 3ZEDA 1ZYLA 4EZNA 2YIVX 4KIKA 3GI7A 4IM0A 3DOBA 3VEBA 2EWFA 2YIAA 3O3MB 4WV7A 1OA1A 2GA9D 4EZTA 2BPRA 1OA0A 4FL9A 1SU6A 3QA8A 2PY6A 5FIGA 3C7NA 4JWEA 4B9QA 4I43A 1GN9A 4KIKB 1Q5LA 3OWGA 3SBTB 4UDYX 1E1DA 1OAOA 1MJGA 1E9VA 1DKZA 3D2EA 3B53X 3OHXM 4IWQA 4JWIA 4R5GA 4UDXX 3VEAA 4IW0A 3LMFA 3H0XA 4G6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKY A;  4EZP A;  4R5J A;  4EZX A;  2OP6 A;  3DQG A;  1DKX A;  3T46 A;  4R5L A;  4EZS A;  2KHO A;  4JNF A;  4H6I A;  4R5I A;  3DPP A;  3DOB A;  2WIN M;  4JWC A;  3DPO A;  3T4A G;  4JWD A;  4EZT A;  4EZW A;  4F01 A;  4F00 A;  2BPR A;  4WV7 A;  4HYB A;  2V7Y A;  4FL9 A;  3H0X A;  3DPQ A;  3T49 A;  4EZY A;  3C7N A;  4HY9 A;  4EZO A;  4EZQ A;  1CKR A;  3T48 A;  4JWE A;  4B9Q A;  4E81 A;  4EZU A;  3QNJ A;  1Q5L A;  4WV5 A;  7HSC A;  3D2F A;  4R5K A;  4EZV A;  3C7N B;  1DG4 A;  1BPR A;  2QXL A;  3L3O M;  1DKZ A;  3D2E A;  3T47 A;  2QFF A;  1YUW A;  4EZR A;  3OHX M;  4H6H A;  4JWI A;  4JN4 A;  4JNE A;  4R5G A;  5E84 A;  4EZZ A;  4PO2 A;  1U00 A;  1DKY A;  3N8E A;  4EZN A; 
#chains in the Genus database with same CATH topology
 4FZO A;  2Z0O A;  4EZX A;  1TQW A;  3D50 A;  3EJS A;  3DDF A;  3T49 A;  3T48 A;  3PLT A;  2YLA A;  1O7D C;  4R5K A;  1LQ7 A;  2YLL A;  1Y2O A;  3ERC C;  3EJU A;  1DKX A;  4EZS A;  1JQK A;  4JNF A;  4H6I A;  3DPP A;  4EZW A;  1QWU A;  4FZP A;  4DCN C;  2OBL A;  4EZO A;  2C08 A;  1TQU A;  1BPR A;  2WYH A;  4H8S A;  1I4L A;  1R33 A;  4JN4 A;  3LVT A;  3O3N B;  3I04 A;  2ND1 A;  5KBP A;  1E2U A;  2WIN M;  2OW6 A;  4F01 A;  3EJP A;  3DX3 A;  4NQI A;  4EZQ A;  4E81 A;  4IWP A;  4WV5 A;  3CZN A;  2OW7 A;  2GF4 A;  2QXL A;  3ABH A;  2QFF A;  2F7R A;  5E84 A;  3N8E A;  1PS3 A;  4IM3 A;  1ZYL A;  3D4Y A;  5C5B A;  4IM0 A;  2EWF A;  2YIA A;  4WV7 A;  2RAJ A;  2BPR A;  4AZG A;  5FIG A;  3C7N A;  2X3V A;  1Q5L A;  3SBT B;  3D52 A;  3B53 X;  1I4D A;  4IW0 A;  2FIC A;  4WPE A;  2F7Q A;  4R5J A;  3ZEF A;  4ILI A;  3BUP A;  1TQV A;  2X3W A;  1I4T A;  3L3O M;  4EZR A;  1X04 A;  3DX4 A;  1HXK A;  1YWM A;  2QKW A;  3B52 X;  4AZC A;  4HR1 A;  2F18 A;  2JNK A;  2X3X A;  1HTY A;  2F7O A;  1DG4 A;  3RV0 A;  2JNS A;  3T47 A;  3BLB A;  3ER8 C;  3LLL A;  1O7D B;  3D51 A;  4ATM A;  4PO2 A;  3SOG A;  2YIB A;  3BVU A;  3KDR A;  4EZP A;  1R5E A;  2KHO A;  4JWC A;  2RAI A;  4IM2 A;  1TQT A;  4EZU A;  4EZV A;  4ILG A;  2EFL A;  4NPH A;  1ZWW A;  4EZN A;  2V0O A;  2Q12 A;  1GN9 A;  4UDY X;  2YL9 A;  1E1D A;  1OAO A;  3VEA A;  2OP6 A;  3DQG A;  3Q84 A;  4G6Q A;  3VKH A;  5TKY A;  3QWE A;  1GNT A;  4R5L A;  5FLE X;  4F00 A;  2Z8Y A;  4HYB A;  4AVM A;  4M0M A;  2LM0 A;  1HWW A;  1URU A;  3SBS A;  3I2W A;  1YUW A;  2FYV A;  2X5C A;  3KAV A;  3QE6 A;  4NSW A;  3EJQ A;  3T46 A;  2F1B A;  4AZ5 A;  3ER9 B;  4ILH B;  2Z0N A;  2OZN B;  3M3W A;  3QNJ A;  2YL5 A;  2F7P A;  4AKV A;  3O3O B;  2NCZ A;  2YL8 A;  1U00 A;  3BUB A;  2D1L A;  4JLC A;  4AZH A;  4JL9 A;  3T4A G;  3DPO A;  4JWD A;  3CKD A;  3FD9 A;  4MQD A;  3DYT A;  3DX0 A;  5C5B B;  2EX3 B;  2RT6 A;  3F7W A;  3D2F A;  4IWO A;  4AZ6 A;  3UIT A;  3C7N B;  3DDG A;  3Q0K A;  2N3K A;  3ZED A;  3GI7 A;  3HAJ A;  2WYI A;  4EZT A;  3RPM A;  1SU6 A;  3D4Z A;  4B9Q A;  4I43 A;  4KIK B;  3DX2 A;  2OO2 A;  3BVW A;  1DKZ A;  3D2E A;  4JWI A;  4R5G A;  4UDX X;  2OBM A;  3CZS A;  4AZ7 A;  2YI9 A;  2ND0 A;  3EJT A;  4AZI A;  4R5I A;  3BUQ A;  2V7Y A;  2ELB A;  1CKR A;  1SUF A;  4EZY A;  4HY9 A;  1SU7 A;  2Q13 A;  3OK8 A;  2GAF D;  3SYV A;  2PMR A;  4AZC B;  3BVX A;  2O0I 1;  2ZXQ A;  4WPC A;  1R34 A;  4HR1 B;  4H6H A;  4JNE A;  4E3C A;  1DKY A;  1TQS A;  2YKT A;  1X03 A;  4AZB A;  3CVR A;  3DX1 A;  2F1A A;  1QX1 A;  3G9G A;  4FZS A;  3DPQ A;  3RV1 A;  4FM3 A;  3B51 X;  2YL6 A;  1UPX A;  3L3P A;  3BVT A;  2ALW A;  2RAK A;  3BUI A;  3HAH A;  3CAZ A;  4DYL A;  3A98 A;  2Z0V A;  1GNL A;  4D8J A;  3KAW A;  7HSC A;  1W9M A;  2MI7 A;  3I39 X;  3BUD A;  3I01 A;  4EZZ A;  1I49 A;  1SU8 A;  2YI8 A;  1WDZ A;  3BVV A;  2YIV X;  4KIK A;  3DOB A;  3VEB A;  1QWN A;  3O3M B;  1OA1 A;  2GA9 D;  1OA0 A;  4FL9 A;  4I1Q A;  3QA8 A;  2LXY A;  2PY6 A;  2EFK A;  3HAI A;  4JWE A;  3CV5 A;  4BNE A;  3OWG A;  3QNI A;  3EJR A;  3ACO A;  2D4C A;  1MJG A;  1E9V A;  4IWQ A;  3OHX M;  3LMF A;  3H0X A; 
#chains in the Genus database with same CATH homology
 2OBM A;  5TKY A;  4R5J A;  4EZX A;  1GNT A;  2YI9 A;  3ZEF A;  4R5L A;  4ILI A;  2ND0 A;  4R5I A;  5FLE X;  4F00 A;  2Z8Y A;  4HYB A;  2V7Y A;  4M0M A;  3T49 A;  1SUF A;  4EZY A;  2LM0 A;  4HY9 A;  1SU7 A;  1CKR A;  3T48 A;  2GAF D;  3SBS A;  4R5K A;  3L3O M;  1YUW A;  4EZR A;  4HR1 B;  4H6H A;  4JNE A;  4E3C A;  2X5C A;  1DKY A;  3KAV A;  3ERC C;  3DQG A;  1DKX A;  3B52 X;  3T46 A;  4EZS A;  1JQK A;  4JNF A;  4H6I A;  3DPP A;  4EZW A;  3ER9 B;  4ILH B;  3DPQ A;  2OBL A;  4EZO A;  4HR1 A;  3RV1 A;  3QNJ A;  4FM3 A;  3B51 X;  1DG4 A;  3RV0 A;  1BPR A;  1UPX A;  2JNS A;  3O3O B;  3T47 A;  4JN4 A;  3ER8 C;  2NCZ A;  4PO2 A;  1U00 A;  4JLC A;  2YIB A;  3KDR A;  3O3N B;  4EZP A;  3I04 A;  2ND1 A;  2OP6 A;  4JL9 A;  2KHO A;  1E2U A;  2WIN M;  3DPO A;  4JWC A;  4JWD A;  3T4A G;  4F01 A;  3FD9 A;  3A98 A;  4IM2 A;  4MQD A;  1GNL A;  4EZQ A;  4D8J A;  2EX3 B;  2RT6 A;  3F7W A;  3KAW A;  4IWP A;  4E81 A;  4EZU A;  4WV5 A;  7HSC A;  3D2F A;  1W9M A;  4EZV A;  4IWO A;  4ILG A;  3I39 X;  3UIT A;  3VKH A;  2QXL A;  4NPH A;  3C7N B;  2QFF A;  3I01 A;  5E84 A;  4EZZ A;  1SU8 A;  3N8E A;  2N3K A;  2YI8 A;  4IM3 A;  3ZED A;  1ZYL A;  4EZN A;  2YIV X;  4KIK A;  3GI7 A;  4IM0 A;  3DOB A;  3VEB A;  2EWF A;  2YIA A;  3O3M B;  4WV7 A;  1OA1 A;  2GA9 D;  4EZT A;  2BPR A;  1OA0 A;  4FL9 A;  1SU6 A;  3QA8 A;  2PY6 A;  5FIG A;  3C7N A;  4JWE A;  4B9Q A;  4I43 A;  1GN9 A;  4KIK B;  1Q5L A;  3OWG A;  3SBT B;  4UDY X;  1E1D A;  1OAO A;  1MJG A;  1E9V A;  1DKZ A;  3D2E A;  3B53 X;  3OHX M;  4IWQ A;  4JWI A;  4R5G A;  4UDX X;  3VEA A;  4IW0 A;  3LMF A;  3H0X A;  4G6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...